Amazon Usage Statistics · Download List of All Websites using Amazon
This site is hosted on Amazon AWS EC2 Infrastructure.
Cloud Hosting · Cloud PaaS
Amazon Virginia Region Usage Statistics · Download List of All Websites using Amazon Virginia Region
Amazon Hosted EC2 Instances in Virginia
U.S. Server Location Usage Statistics · Download List of All Websites using U.S. Server Location
The web server is located in the United States.
Server Location
Amazon S3 CDN Usage Statistics · Download List of All Websites using Amazon S3 CDN
Amazon S3 is storage for the Internet. It is designed to make web-scale computing easier for developers.
Last technology detected on 24th October 2024. We know of 4 technologies on this page and 10 technologies removed from canadianpacificrailwaylimited.biz since 31st December 2018. Link to this page.
Add BuiltWith to for free! Get lookups easily and quickly.
Get a notification when canadianpacificrailwaylimited.biz adds new technologies.
Get canadianpacificrailwaylimited.biz profile as an XML, JSON, CSV or XLSX via the Domain API.
Can't find the technology you are looking for? Send us a suggestion, we will try and add it to our database.