Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

BCBCCONSTRUCTION.COM

BCBCCONSTRUCTION.COM
Shared Attributes
Domain
mmtowing.online mmtowing.online
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
impressivetileinc.com impressivetileinc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
terralandscapeservices.com terralandscapeservices.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
avelarpaintingsolutions.com avelarpaintingsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
genpowerco.com genpowerco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
khdistribution.com khdistribution.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
lurodenterprises.com lurodenterprises.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2022 15 days
mindoutthegutter.com mindoutthegutter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 May 2022 55 days
mneyeinstitute.com mneyeinstitute.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2022 12 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

precisedeliveryservices.com precisedeliveryservices.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2022 21 days
sanitizenowllc.com sanitizenowllc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 53 days
specialtouchcompanion.com specialtouchcompanion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Jan 2023 Jan 2023 One Off
bluegrasssidingandgutter.net bluegrasssidingandgutter.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2022 36 days
weatherfordelectric.com weatherfordelectric.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2022 29 days
youngbloodlawfl.com youngbloodlawfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Jun 2022 104 days
zapempestmiami.com zapempestmiami.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Jul 2022 129 days
chamberslegalteam.com chamberslegalteam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Apr 2022 Apr 2022 One Off
townsquareinteractive.com cigainero.townsquareinteractive.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 May 2022 Jan 2023 254 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

kings-garage.net kings-garage.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
paulmcdermottmasonry.com paulmcdermottmasonry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
polywoodtruckingllc.com polywoodtruckingllc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
allstarpainting.com allstarpainting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
allthingscoveredllc.com allthingscoveredllc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
truthemortgage.com truthemortgage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
brightlightproservices.com brightlightproservices.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
genzerspropertysolutions.com genzerspropertysolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
jmdjanitorial.com jmdjanitorial.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

orrstrucking.com orrstrucking.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2022 19 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

royaldayspa.net royaldayspa.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 53 days
amgtreeservice.net amgtreeservice.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Aug 2022 163 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

tmtrees.com tmtrees.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2022 27 days
watersandsonsexcavation.com watersandsonsexcavation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2022 29 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

dotsacehardware.com dotsacehardware.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 53 days
dreambuilders541.com dreambuilders541.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Oct 2022 Oct 2022 One Off
economyelectricservice.com economyelectricservice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 May 2022 79 days
greenearthlandscaping.net greenearthlandscaping.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2022 47 days
harryssewerdraincleaning.com harryssewerdraincleaning.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Apr 2022 May 2022 35 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

jasoneppinetteconstruction.com jasoneppinetteconstruction.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2022 12 days
jlcaccountingandtaxservices.com jlcaccountingandtaxservices.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 53 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

hermesexpressllc.com hermesexpressllc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
bizyboys.com bizyboys.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

advanceddrainjetting.com advanceddrainjetting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Jun 2022 110 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

wafloorinstallation.com wafloorinstallation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 47 days
cblhomes.com cblhomes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Apr 2022 Oct 2022 174 days
constructionwithstyle.com constructionwithstyle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2022 4 days
constructionwithstyle.net constructionwithstyle.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Nov 2022 Dec 2022 38 days
countlessconstruction.com countlessconstruction.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2022 4 days
hearthandhomeusa.net hearthandhomeusa.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 53 days
jolliffconcrete.com jolliffconcrete.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Jun 2022 86 days
personalinjurysandiegoca.com personalinjurysandiegoca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 53 days
abnnc.com abnnc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
aboveallawningcleaning.com aboveallawningcleaning.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
thewashandtan.com thewashandtan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
venamex.com venamex.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
cjprocleaningga.com cjprocleaningga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
defianceconst.com defianceconst.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
eoeelectric.com eoeelectric.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
molepatrolmo.com molepatrolmo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
recoveryministrieshuntsville.com recoveryministrieshuntsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-194873039 Feb 2022 Feb 2022 One Off
securitylocksmithtxk.com securitylocksmithtxk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2023 358 days
specialtouchcompanioncare.com specialtouchcompanioncare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Apr 2023 Apr 2023 11 days
stevespaintingandremodeling.com stevespaintingandremodeling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 May 2022 64 days
bigdshomeimprovement.com bigdshomeimprovement.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2023 1 year, 13 days
bignastyhillclimb.com bignastyhillclimb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 53 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

wandclandscaping.net wandclandscaping.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Apr 2023 1 year, 53 days
cigainerosigns.com cigainerosigns.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Mar 2023 1 year, 17 days
danielsplumbingllc.com danielsplumbingllc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Jun 2022 113 days
havenenergyandlabor.com havenenergyandlabor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Nov 2022 263 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

mhseamlessguttersinc.com mhseamlessguttersinc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Jul 2022 121 days
moslawncaretx.com moslawncaretx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Feb 2023 350 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

