BPB.MORTEZASHAMLOO.IR
Shared Attributes
Domain
moonjanebi.com moonjanebi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
OX OX-539074089 Dec 2024 Dec 2024 One Off
OX OX-539164681 Dec 2024 Dec 2024 One Off
OX OX-537127704 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
SMAA SMAA-1100036483 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
PUBM PUBM-157326 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
mortezashamloo.ir mortezashamloo.mortezashamloo.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
SMAA SMAA-1100036483 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mtbrand.ir testaw.mtbrand.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
SMAA SMAA-1100036483 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
ehsanzz.ir bpb245.ehsanzz.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
NEX NEX-650147 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYUTY34 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
PUBM PUBM-157326 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
downdetector.dk downdetector.dk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539164681 Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
OX OX-537127704 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
mkzh2shjyz.top abcds.mkzh2shjyz.top
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYUTY34 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
downdetector.com.ar downdetector.com.ar
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539074089 Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
mtbrand.ir aws.mtbrand.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
OX OX-539164681 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
SMAA SMAA-1100036483 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mounesi.ir ru.mounesi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-537127704 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
PUBM PUBM-157326 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.co.il downdetector.co.il
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
mobailfarid2.ir neginkarimi.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.co.nz downdetector.co.nz
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539074089 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
mohsekarim7.ir bpb.mohsekarim7.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYUTY34 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mounesi.online falk.mounesi.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-539074089 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.cl downdetector.cl
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539074089 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
calculateact.com calculateact.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
OX OX-539074089 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
OX OX-537127704 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
moonfix.ir log.moonfix.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
moonfix.ir moonfix.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.com.co downdetector.com.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
mahjanebi.ir mahjanebi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
OX OX-539079344 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mtbrand.ir primee.mtbrand.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
OX OX-537127704 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mobailfarid2.ir aghanavid.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
PUBM PUBM-157326 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mtbrand.ir mirzaii1.mtbrand.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
OX OX-539164681 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mirabdolbaghi.ir mirabdolbaghi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SMAA SMAA-1100036483 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
moonfix.ir doo.moonfix.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-539164681 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mounesi.ir falk.mounesi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-539164681 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
PUBM PUBM-157326 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.cz downdetector.cz
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
mahjanebi.ir cd.mahjanebi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
linjunzs.cn cf.linjunzs.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 4 days
NEX NEX-3427 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.gr downdetector.gr
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
OX OX-539164681 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mobailfarid3.ir testip.mobailfarid3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mamatune.top pfr3.mamatune.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
NEX NEX-650147 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
PUBM PUBM-157326 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mamatune.top pfr4.mamatune.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
NEX NEX-3427 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
burger-plus.ir relay.burger-plus.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 20 days
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
hzdragon.top bpb.hzdragon.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.ec downdetector.ec
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18576 Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
computationaladvancements.com vala.computationaladvancements.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 17 days
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
SMAA SMAA-1100036483 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
caiyongchao.top open.caiyongchao.top
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
SMAA SMAA-1100036483 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
allestoringen.nl allestoringen.nl
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-11576 Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
OX OX-539164681 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
moonfix.ir dir.moonfix.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mahdibm.com epic.mahdibm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
TRIP TRIP-12458 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
krislovingmyrna.sbs bpbp.krislovingmyrna.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 5 days
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.pt downdetector.pt
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539164681 Dec 2024 Dec 2024 One Off
OX OX-537127704 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.jp downdetector.jp
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539074089 Dec 2024 Dec 2024 One Off
OX OX-537127704 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
computationaladvancements.com eregon.computationaladvancements.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 17 days
OX OX-539164681 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYUTY34 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
bluehat358.my.id vless-panel.bluehat358.my.id
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 43 days
NEX NEX-650147 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mahjanebi.ir hi.mahjanebi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
OX OX-539079344 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.se downdetector.se
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539079344 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
lirytin.pw cn.lirytin.pw
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 4 days
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.it downdetector.it
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539079344 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
hiworld3.ir snap.hiworld3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 50 days
NEX NEX-650147 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.at downdetector.at
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
downdetector.sg downdetector.sg
Attribute Value First Detected Last Detected Overlap Duration
OX OX-537127704 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
gebotai.cc pbp.gebotai.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 52 days
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.fi downdetector.fi
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.ie downdetector.ie
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539079344 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
linspire.cc bpb.linspire.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
RUB RUB-11576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
waznimey.loseyourip.com free.waznimey.loseyourip.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
OX OX-537127704 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
070809.xyz 070809.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-800F1BA406 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
OX OX-539074089 Dec 2024 Dec 2024 One Off
haichuan.online sub.haichuan.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
OX OX-539164681 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.fr downdetector.fr
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539164681 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.co.uk downdetector.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539164681 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
downdetector.ro downdetector.ro
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-11576 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.sk downdetector.sk
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18576 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
mamatune.top pfr2.mamatune.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
NEX NEX-650147 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
john19820.top bpbw.john19820.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
APS APS-3336 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.hk downdetector.hk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.pe downdetector.pe
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
iranfilm-dl.online mainsub.iranfilm-dl.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 8 days
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
