Email Hosting Providers

GoDaddy EmailGoDaddy Email

GoDaddy Email Usage Statistics · Download List of All Websites using GoDaddy Email

GoDaddy email provides a personalized address but protection against viruses and spam and includes tools like Calendar.

Web Hosting Provider Email

Web Hosting Providers

AWS Global AcceleratorAWS Global Accelerator

AWS Global Accelerator Usage Statistics · Download List of All Websites using AWS Global Accelerator

Networking service that sends traffic through Amazon Web Service’s global network infrastructure for performance improvements.

Cloud Hosting

Profile Details

Last technology detected on 20th January 2025. We know of 4 technologies on this page and 19 technologies removed from losangelescertifiedfamilylawspecialist.com since 31st May 2018. Link to this page.

Add BuiltWith to for free! Get lookups easily and quickly.

Get a notification when losangelescertifiedfamilylawspecialist.com adds new technologies.

Get losangelescertifiedfamilylawspecialist.com profile as an XML, JSON, CSV or XLSX via the Domain API.

Suggest a Technology

Can't find the technology you are looking for? Send us a suggestion, we will try and add it to our database.