recoveryservicesmobile.com recoveryservicesmobile.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-32817731 Mar 2022 Aug 2022 150 days
BCBCCONSTRUCTION.COM
Non IP Attributes
Attribute First Last
UA UA-32817731 Mar 2022 Apr 2023
UA UA-194873039 Feb 2022 Feb 2022
BCBCCONSTRUCTION.COM
Overlap Attribute Domains
bcbcconstruction.com bcbcconstruction.com
mmtowing.online mmtowing.online
impressivetileinc.com impressivetileinc.com
terralandscapeservices.com terralandscapeservices.com
avelarpaintingsolutions.com avelarpaintingsolutions.com
genpowerco.com genpowerco.com
khdistribution.com khdistribution.com
lurodenterprises.com lurodenterprises.com
mindoutthegutter.com mindoutthegutter.com
mneyeinstitute.com mneyeinstitute.com
central-air.com central-air.com
precisedeliveryservices.com precisedeliveryservices.com
sanitizenowllc.com sanitizenowllc.com
specialtouchcompanion.com specialtouchcompanion.com
bluegrasssidingandgutter.net bluegrasssidingandgutter.net
weatherfordelectric.com weatherfordelectric.com
youngbloodlawfl.com youngbloodlawfl.com
zapempestmiami.com zapempestmiami.com
chamberslegalteam.com chamberslegalteam.com
cigainero.townsquareinteractive.com cigainero.townsquareinteractive.com
homecarenetwork.com homecarenetwork.com
kings-garage.net kings-garage.net
paulmcdermottmasonry.com paulmcdermottmasonry.com
polywoodtruckingllc.com polywoodtruckingllc.com
allstarpainting.com allstarpainting.com
allthingscoveredllc.com allthingscoveredllc.com
truthemortgage.com truthemortgage.com
brightlightproservices.com brightlightproservices.com
genzerspropertysolutions.com genzerspropertysolutions.com
jmdjanitorial.com jmdjanitorial.com
lighthouseandflooring.com lighthouseandflooring.com
michaelphillipswreckerservice.net michaelphillipswreckerservice.net
orrstrucking.com orrstrucking.com
poplinheatandair.com poplinheatandair.com
qdsplacepartyhallandvenue.com qdsplacepartyhallandvenue.com
bluegorillagarage.com bluegorillagarage.com
royaldayspa.net royaldayspa.net
amgtreeservice.net amgtreeservice.net
andysstumpgrinding.com andysstumpgrinding.com
statewidetopchoiceroofing.com statewidetopchoiceroofing.com
thecapitolstrategiesgroup.com thecapitolstrategiesgroup.com
tmtrees.com tmtrees.com
watersandsonsexcavation.com watersandsonsexcavation.com
westgatetavern.com westgatetavern.com
cristinaolsontaxservices.com cristinaolsontaxservices.com
dotsacehardware.com dotsacehardware.com
dreambuilders541.com dreambuilders541.com
economyelectricservice.com economyelectricservice.com
greenearthlandscaping.net greenearthlandscaping.net
harryssewerdraincleaning.com harryssewerdraincleaning.com
harveycedarsmarina.com harveycedarsmarina.com
jasoneppinetteconstruction.com jasoneppinetteconstruction.com
jlcaccountingandtaxservices.com jlcaccountingandtaxservices.com
cooltanz.com cooltanz.com
hermesexpressllc.com hermesexpressllc.com
bizyboys.com bizyboys.com
rpeelectric.com rpeelectric.com
advanceddrainjetting.com advanceddrainjetting.com
southeastbail.com southeastbail.com
agchemicalusa.com agchemicalusa.com
tbiconcreteflooring.com tbiconcreteflooring.com
wafloorinstallation.com wafloorinstallation.com
cblhomes.com cblhomes.com
constructionwithstyle.com constructionwithstyle.com
constructionwithstyle.net constructionwithstyle.net
countlessconstruction.com countlessconstruction.com
hearthandhomeusa.net hearthandhomeusa.net
jolliffconcrete.com jolliffconcrete.com
personalinjurysandiegoca.com personalinjurysandiegoca.com
abnnc.com abnnc.com
aboveallawningcleaning.com aboveallawningcleaning.com
thewashandtan.com thewashandtan.com
venamex.com venamex.com
cjprocleaningga.com cjprocleaningga.com
defianceconst.com defianceconst.com
eoeelectric.com eoeelectric.com
molepatrolmo.com molepatrolmo.com
recoveryministrieshuntsville.com recoveryministrieshuntsville.com
securitylocksmithtxk.com securitylocksmithtxk.com
specialtouchcompanioncare.com specialtouchcompanioncare.com
stevespaintingandremodeling.com stevespaintingandremodeling.com
bigdshomeimprovement.com bigdshomeimprovement.com
bignastyhillclimb.com bignastyhillclimb.com
village-crossroads.net village-crossroads.net
wandclandscaping.net wandclandscaping.net
cigainerosigns.com cigainerosigns.com
danielsplumbingllc.com danielsplumbingllc.com
havenenergyandlabor.com havenenergyandlabor.com
johnschwartzconstruction.com johnschwartzconstruction.com
luftsgarage.com luftsgarage.com
martinbrosconcreteandblacktop.com martinbrosconcreteandblacktop.com
mhseamlessguttersinc.com mhseamlessguttersinc.com
moslawncaretx.com moslawncaretx.com
randallaellisdds.com randallaellisdds.com
recoveryservicesmobile.com recoveryservicesmobile.com
BCBCCONSTRUCTION.COM
IP History

Click the IP addresses to see over domains using them.