YUME YUME-2070966140 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
haibin7.xyz bpb.haibin7.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 11 days
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
YAHO YAHO-58286 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
TAPP TAPP-35919 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
houjue83.com houjue83.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 9 days
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
banyungong.space banyungong.space
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
DM DM-100298 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SMAA SMAA-1100036483 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.tw downdetector.tw
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
LIJI LIJI-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.hu downdetector.hu
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024 One Off
AOL AOL-56740 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.id downdetector.id
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
downdetector.hr downdetector.hr
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024 One Off
INFO INFO-3353280 Dec 2024 Dec 2024 One Off
allestoringen.be allestoringen.be
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
OX OX-537127704 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
channelbiz.es channelbiz.es
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-561495 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
wincustomize.com wincustomize.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
downdetector.in downdetector.in
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539079344 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
channelbiz.de channelbiz.de
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-185019 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
RUB RUB-18576 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
qj.net qj.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-185019 Dec 2024 Dec 2024 One Off
RUB RUB-11576 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
channelbiz.fr channelbiz.fr
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-561495 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
downdetector.pk downdetector.pk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100298 Dec 2024 Dec 2024 One Off
OX OX-539164681 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
downdetector.pl downdetector.pl
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
IEX IEX-183785 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
downdetector.ca downdetector.ca
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
SVRN SVRN-235106 Dec 2024 Dec 2024 One Off
geekgirlauthority.com geekgirlauthority.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
windowsxlive.net windowsxlive.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
extremetech.com extremetech.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024 One Off
itespresso.fr itespresso.fr
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
downdetector.mx downdetector.mx
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
downdetector.web.tr downdetector.web.tr
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539079344 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
mobiletechreview.com mobiletechreview.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
YAHO YAHO-54954 Dec 2024 Dec 2024 One Off
siliconweek.com siliconweek.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-185019 Dec 2024 Dec 2024 One Off
NEX NEX-3427 Dec 2024 Dec 2024 One Off
downdetector.com.au downdetector.com.au
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100298 Dec 2024 Dec 2024 One Off
NEX NEX-650147 Dec 2024 Dec 2024 One Off
androidcommunity.com androidcommunity.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18576 Dec 2024 Dec 2024 One Off
OX OX-538904910 Dec 2024 Dec 2024 One Off
downdetector.ph downdetector.ph
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
DM DM-100298 Dec 2024 Dec 2024 One Off
downloadcrew.com downloadcrew.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
IEX IEX-185019 Dec 2024 Dec 2024 One Off
itespresso.es itespresso.es
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
CTX CTX-561495 Dec 2024 Dec 2024 One Off
lyv3518.top laile.lyv3518.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
doway.ir lerarn.doway.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
liukaiblog.cn liukaiblog.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
682095.xyz lsls.682095.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
530302.xyz lxy.530302.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
majidarchive.ir majid.majidarchive.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 53 days
hly110-cf.com mcbpb120.hly110-cf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 74 days
tsy103.site mdy0505.tsy103.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
ejusta.ir mehdbarzddsarkelaa.ejusta.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 30 days
dsoheilb.ir mehdimlm.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 14 days
abedism.ir mehran.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
bachebiapain.ir mermer.bachebiapain.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 16 days
skymobiletm.ir mirab.amir.mashhad.hamed.aseman.skymobiletm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
amirranger.online mirza.amirranger.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 24 days
fergaltnt.ir mnasjfjdbdjcjdjfhdjfhejsbxjdjxhdjxjwjdnrvdjxbdjxbelwbxhdndjcjsj.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 12 days
nscl.ir moon.nscl.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 82 days
dsoheilb1.ir rezaei.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
jssean.top mynet.jssean.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
kodenul.my.id mypanel.kodenul.my.id
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
bilbilak.xyz mywork.bilbilak.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 60 days
bachebiapain.ir nginx-f.bachebiapain.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 16 days
notebooks.com notebooks.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
onlysluts.us onlysluts.us
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ookla.com ookla.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024 One Off
dsoheilb.ir rasulkarimi.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
algholami.ir page.algholami.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 60 days
iolo.ir page.iolo.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
ps4link.ru page.ps4link.ru
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
0hoo.ir pages.0hoo.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
772013.xyz pages.772013.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
rayanetcenter.ir rayanetcenter.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 1 day
ip-dynamic.org rayo.rayo.ip-dynamic.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 26 days
100661.xyz panel.100661.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
237271.xyz panel.237271.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
codemind.ir panel.codemind.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 18 days
dj18.top panel.dj18.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
familynetwork.ir panel.familynetwork.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
music110.top panel.music110.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
fergaltnt.ir panel.usa.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
zdxq.xyz panel.zdxq.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
812345678.xyz panel245.812345678.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
fergaltnt.ir panelswitzerlandvipmnippiookio.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
mohsentoy.ir mohsentoy.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
freegift.pp.ua pbp.freegift.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 36 days
mumumumushu.org pbp.mumumumushu.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 83 days
peybeton.ir peybeton.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 4 days
mamatune.top pfr1.mamatune.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
frdosi.ir pgs.frdosi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
abedism.ir pooorism.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
hafasamcompany.ir peransasarejus.hafasamcompany.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
4flw.com pro.4flw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
yca888.nyc.mn pxf.yca888.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 21 days
mobailfarid2.ir rezamahmoodi.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
12233345.xyz rga.12233345.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
applle3.ir applle3singaporemn23kko.applle3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 24 days
dsoheilb1.ir royaei.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
mobailfarid2.ir arashkhalili.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
dsoheilb.ir saeedjafari.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
saihan.asia saihan.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
zabanamooz.tech saliminz784.getconf.zabanamooz.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 18 days
abedism.ir saman.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
adbt.ir adbt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
alirezamansoury.ir afggtfx.higf.alirezamansoury.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
abedism.ir aghaforughi.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
candidwears.ir netco.candidwears.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
aiol.xyz aiol.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
dsoheilb.ir aloalo.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
seyedpc.shop seyedpc.shop
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 29 days
abedism.ir alinight.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
sherrytsang.cfd sherrytsang.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 13 days
shopvipback.uk shopvipback.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 16 days
4683239.xyz singlyq.tro.4683239.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
cheni96.top singbox.cheni96.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 18 days
