Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

ANABOLIZANDO.BUSCAFEITA.COM

ANABOLIZANDO.BUSCAFEITA.COM
Shared Attributes
Domain
centuryconcreteinc.com centuryconcreteinc.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
antrimguardian.co.uk antrimguardian.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
aaamazingjunk.com aaamazingjunk.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Aug 2023 206 days
aanmeldsystemen.nl aanmeldsystemen.nl
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Mar 2023 Oct 2023 209 days
abbigliamentocharmantalghero.com abbigliamentocharmantalghero.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 May 2023 96 days
abcdeporte.com.ar abcdeporte.com.ar
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
g3w.be actions.g3w.be
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
m3m.be actions.m3m.be
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adoreevents.com.au adoreevents.com.au
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
accroo.ca accroo.ca
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adlerdogs.be adlerdogs.be
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adhope.org adhope.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adultcarehunters.net adultcarehunters.net
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adamsfertequip.com adamsfertequip.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
advanceheaders.com.au advanceheaders.com.au
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ilikeout.com adaytochill.ilikeout.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
lozar.kiev.ua advertise.lozar.kiev.ua
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
aexinfo.my.id aexinfo.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jun 2023 122 days
afrishops.co.za afrishops.co.za
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ahimedia.my.id ahimedia.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jun 2023 123 days
ahmazingyou.com ahmazingyou.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jul 2023 164 days
akita.co.kr akita.co.kr
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
akurmedia.my.id akurmedia.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Jul 2023 61 days
alkatekno.my.id alkatekno.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Jun 2023 Jul 2023 41 days
alkatrade.my.id alkatrade.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jun 2023 123 days
alwaysbeautifulangels.com alwaysbeautifulangels.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Jul 2023 Oct 2023 87 days
ae-admin.com alachua-live.ae-admin.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
althaeabeautydayspa.it althaeabeautydayspa.it
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
allatrade.my.id allatrade.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Jun 2023 17 days
alucol.com.co alucol.com.co
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
alisocreekchurch.org alisocreekchurch.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Apr 2023 Oct 2023 166 days
alptrade.my.id alptrade.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Jul 2023 57 days
albirfamilymedicalcentre.com albirfamilymedicalcentre.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
allfurypets.com allfurypets.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Aug 2023 Oct 2023 44 days
algiracentrocomercial.com algiracentrocomercial.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
alljobscornwall.co.uk alljobscornwall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Apr 2023 Oct 2023 166 days
alm.org alm.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ammaarsaeed.com ammaarsaeed.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Aug 2023 Oct 2023 41 days
americasneeds.com americasneeds.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jun 2023 124 days
ann.com.ng ann.com.ng
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 May 2023 One Off
anabolizandoonline.com.br anabolizandoonline.com.br
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
anasalvadorbaron.com anasalvadorbaron.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
andreafrizzarin.it andreafrizzarin.it
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
apartmani-pag-sobota.com.hr apartmani-pag-sobota.com.hr
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
apmhosting.info apmhosting.info
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
apexskiphire.co.uk apexskiphire.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
alltimberframes.co.uk alltimberframes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
heartsonfire.cn heartsonfire.cn
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Feb 2023 1 day
masterqi.ru masterqi.ru
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
m3m.be acties.m3m.be
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
g3w.be acties.g3w.be
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
activenorcal.com activenorcal.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
accentuatekids.com accentuatekids.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
