Profile Details

Last technology detected on 24th October 2024. We know of 4 technologies on this page and 10 technologies removed from canadianpacificrailwaylimited.biz since 31st December 2018. Link to this page.

Add BuiltWith to for free! Get lookups easily and quickly.

Get a notification when canadianpacificrailwaylimited.biz adds new technologies.

Get canadianpacificrailwaylimited.biz profile as an XML, JSON, CSV or XLSX via the Domain API.

Suggest a Technology

Can't find the technology you are looking for? Send us a suggestion, we will try and add it to our database.