jackdrogba.top singbox.jackdrogba.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
jsczczc.nyc.mn singbox.jsczczc.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 26 days
kaiserxu.asia singbox.kaiserxu.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
soscctv.ir soscctv.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
parskala.cloud api.parskala.cloud
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 4 days
hesabfun.ir speed.hesabfun.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 33 days
moallemfile.ir speed.moallemfile.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
kejbahs.cfd speedtesttestuploaddownloadspeeft.kejbahs.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 51 days
mermerrnd.sbs spring.mermerrnd.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 54 days
tech-offline.ir api1.tech-offline.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
abedism.ir abed.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
laixianzheng.nyc.mn sub.laixianzheng.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 5 days
mobailfarid3.ir ahmadqhanbari.mobailfarid3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
metroplus1.ir ambpb.metroplus1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 54 days
downloadbazha.ir svaezz.downloadbazha.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
6686888.xyz test.6686888.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
nscl.ir testni.nscl.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
oppc.ir babycalmdown.oppc.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
decorationdesign1403.ir bache-paieene-shahr.decorationdesign1403.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 69 days
kermanconcert.ir bache.kermanconcert.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 32 days
moxuetianya.com tianya0728bpb.moxuetianya.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
ursfur.net baoshi.bpb.ursfur.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zabanamooz.tech batiti923.getconf.zabanamooz.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
bbgzyxoicqq.sbs bbb.bbgzyxoicqq.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 21 days
zwp.world bbb.zwp.world
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 66 days
zabanamooz.tech tuta744.getconf.zabanamooz.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
bachebiapain.ir twisted-royal.bachebiapain.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 16 days
feyfey.uk bgp.feyfey.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
znj1968.xyz uuijk.znj1968.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
hrasad.ir vbb.hrasad.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
bangboo.xyz ver.bangboo.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 61 days
bazivashadi.ir blog.bazivashadi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 61 days
mtbrand.ir vip.mtbrand.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
babybirdcn.top vless.babybirdcn.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
cm-vless.sbs vless.cm-vless.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 58 days
zzy520.top vlessda.zzy520.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
chenghua.sbs vlab.chenghua.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 40 days
pikachuenglish.com vpn2.pikachuenglish.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
dubya.info wao.dubya.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
kkhome.top bpb-a.kkhome.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
5201989.xyz bpb-page.5201989.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
mie-ai.top bpb-proxy.mie-ai.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
20100207.xyz bpb-worker-panel-bvz.20100207.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
cxtz-001.top bpb-worker-panel.cxtz-001.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 57 days
023111.xyz bpb.023111.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
052360.xyz bpb.052360.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
070022.xyz bpb.070022.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 58 days
10086vip.uk bpb.10086vip.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
113344.xyz bpb.113344.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
152492.xyz bpb.152492.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
1688598.xyz bpb.1688598.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
17800.buzz bpb.17800.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 26 days
1788888.xyz bpb.1788888.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
189789.xyz bpb.189789.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 19 days
19760929.xyz bpb.19760929.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
198122.xyz bpb.198122.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
19821124.xyz bpb.19821124.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
22446688.buzz bpb.22446688.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
28590328.xyz bpb.28590328.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
298999.xyz bpb.298999.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
345589.xyz bpb.345589.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
4007777.xyz bpb.4007777.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
404505606.xyz bpb.404505606.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 20 days
489822.xyz bpb.489822.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
520131445.xyz bpb.520131445.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 65 days
520299.xyz bpb.520299.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
542872490.xyz bpb.542872490.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
5583.world bpb.5583.world
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 38 days
61760238.xyz bpb.61760238.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
62283063.xyz bpb.62283063.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
6686888.xyz bpb.6686888.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
760925.xyz bpb.760925.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
811120.xyz bpb.811120.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
886123.xyz bpb.886123.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
999881.xyz bpb.999881.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
allin66.sbs bpb.allin66.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
aobo.pw bpb.aobo.pw
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 62 days
baranifact.ir bpb.baranifact.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 38 days
bcfxclub.sbs bpb.bcfxclub.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 61 days
bigfu4nets.top bpb.bigfu4nets.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 38 days
bjzkar.ren bpb.bjzkar.ren
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 24 days
cgfriend.top bpb.cgfriend.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 66 days
coolsoul.co bpb.coolsoul.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
dafengzi.top bpb.dafengzi.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 27 days
daxiong.pp.ua bpb.daxiong.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 69 days
ddss.online bpb.ddss.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
dormitory5017.cyou bpb.dormitory5017.cyou
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
hcfiller.com bpb.fans.hcfiller.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 51 days
flaresky.top bpb.flaresky.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 72 days
fluffy90.online bpb.fluffy90.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
fwangping.top bpb.fwangping.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 53 days
ghjytu112.top bpb.ghjytu112.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
gjz518.top bpb.gjz518.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
gnaygnoy.nyc.mn bpb.gnaygnoy.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
gnaygnoylt.nyc.mn bpb.gnaygnoylt.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
gptclub.top bpb.gptclub.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
gramyar.ir bpb.gramyar.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 73 days
hanjiangke.nyc.mn bpb.hanjiangke.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
hcksensor.top bpb.hcksensor.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
hellopluto.uk bpb.hellopluto.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
hopol.win bpb.hopol.win
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
hutail.xyz bpb.hutail.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
hwd.pp.ua bpb.hwd.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
iori.pp.ua bpb.iori.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
isme.live bpb.isme.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
jijiang6.top bpb.jijiang6.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
kero990.pp.ua bpb.kero990.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 36 days
0j0.jp bpb.lala.0j0.jp
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ludeapd.top bpb.ludeapd.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
com.mp bpb.lyt.com.mp
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 56 days
onlyforme.ir bpb.me.onlyforme.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mirela.ir bpb.mirela.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
mirshekaran.ir bpb.mirshekaran.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
njyp.xyz bpb.njyp.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
notmmao.me bpb.notmmao.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
otan.org.uk bpb.otan.org.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
payfirst.club bpb.payfirst.club
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
sandy1029.cloud bpb.sandy1029.cloud
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
snaily.top bpb.snaily.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 38 days
suxu.asia bpb.suxu.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 73 days
ucvape.cc bpb.ucvape.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
vitfrank.link bpb.vitfrank.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
914520.xyz bpb.vvcbill.914520.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
weiaixin.space bpb.weiaixin.space
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