actionasiaevents.com actionasiaevents.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ae-admin.com acf-live.ae-admin.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adk-architecten.nl adk-architecten.nl
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
audiobras.net adnad.audiobras.net
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Aug 2023 Oct 2023 41 days
qrup313.com adnanoktarkimdir.qrup313.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
advandenhoven.nl advandenhoven.nl
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Mar 2023 43 days
adventa.com adventa.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ae-admin.com adds-nm-live.ae-admin.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
gouv.nc affaires-coutumieres.gouv.nc
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
afrikaitorpesunik.hu afrikaitorpesunik.hu
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
agriturismospinalva.com agriturismospinalva.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
agros.org.br agros.org.br
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
agenziafunebrefabrizi.com agenziafunebrefabrizi.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ahmetnart.com ahmetnart.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jun 2023 123 days
ainfo.my.id ainfo.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Jul 2023 62 days
alhbox.com alhbox.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
alwaysbeingfit.com alwaysbeingfit.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jul 2023 164 days
akdental.org akdental.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 248 days
ae-admin.com alabamastateds-live.ae-admin.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
alwaysshopandsave.com alwaysshopandsave.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jul 2023 164 days
alwaysstayinghealthy.com alwaysstayinghealthy.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 May 2023 108 days
alwaysstayingfit.com alwaysstayingfit.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 May 2023 108 days
alesilaclama.com.tr alesilaclama.com.tr
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
althaeabellezza.it althaeabellezza.it
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
alanyaroyaltemizlik.com alanyaroyaltemizlik.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Aug 2023 Oct 2023 44 days
alpmedia.my.id alpmedia.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jul 2023 164 days
alptekno.my.id alptekno.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Jul 2023 57 days
allmanbrothersstore.com allmanbrothersstore.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Oct 2023 145 days
amoremebel.az amoremebel.az
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jun 2023 124 days
americanimmigrationlaw.com americanimmigrationlaw.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
angelbeautyone.com angelbeautyone.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Jun 2023 Oct 2023 127 days
antimili-youth.net antimili-youth.net
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
aniyah.site aniyah.site
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Mar 2023 44 days
thanhbinhweb.com aniyah.thanhbinhweb.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Mar 2023 32 days
andewegschilders.nl andewegschilders.nl
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 248 days
androkit.net androkit.net
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Mar 2023 Jul 2023 120 days
vivasalud.be acties.vivasalud.be
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
gezinsbond-wichelen.be gezinsbond-wichelen.be
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
garagedoorrepair-renton.com garagedoorrepair-renton.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
abashe.com abashe.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Mar 2023 42 days
abitofthisorthat.com abitofthisorthat.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Jul 2023 Jul 2023 One Off
butterfly-son.nl butterfly-son.nl
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
acad-lab.com acad-lab.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
vivasalud.be actions.vivasalud.be
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Mar 2023 35 days
accounting-basics-for-students.com accounting-basics-for-students.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
acdda.org acdda.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adabusiness.org adabusiness.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adya.co adya.co
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jul 2023 163 days
smtusa.com aeqroofing.smtusa.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Oct 2023 Oct 2023 5 days
agelesshubb.com agelesshubb.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
agrialessandrini.it agrialessandrini.it
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
all-media.gr agroapostolidis.all-media.gr
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 248 days
agrosok.ru agrosok.ru
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 May 2023 102 days
ahsa.me ahsa.me
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Oct 2023 149 days