weizhen.xyz bpb.weizhen.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
woskee.xyz bpb.woskee.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wyz.pp.ua bpb.wyz.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
yeqing.me bpb.yeqing.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 21 days
yier.me bpb.yier.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
zhangwenkang.top bpb.zhangwenkang.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zhj13.com bpb.zhj13.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
hkcool.pp.ua bpb0504.hkcool.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
aozorako.com bpb0716.aozorako.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 38 days
050166.top bpb1.050166.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 65 days
765423.xyz bpb1.765423.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
19760929.xyz bpb18.19760929.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
489822.xyz bpb2.489822.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
36950288.xyz bpb202405.36950288.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
lgf5090.sbs bpb245.lgf5090.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 32 days
lileoxiu.nyc.mn bpb27-1.lileoxiu.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
156889.xyz bpb728.156889.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
msdjw.sbs bpbnewadd.ww.msdjw.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
61760238.xyz bpbok1.61760238.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
6666656.xyz bpbpages.6666656.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
liannian.com bpbsingbox.liannian.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
ip-ddns.com bpbtls.woshihutao123.ip-ddns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
8p.ink bpbw.8p.ink
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 65 days
beggar.top work.beggar.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
sh-do-1x-2s.pro wrck.sh-do-1x-2s.pro
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zcdn.vip xbbb.zcdn.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
xtangbao.top xtangbao.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
yiyuya.nyc.mn yiyuya.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 28 days
yufour.top yyds.yufour.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 21 days
830323.xyz cdf.830323.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
cfalirez.top cdf.cfalirez.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
persismotorsport.ir cdn3.persismotorsport.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 4 days
tagh.xyz ceshi.tagh.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 73 days
052088.xyz zidong.052088.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
kado.best cfp.kado.best
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
694016.xyz cfpanel.694016.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mojecloud.ir cfw.mojecloud.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
applle3.ir ba.applle3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 24 days
1362282.xyz ai.1362282.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
aliff.ir al.aliff.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
check-host.top check-host.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
catbank.cn bp.catbank.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 59 days
minghui.lol cc.minghui.lol
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
cloud-ip.biz cf.3319.cloud-ip.biz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
eatumom.cc cf.eatumom.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
willshen.top cf.willshen.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
itsfine.ir dl.itsfine.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
itsfine.ir dl.test.itsfine.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
pswluo.cn fq.pswluo.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
masnavi.top gr.masnavi.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 82 days
4reavless.xyz kr.4reavless.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 45 days
jgyu.com kv.jgyu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
965000.xyz ky.965000.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
jmnt.ir mn.jmnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
deebian.com su.deebian.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
meinpi.top wk.meinpi.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
nl.am ws.cherry.nl.am
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
testgitcode.sbs b.testgitcode.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 13 days
yasharkia.ir b.yasharkia.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xiaohhubs.top cla.xiaohhubs.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
is9630onjq4h7vduscu3shqvg7bnolxwvbg9gf3a4s2wrej2xbdtcvejabwugr2.cfd x.is9630onjq4h7vduscu3shqvg7bnolxwvbg9gf3a4s2wrej2xbdtcvejabwugr2.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 8 days
cloudns.nz cloudflare.clickeyourip1.cloudns.nz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
tonal1.ir contactus.tonal1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
cqn9105.cn cqn9105.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
freeairlaines.com crmbpb.freeairlaines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
darkness-auth.ir darkness-auth.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 80 days
njuy159.xyz demo.njuy159.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
itdreamnetwork.ir dev2.itdreamnetwork.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 26 days
eagmin.com eagmin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 55 days
geomatrix.ir fan.geomatrix.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 24 days
medicaldream.ir fast-3.medicaldream.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
fengyaoxi0628.top fengyaoxi0628.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mobailfarid2.ir fereydonsaediyan.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
mysbs.top fgtr.mysbs.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
byethost3.com file.stream2.byethost3.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
hafasamcompany.ir fishimahii.hafasamcompany.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mytopmov.ir fmp.mytopmov.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
675979.xyz fpgh3834.675979.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ivvo.top free.ivvo.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
skymobiletm.ir friends.skymobiletm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zabanamooz.tech frwrd.azinja.beonja.zabanamooz.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
feiyihao.cn gjd.feiyihao.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 42 days
asemanbot.ir hamed.maleki.expire.2025.05.05.asemanbot.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
asemannetwork.ir hasan.net.labtob.asemannetwork.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
metroplus1.ir hash2.metroplus1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
iamabiologist.ir hello-world-lively-dust-bb7d.iamabiologist.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 75 days
xiaoyuediandao.top hkk.xiaoyuediandao.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
huio.top huio.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 5 days
cloudns.nz installed.clickeyourip.cloudns.nz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 67 days
kharidbacklink.com irena.kharidbacklink.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 32 days
mresearcher.ir itdog.cn.zula.ir.ssmy.ir.com.v2.peedtest.com.visa.org.zac.ir.mresearcher.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
dsoheilb.ir jamali2.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
janebistore.monster janebistore.monster
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 77 days
jjh0401.top jjh0401.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 5 days
imgolden.site join.bede.vpncustomize.speedtest.net.imgolden.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 26 days
csbl.top karing.csbl.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
gongmu319.top karing.gongmu319.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 52 days
kharide-asan.world kharide-asan.world
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
wkun.xyz wkun.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
emuci.buzz jpr.emuci.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
dengkenet.com jsom-panel.dengkenet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
cprmehrvarzi.ir khomein.cprmehrvarzi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 68 days
ejusta.ir kimismsnotplaceju.ejusta.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
mojikach.ir king.mojikach.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wwwguo7.xyz kjgx0803.wwwguo7.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
cvui.top link.cvui.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
dsoheilb1.ir majedali.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
kiya7171.ir mamadoo.ggyhied.kiya7171.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 52 days
mekxsw.online mekxsw.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
fergaltnt.ir mnalihasanialihasanimnalihasaniwwwqpmkmk.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 54 days
fergaltnt.ir mnpaneljapan1japan1.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 54 days
mobilebagheri.tech mobilebagheri.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
hafasamcompany.ir mohadessarej.hafasamcompany.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 40 days
mobailfarid2.ir mohamadmahmoodi.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
dsoheilb1.ir mohammad.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
mrr.ir morero.mrr.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
oppc.ir multi.oppc.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
captaink.top mybpb.captaink.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 40 days
046019.xyz mzz.046019.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 26 days
mvm1988.ir normal.mvm1988.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 54 days
abedism.ir omidsalmasi.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
jijunrong.one onerootman.jijunrong.one
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
im4n.ir page.im4n.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
roudi.pw page.roudi.pw
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
algholami.ir page2.algholami.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
497882.xyz panel.497882.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
801702116.xyz panel.801702116.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
820105.xyz panel.820105.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
alighadrboland.ir panel.alighadrboland.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 63 days
shelinwilson.top panel.shelinwilson.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
fergaltnt.ir panelaustralia.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fergaltnt.ir panelfrance.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fergaltnt.ir panelgermany3vipiran.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 12 days
applle3.ir panelgermanyyyypp3.applle3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 24 days
fergaltnt.ir panelhongkong3iranppipgallcenxoqjxe.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fergaltnt.ir panelsingaporemnkjsjdbejbejxos.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 37 days
viravips.com pbbs.viravips.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wuzhiyuan.pp.ua pbp.wuzhiyuan.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ynlwin.site pbp.ynlwin.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 21 days
photographybay.com photographybay.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
boxisoft.ir portal.boxisoft.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
gpt4all.cfd rapidbpb.gpt4all.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 51 days
dreamyyds.buzz haha.dreamyyds.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
rwei.nyc.mn rwei.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 28 days
dsoheilb1.ir areukid.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 28 days
erfanfamily.ir admindastres.erfanfamily.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
satsw.ir satsw.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 3 days
ariyaphone.ir ariyaphone.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 50 days
nscl.ir sea.nscl.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
fortgift.ir server-70535eb6804c584cdd9cc.fortgift.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 12 days
metroplus1.ir alprbpb.metroplus1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 54 days
isnapics.xyz alfakher.isnapics.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 34 days
piaoluo000.top amy999.piaoluo000.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
dsoheilb1.ir amirhos.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
roostashahreiran.ir simsim.roostashahreiran.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
fangmilu.cc singbox.fangmilu.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 13 days
dsoheilb1.ir soheil.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
kaizenclub.top apachemonsterwild.kaizenclub.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 51 days
950117.xyz speedtest.950117.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
meganet.com.pl speedtest.meganet.com.pl
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
amirardi.pw app-state.amirardi.pw
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
centralpto.com srvdl.centralpto.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 18 days
aoo.ink abc.aoo.ink
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 62 days
mobailfarid2.ir abdolah.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
drkordmirza.com sub.drkordmirza.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
javad490.ir sub2.javad490.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 77 days
ejusta.ir atefamooramzaeju.ejusta.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 55 days
khamoosh.site auto.khamoosh.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 78 days
dsoheilb.ir test.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
k0o.ir test.k0o.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
medicalhistory.ir test.medicalhistory.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
betterid.cfd test241010.betterid.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 22 days
baasiri.pro baasiri.pro
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 61 days
dsoheilb1.ir bahman.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
vesslan.site tls.vesslan.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
bearblog.site bearblog.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
preciousleaf.xyz tsang.preciousleaf.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
armanm.ir usa.armanm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
freeairlaines.com user1441.freeairlaines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
dtshot8.com biubiu.dtshot8.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 14 days
virussisvsis.ir virussisvsis.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 14 days
v2com.sbs vless2.v2com.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ylyns.sbs vless5.ylyns.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
majaaaz.ir bnopb.majaaaz.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
cloudvalley.host vpn.cloudvalley.host
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
akljsdklajdsl.pp.ua vpn.akljsdklajdsl.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 38 days
520123.top vpn3.520123.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zabanamooz.tech wahed945.getconf.zabanamooz.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
lzws.top wall.lzws.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
johnnykhu.asia warppage3.johnnykhu.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 7 days
ariesljm.buzz wbpb.ariesljm.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
medicalhistory.ir bpb-mhi.medicalhistory.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 54 days
aceking.work bpb-net-us.aceking.work
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mymjze.cfd bpb-panel.mymjze.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 58 days
02251007.xyz bpb.02251007.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
0591cn.com bpb.0591cn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
13807735.xyz bpb.13807735.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
15minutes.work bpb.15minutes.work
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
16885885.xyz bpb.16885885.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
169986.xyz bpb.169986.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
1987000.xyz bpb.1987000.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
198968.xyz bpb.198968.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
220814.site bpb.220814.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
220814.xyz bpb.220814.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
2234566.xyz bpb.2234566.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
2678123.xyz bpb.2678123.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
27777777.xyz bpb.27777777.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
292775.xyz bpb.292775.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
320402.xyz bpb.320402.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
3344550.xyz bpb.3344550.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
360669.xyz bpb.360669.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
37dns.vip bpb.37dns.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
37ltd.com bpb.37ltd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
3890276.xyz bpb.3890276.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 65 days
502401.xyz bpb.502401.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
517000.xyz bpb.517000.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
5377811.sbs bpb.5377811.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
55555555.best bpb.55555555.best
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 45 days
557668.xyz bpb.557668.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
557707.xyz bpb.557707.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
56318989.xyz bpb.56318989.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
604.ltd bpb.604.ltd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
665655.xyz bpb.665655.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
690711.xyz bpb.690711.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
710110875.xyz bpb.710110875.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
720720720.xyz bpb.720720720.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
778945.xyz bpb.778945.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
8155053.com bpb.8155053.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
880399.xyz bpb.880399.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 20 days
890218.xyz bpb.890218.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
906051999.xyz bpb.906051999.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
952300.xyz bpb.952300.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
96b.in bpb.96b.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 64 days
999607.xyz bpb.999607.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
aigg.eu bpb.aigg.eu
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 63 days
ascarparts.com bpb.ascarparts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 24 days
baynixk.sbs bpb.baynixk.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 38 days
belper.xyz bpb.belper.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
bldcn.top bpb.bldcn.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
buntool.com bpb.buntool.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 39 days
chatsmc.online bpb.chatsmc.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
chuange.pp.ua bpb.chuange.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
cjmahdi.ir bpb.cjmahdi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 66 days
us.kg bpb.cztor.us.kg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 37 days
dadazhou.sbs bpb.dadazhou.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
darkwatercity.online bpb.darkwatercity.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
ddmonster.top bpb.ddmonster.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 42 days