al-masss.com al-masss.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
akurtrade.my.id akurtrade.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Jul 2023 61 days
alachuacountydental.com alachuacountydental.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
qrup313.com allahucunyasamaq.qrup313.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
alucol.co alucol.co
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 May 2023 108 days
alexopticbali.com alexopticbali.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
almacentorres.com almacentorres.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 248 days
americanoffgridsupplies.com americanoffgridsupplies.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Oct 2023 142 days
anandachillage.com anandachillage.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
webempresas.org anasalvadorbaron.webempresas.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
apekamedia.my.id apekamedia.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jun 2023 124 days
apekatrade.my.id apekatrade.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Oct 2023 138 days
apluspackandship.com apluspackandship.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
bensandbrook.com bensandbrook.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
defense.gov defense.gov
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
aandivendor.in aandivendor.in
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Oct 2023 Oct 2023 4 days
abidingpresence.org abidingpresence.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Mar 2023 Oct 2023 208 days
clubdefundraising.com academia.clubdefundraising.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Jun 2023 Oct 2023 121 days
acmegamall.com acmegamall.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 May 2023 98 days
adaytochill.com adaytochill.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
adds-nm.org adds-nm.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
afpga.fr afpga.fr
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
affittovacanzetrieste.com affittovacanzetrieste.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 247 days
gigro.com agros.gigro.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ags-garantie-salaires.org ags-garantie-salaires.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
aharvest.org aharvest.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
aishwaryagraphics.com aishwaryagraphics.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
akna.my.id akna.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Mar 2023 Jul 2023 121 days
akurtekno.my.id akurtekno.my.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- May 2023 Jul 2023 61 days
akbacaklar.com akbacaklar.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
alhajisuperstar.com alhajisuperstar.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Jun 2023 123 days
alphadent.bg alphadent.bg
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
almodeeraldhaki.com almodeeraldhaki.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ami-esports.eu ami-esports.eu
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
amysandas.com amysandas.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
amithafurnitures.com amithafurnitures.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ampuup.com ampuup.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Apr 2023 Oct 2023 166 days
ambulatorimedicitrieste.com ambulatorimedicitrieste.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
animateacocinar.es animateacocinar.es
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
filminspector.com animatedfilmreviews.filminspector.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Mar 2023 Oct 2023 211 days
angelicvoice.fr angelicvoice.fr
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
analyzemath.com analyzemath.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
andreinicarrozzeria.com andreinicarrozzeria.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
apeb.co.id apeb.co.id
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 248 days
appclarify.com appclarify.com
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
aldaonline.org aldaonline.org
Attribute Value First Detected Last Detected Overlap Duration
AT AT- Feb 2023 Oct 2023 251 days
ANABOLIZANDO.BUSCAFEITA.COM
Non IP Attributes
Attribute First Last
AT AT- Feb 2023 Oct 2023
ANABOLIZANDO.BUSCAFEITA.COM
Overlap Attribute Domains
centuryconcreteinc.com centuryconcreteinc.com
antrimguardian.co.uk antrimguardian.co.uk
aaamazingjunk.com aaamazingjunk.com
aanmeldsystemen.nl aanmeldsystemen.nl
abbigliamentocharmantalghero.com abbigliamentocharmantalghero.com
abcdeporte.com.ar abcdeporte.com.ar
actions.g3w.be actions.g3w.be
actions.m3m.be actions.m3m.be
adoreevents.com.au adoreevents.com.au
accroo.ca accroo.ca
adlerdogs.be adlerdogs.be
adhope.org adhope.org
adultcarehunters.net adultcarehunters.net
adamsfertequip.com adamsfertequip.com
advanceheaders.com.au advanceheaders.com.au
adaytochill.ilikeout.com adaytochill.ilikeout.com
advertise.lozar.kiev.ua advertise.lozar.kiev.ua
aexinfo.my.id aexinfo.my.id
afrishops.co.za afrishops.co.za