ddxm.pp.ua bpb.ddxm.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 30 days
duoduola.cn bpb.duoduola.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
dy81.link bpb.dy81.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 55 days
fanshu.de bpb.fanshu.de
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
fes.hk bpb.fes.hk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 54 days
finanzam.com bpb.finanzam.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 42 days
fordust.top bpb.fordust.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 24 days
fsramon163.pp.ua bpb.fsramon163.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 36 days
fx-hl.com bpb.fx-hl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
g22.top bpb.g22.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
haogougou.uk bpb.haogougou.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
hldart.com bpb.hldart.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
ho3yn19.ir bpb.ho3yn19.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
hustonstars.top bpb.hustonstars.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
icm.pp.ua bpb.icm.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
iuyi.top bpb.iuyi.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
jack132b01.nyc.mn bpb.jack132b01.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
jaylensong.top bpb.jaylensong.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
john19820.top bpb.john19820.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 26 days
joinspace.pp.ua bpb.joinspace.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 77 days
junsixie.xyz bpb.junsixie.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
jushenqi.top bpb.jushenqi.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
kiandevteam.ir bpb.kiandevteam.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 78 days
knightzzk.nyc.mn bpb.knightzzk.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
komogroup.top bpb.komogroup.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 5 days
len.pp.ua bpb.len.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 56 days
linjabao.top bpb.linjabao.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
liq.pp.ua bpb.liq.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 56 days
liuchunqi.xyz bpb.liuchunqi.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 53 days
maovps.link bpb.maovps.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
meihao.buzz bpb.meihao.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
mk496366013.buzz bpb.mk496366013.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
moah79.top bpb.moah79.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mxiancn.top bpb.mxiancn.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
myfreepass.ir bpb.myfreepass.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
nibey.online bpb.nibey.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ntok.top bpb.ntok.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
octopuslol.com bpb.octopuslol.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
pandagit.ir bpb.pandagit.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
pandar.pp.ua bpb.pandar.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
parhde.ir bpb.parhde.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
ph75738.pp.ua bpb.ph75738.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ptstb.top bpb.ptstb.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
qdmg.club bpb.qdmg.club
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
qingxin.lol bpb.qingxin.lol
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
rsjhh.xyz bpb.rsjhh.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
saonian.online bpb.saonian.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
seyedx.ir bpb.seyedx.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
slz.pp.ua bpb.slz.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 75 days
sxjcqx.cn bpb.sxjcqx.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
tagh.xyz bpb.tagh.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 73 days
theshy.sbs bpb.theshy.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
myboxes.cfd bpb.trojapages.myboxes.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
upchao.cn bpb.upchao.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
water.pp.ua bpb.water.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wiilsvless.sbs bpb.wiilsvless.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wits.ink bpb.wits.ink
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wkxs.de bpb.wkxs.de
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 42 days
xgcz.xyz bpb.xgcz.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
xinfujia.uk bpb.xinfujia.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xuketfe.top bpb.xuketfe.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xuuuu.top bpb.xuuuu.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zxqzz.sbs bpb.zxqzz.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
totoro.studio bpb01.totoro.studio
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
737389.xyz bpb0705.737389.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
otan.org.uk bpb1.otan.org.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
swqz.mom bpb10.swqz.mom
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 26 days
1288025.xyz bpb2.1288025.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
345589.xyz bpb2.345589.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 19 days
chenheyao05.top bpb2.cf.chenheyao05.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
ehsanranjer.ir bpb2.ehsanranjer.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
now9888.com bpb2.now9888.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xi.to bpb2.unitycourses.xi.to
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
vitfrank.link bpb2.vitfrank.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
tanzunsx.ir bpb21.tanzunsx.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 11 days
hanweid.nyc.mn bpb244.hanweid.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 10 days
lileoxiu.nyc.mn bpb27-4.lileoxiu.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
wenjianken.com bpb3.wenjianken.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
cpiforpersia.uk bpbfrag1.cpiforpersia.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
bihu.co bpbkkk.bihu.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
ddss.online bpbpanel.ddss.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
tczn.work bpbpg.tczn.work
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 46 days
amirktb.ir bpbsia.amirktb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
edtdigital.top bpbsingbox.edtdigital.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 14 days
52pm.ink bpbv.52pm.ink
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 65 days
ehsanranjer.ir bpbv3.ehsanranjer.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
pangx.buzz bpbw.pangx.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xdty.top bpbwork-kxsw-0a2ad23.xdty.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 41 days
tableshikhu2.sbs bptest.tableshikhu2.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
v0pc.com bpw.v0pc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 71 days
ejusta.ir welamirmohamy.ejusta.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
lepc.vip wol.lepc.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
581525.xyz bus.581525.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
5288z.com workers.5288z.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zabanamooz.tech writer239.getconf.zabanamooz.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
vopc.cn wzybpb.vopc.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 26 days
vvbaby.net xbkj0507.vvbaby.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 24 days
7zp.pp.ua xianggang.7zp.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 36 days
taoyang1893.xyz xjwlmq.taoyang1893.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
yong.nyc.mn yong.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 36 days
fortgift.ir cdn-core-e2906f77aea7f9c09a8a863c81c628ff.fortgift.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 53 days
hdancer.site zendebadiranoirani.hdancer.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 10 days
520691.xyz cesuwang.520691.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
1096.pp.ua cfb.1096.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 38 days
jochon.cn cfbpb.jochon.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 38 days
51changjiang.cfd cfdns.51changjiang.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
betterman.xyz cfvless.betterman.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
930405.xyz cfw.930405.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
fengyan.buzz znr.fengyan.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mangasell.ir zula.speedtest.net.mangasell.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
ericking.online ak.ericking.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
ebg.ir ae.ebg.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
110233.xyz cc.110233.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
helloethan.sbs cc.helloethan.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
888888800.xyz cf.888888800.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
bpb1.xyz cf.bpb1.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
alumglass.org bp.alumglass.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
youwan.buzz bp.youwan.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
armanm.ir de.eee.armanm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 36 days
salzy.my.id df.game.naver.com.vlez.salzy.my.id
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
aibeluga.top dy.aibeluga.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mordaab.ir eu.mordaab.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
memarinama.com fa.memarinama.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 30 days
35dog.com fw.35dog.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
dorianv.ir gc.dorianv.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
alirez.space hm.alirez.space
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
aouto.link hn.aouto.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
akn.pp.ua kr.akn.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 28 days
370066259.xyz mh.370066259.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
jvmm.ir mm.jvmm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
elims.top mb.elims.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 29 days
avidez.my.id sg.avidez.my.id
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
8189.in tz.8189.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 37 days
ebg.ir uk.ebg.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
bright.nyc.mn us.bright.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
funxbox.xyz yy.funxbox.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
ibajrqw.top b.ibajrqw.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 75 days
pagal.ir m.pagal.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
asrnoor.ir p.asrnoor.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
asrnour.ir p.asrnour.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
dubya.info m.wo.dubya.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 55 days
cloudflared.ir cloudflared.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
bfrserver2.info cybmik-1.bfrserver2.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 62 days
krfserver3.info cybmik-1.krfserver3.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 79 days
netdreamworks.com dev2.netdreamworks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
division2map.com division2map.com
Attribute Value First Detected Last Detected Overlap Duration
CRIT CRIT-B-062691 Dec 2024 Dec 2024 One Off
dopraxkunt.site dopraxkunt.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
pooyasharifi8208.ir edbpb.harchi.pooyasharifi8208.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 4 days
mobailfarid2.ir ehsanfatahi.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
reza2143sava.ir emergency.call.reza2143sava.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zabanamooz.tech emrica987.getconf.zabanamooz.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
streetdirectory.sg explore.streetdirectory.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ejusta.ir farangiesmaeju.ejusta.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
medicaltreatment.ir fast-3.medicaltreatment.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
developergitblog.cfd fftest.developergitblog.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 69 days
caomiao.work singbox.caomiao.work
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 19 days
trmusic.ir form.trmusic.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
iamerfan.ir free.iamerfan.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 9 days
jsdhksjksdklsdjk.ir freeg.jsdhksjksdklsdjk.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 77 days
19861215.xyz fuck.19861215.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
40cheraagh.ir galar1galar2galar3.40cheraagh.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
applle3.ir germanykmndhsudhwjshwhsbsjdoooowwbb4.applle3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 24 days
ro.to gitnew.ro.to
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
pokh.lol goh.pokh.lol
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
4flw.com gold.4flw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
gorazu.ir gorazu.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
dsoheilb.ir hamidapadana.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
hunas.cc hkg.hunas.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
emuci.buzz hkr.emuci.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
32634369.xyz ieju6ee.32634369.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mobailfarid2.ir imansheykhi.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mtbrand.ir iranjojeafoqjfoqfjqoofjqghjqjqqjgkqjggjqfjqofjqiwehghikhssssswo.mtbrand.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
ejusta.ir isaaghaemateemaza.ejusta.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
itespresso.de itespresso.de
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-185019 Dec 2024 Dec 2024 One Off
izakcenter.online izakcenter.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
135857.xyz jdkk.135857.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wwwguo7.xyz jdrj0704.wwwguo7.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
proxy-ip.vip jenny.proxy-ip.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
asemanbot.ir rasool.yazdian.expire.2024.05.29.asemanbot.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
abolfazlalz.ir abolfazlalz.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
decorationdesign1403.ir abrokamon.decorationdesign1403.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
buzzloom.buzz bpq.buzzloom.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
dsoheilb.ir abasjafari.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
damavand.uk aboutus.damavand.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 27 days
yufour.top yufour.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 36 days
erfanfamily.ir safe.erfanfamily.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
blitz-vpn.site safetvpn-playpoint-benana.blitz-vpn.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
saleh2323.ir admin.saleh2323.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
k0o.ir sgdfgdf.k0o.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 56 days
iminitor.ir shad3s.iminitor.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
dsoheilb.ir shop.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
maintainhydraulic.ir ameneh.maintainhydraulic.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
simurghcloud.ir simurghcloud.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 13 days
fergaltnt.ir singapore.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
520love.store singbox.520love.store
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
cloudwl.win singbox.cloudwl.win
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 39 days
hkkvray2.top singbox.hkkvray2.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
filimoiran.com amir58.filimoiran.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 25 days
bewuyeluo.top sock.bewuyeluo.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
andylau19801.nyc.mn andylau19801.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
mehr1dad.ir speedtest.mehr1dad.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
myprojectsghost.online speedtest.myprojectsghost.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 54 days
alichamani.ir asad.jkhg.alichamani.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 60 days
paad724.com srv1.paad724.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 3 days
cotton24.ir store.cotton24.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 68 days
sturgeon.pp.ua sturgeon.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 13 days
suxu.asia suxu.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 43 days
mylifehf.ir taherirezasar.mylifehf.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mobailfarid3.ir arashkhalili1.mobailfarid3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
taptunnel.space taptunnel.space
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
ejustageram.ir tatataheri.ejustageram.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 55 days
ccsyue.cn test.ccsyue.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
ep3hnm.ir test.ep3hnm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
erfanhub.ir test3.erfanhub.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
385119.xyz testbpb.385119.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ye28.nyc.mn text.ye28.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xdwsh.com bbb.xdwsh.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
barbybar.ir bbppbb.barbybar.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
810820830.xyz bbr.810820830.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
blfs.top tunnel2.blfs.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 33 days
giordanobruno.ir bia.giordanobruno.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 73 days
uniquephysio.ca uniquephysio.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 18 days
freeairlaines.com user141.freeairlaines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 17 days
freeairlaines.com user1442.freeairlaines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
vavan.ir vavan.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 4 days
sourena33.sbs blog75.sourena33.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
samvpn.xyz vlesspbp.samvpn.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
fasurus.life vpn.fasurus.life
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 24 days
kenshi.nyc.mn bob.kenshi.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
jiroutiao.com vpn.jiroutiao.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
5lp.xyz vpnbpb.5lp.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 28 days
luta.one vpnn.luta.one
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
pars-android.com bpb-aqil-panel.pars-android.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
medicaldream.ir bpb-mdr.medicaldream.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 83 days
medicaltreatment.ir bpb-mtr.medicaltreatment.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 83 days
cxtz-001.top bpb-panel.cxtz-001.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 42 days
hiyamykh.pp.ua bpb-panel.hiyamykh.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
itbearser.top bpb-worker.itbearser.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
052222.xyz bpb.052222.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 26 days
0618033.xyz bpb.0618033.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
065169.xyz bpb.065169.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
1009.top bpb.1009.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 38 days
111518.xyz bpb.111518.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
118558.xyz bpb.118558.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
11cm.com.cn bpb.11cm.com.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 65 days
1288025.xyz bpb.1288025.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
137390740.xyz bpb.137390740.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
143314.xyz bpb.143314.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