ahimedia.my.id ahimedia.my.id
ahmazingyou.com ahmazingyou.com
akita.co.kr akita.co.kr
akurmedia.my.id akurmedia.my.id
alkatekno.my.id alkatekno.my.id
alkatrade.my.id alkatrade.my.id
alwaysbeautifulangels.com alwaysbeautifulangels.com
alachua-live.ae-admin.com alachua-live.ae-admin.com
althaeabeautydayspa.it althaeabeautydayspa.it
allatrade.my.id allatrade.my.id
alucol.com.co alucol.com.co
alisocreekchurch.org alisocreekchurch.org
alptrade.my.id alptrade.my.id
albirfamilymedicalcentre.com albirfamilymedicalcentre.com
allfurypets.com allfurypets.com
algiracentrocomercial.com algiracentrocomercial.com
alljobscornwall.co.uk alljobscornwall.co.uk
alm.org alm.org
ammaarsaeed.com ammaarsaeed.com
americasneeds.com americasneeds.com
ann.com.ng ann.com.ng
anabolizandoonline.com.br anabolizandoonline.com.br
anasalvadorbaron.com anasalvadorbaron.com
andreafrizzarin.it andreafrizzarin.it
apartmani-pag-sobota.com.hr apartmani-pag-sobota.com.hr
apmhosting.info apmhosting.info
apexskiphire.co.uk apexskiphire.co.uk
alltimberframes.co.uk alltimberframes.co.uk
heartsonfire.cn heartsonfire.cn
masterqi.ru masterqi.ru
acties.m3m.be acties.m3m.be
acties.g3w.be acties.g3w.be
activenorcal.com activenorcal.com
accentuatekids.com accentuatekids.com
actionasiaevents.com actionasiaevents.com
acf-live.ae-admin.com acf-live.ae-admin.com
adk-architecten.nl adk-architecten.nl
adnad.audiobras.net adnad.audiobras.net
adnanoktarkimdir.qrup313.com adnanoktarkimdir.qrup313.com
advandenhoven.nl advandenhoven.nl
adventa.com adventa.com
adds-nm-live.ae-admin.com adds-nm-live.ae-admin.com
affaires-coutumieres.gouv.nc affaires-coutumieres.gouv.nc
afrikaitorpesunik.hu afrikaitorpesunik.hu
agriturismospinalva.com agriturismospinalva.com
agros.org.br agros.org.br
agenziafunebrefabrizi.com agenziafunebrefabrizi.com
ahmetnart.com ahmetnart.com
ainfo.my.id ainfo.my.id
alhbox.com alhbox.com
alwaysbeingfit.com alwaysbeingfit.com
akdental.org akdental.org
alabamastateds-live.ae-admin.com alabamastateds-live.ae-admin.com
alwaysshopandsave.com alwaysshopandsave.com
alwaysstayinghealthy.com alwaysstayinghealthy.com
alwaysstayingfit.com alwaysstayingfit.com
alesilaclama.com.tr alesilaclama.com.tr
althaeabellezza.it althaeabellezza.it
alanyaroyaltemizlik.com alanyaroyaltemizlik.com
alpmedia.my.id alpmedia.my.id
alptekno.my.id alptekno.my.id
allmanbrothersstore.com allmanbrothersstore.com
amoremebel.az amoremebel.az
americanimmigrationlaw.com americanimmigrationlaw.com
angelbeautyone.com angelbeautyone.com
antimili-youth.net antimili-youth.net
aniyah.site aniyah.site
aniyah.thanhbinhweb.com aniyah.thanhbinhweb.com
andewegschilders.nl andewegschilders.nl
androkit.net androkit.net
acties.vivasalud.be acties.vivasalud.be
gezinsbond-wichelen.be gezinsbond-wichelen.be
garagedoorrepair-renton.com garagedoorrepair-renton.com
abashe.com abashe.com
abitofthisorthat.com abitofthisorthat.com
butterfly-son.nl butterfly-son.nl
acad-lab.com acad-lab.com
actions.vivasalud.be actions.vivasalud.be
accounting-basics-for-students.com accounting-basics-for-students.com
acdda.org acdda.org
adabusiness.org adabusiness.org
adya.co adya.co
aeqroofing.smtusa.com aeqroofing.smtusa.com
agelesshubb.com agelesshubb.com
agrialessandrini.it agrialessandrini.it
agroapostolidis.all-media.gr agroapostolidis.all-media.gr
agrosok.ru agrosok.ru
ahsa.me ahsa.me
al-masss.com al-masss.com
akurtrade.my.id akurtrade.my.id
alachuacountydental.com alachuacountydental.com
allahucunyasamaq.qrup313.com allahucunyasamaq.qrup313.com
alucol.co alucol.co
alexopticbali.com alexopticbali.com
almacentorres.com almacentorres.com
americanoffgridsupplies.com americanoffgridsupplies.com
anandachillage.com anandachillage.com
anasalvadorbaron.webempresas.org anasalvadorbaron.webempresas.org
apekamedia.my.id apekamedia.my.id
apekatrade.my.id apekatrade.my.id
apluspackandship.com apluspackandship.com
bensandbrook.com bensandbrook.com
defense.gov defense.gov
aandivendor.in aandivendor.in
abidingpresence.org abidingpresence.org
academia.clubdefundraising.com academia.clubdefundraising.com
acmegamall.com acmegamall.com
adaytochill.com adaytochill.com
adds-nm.org adds-nm.org
afpga.fr afpga.fr
affittovacanzetrieste.com affittovacanzetrieste.com
agros.gigro.com agros.gigro.com
ags-garantie-salaires.org ags-garantie-salaires.org
aharvest.org aharvest.org
aishwaryagraphics.com aishwaryagraphics.com
akna.my.id akna.my.id
akurtekno.my.id akurtekno.my.id
akbacaklar.com akbacaklar.com
alhajisuperstar.com alhajisuperstar.com
alphadent.bg alphadent.bg
almodeeraldhaki.com almodeeraldhaki.com
ami-esports.eu ami-esports.eu
amysandas.com amysandas.com
amithafurnitures.com amithafurnitures.com
ampuup.com ampuup.com
ambulatorimedicitrieste.com ambulatorimedicitrieste.com
anabolizando.buscafeita.com anabolizando.buscafeita.com
animateacocinar.es animateacocinar.es
animatedfilmreviews.filminspector.com animatedfilmreviews.filminspector.com
angelicvoice.fr angelicvoice.fr
analyzemath.com analyzemath.com
andreinicarrozzeria.com andreinicarrozzeria.com
apeb.co.id apeb.co.id
appclarify.com appclarify.com
aldaonline.org aldaonline.org
ANABOLIZANDO.BUSCAFEITA.COM
IP History

Click the IP addresses to see over domains using them.