1646.cc bpb.1646.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 37 days
181918.xyz bpb.181918.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
19810324.xyz bpb.19810324.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
1981666.xyz bpb.1981666.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
1984.pp.ua bpb.1984.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
19990120.xyz bpb.19990120.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
2182569.xyz bpb.2182569.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
225514.xyz bpb.225514.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
3184583.best bpb.3184583.best
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
35573551.xyz bpb.35573551.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 20 days
3559670.xyz bpb.3559670.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 20 days
41857090.xyz bpb.41857090.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 65 days
51335133.xyz bpb.51335133.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
5206666.xyz bpb.5206666.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
5251314.xyz bpb.5251314.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 20 days
55519802.xyz bpb.55519802.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 45 days
690112.xyz bpb.690112.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
6968489.xyz bpb.6968489.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
740715.xyz bpb.740715.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
888028.xyz bpb.888028.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
8p.ink bpb.8p.ink
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 37 days
917520.xyz bpb.917520.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
92tc.net bpb.92tc.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
aa868.top bpb.aa868.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 26 days
abdavp.lol bpb.abdavp.lol
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 20 days
adtmanagement.com bpb.adtmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
aihowl.top bpb.aihowl.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
attack-on-titan.ir bpb.attack-on-titan.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 60 days
baghdiq.nyc.mn bpb.baghdiq.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
bamboodew.top bpb.bamboodew.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
bersinrose.ir bpb.bersinrose.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 38 days
byteyam.com bpb.byteyam.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 64 days
ctscan.top bpb.ctscan.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 27 days
ddfhfgx888.top bpb.ddfhfgx888.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
dongbo88.xyz bpb.dongbo88.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
ele.pp.ua bpb.ele.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
elevenfamilies.link bpb.elevenfamilies.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
faceless.nyc.mn bpb.faceless.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
falconerileather.site bpb.falconerileather.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
fthi.site bpb.fthi.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
goku.top bpb.goku.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
griphin.top bpb.griphin.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 49 days
happyboy.pp.ua bpb.happyboy.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 74 days
hellolsy.com bpb.hellolsy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 74 days
hotik.asia bpb.hotik.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
hzos.top bpb.hzos.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
iaai.love bpb.iaai.love
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
iwoyao123.top bpb.iwoyao123.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
juezhengjing.win bpb.juezhengjing.win
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 51 days
kkhome.top bpb.kkhome.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 38 days
klzhong.store bpb.klzhong.store
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 5 days
kmevps.ir bpb.kmevps.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
kspn.top bpb.kspn.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
ktvlab.site bpb.ktvlab.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
lepidus.me bpb.lepidus.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
lesvtlss.sbs bpb.lesvtlss.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 32 days
liangzg.com bpb.liangzg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 52 days
lingev2tst.top bpb.lingev2tst.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 31 days
lingjinglive.com bpb.lingjinglive.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
lingwudev.tech bpb.lingwudev.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
luohao001.cn bpb.luohao001.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 3 days
lvjinghuanjing.com bpb.lvjinghuanjing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
miaoyang.win bpb.miaoyang.win
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mmolive.com bpb.mmolive.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
mothan.tech bpb.mothan.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
movenn.com bpb.movenn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
mt9.ir bpb.mt9.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
mutoworld.xyz bpb.mutoworld.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Dec 2024 Dec 2024 One Off
myzxyzxy.top bpb.myzxyzxy.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
niu7.top bpb.niu7.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
noip.vip bpb.noip.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
nptv.cn bpb.nptv.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
ooya.site bpb.ooya.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
9051246.xyz bpb.pag.9051246.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
pangx.buzz bpb.pangx.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
pt01524.win bpb.pt01524.win
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
putaotang.xyz bpb.putaotang.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
seafeng.cfd bpb.seafeng.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
shangool.ru bpb.shangool.ru
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ssghdl888.xyz bpb.ssghdl888.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
sxpcloud.top bpb.sxpcloud.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
taronet.top bpb.taronet.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
teamos.net bpb.teamos.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
tgbg.pp.ua bpb.tgbg.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 45 days
vopc.cn bpb.vopc.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 43 days
webvip.cc bpb.webvip.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 23 days
whulhf.win bpb.whulhf.win
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 23 days
woohom.top bpb.woohom.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 23 days
wwszkt.top bpb.wwszkt.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
xencn.me bpb.xencn.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xiaoaitongxue.love bpb.xiaoaitongxue.love
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xir.cc bpb.xir.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 67 days
xls.pp.ua bpb.xls.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
xxyy.asia bpb.xxyy.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
yayajing.site bpb.yayajing.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zhizhu.store bpb.zhizhu.store
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zmdybh.com bpb.zmdybh.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
cnyohu.com bpb0716.cnyohu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 26 days
zhongyoutc.com bpb0716.zhongyoutc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
niux.pp.ua bpb10.niux.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
cjmahdi.ir bpb2-pages.cjmahdi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 66 days
20888802.xyz bpb2.20888802.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
wits.ink bpb2.wits.ink
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 26 days
3559670.xyz bpb23.3559670.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 20 days
ehsanzz.ir bpb241last.ehsanzz.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
arash-skating.ir bpb243.arash-skating.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 38 days
fwdf666668.top bpb245.fwdf666668.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
hago.nyc.mn bpb26.hago.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
lileoxiu.nyc.mn bpb27-3.lileoxiu.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
lingela.sbs bpb3.lingela.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
iaai.love bpb8.iaai.love
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
makingirangreatagain.com bpbnpvcpi.makingirangreatagain.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
ehsanskate.ir bpbv2.ehsanskate.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
2116088.xyz bpbvpn.2116088.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
6666656.xyz bpbworker.6666656.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
mohammadupl.com bpbworker.mohammadupl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
pqbvm.com bpbworker.pqbvm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
f2pool.com.cn bpbwp.f2pool.com.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
jack132b01.nyc.mn bpbwpanel.jack132b01.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
v0pc.com bpp.v0pc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
jackeyshone.link wei.jackeyshone.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
wooditforyou.shop wooditforyou.shop
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ifeng250.com worker-bpb.ifeng250.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 15 days
304307608.xyz wqs.304307608.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
xxxcnn.nyc.mn xxxcnn.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 1 day
yakanet.online yakanet.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 14 days
guaiguai999.org yuyu.guaiguai999.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 35 days
wanpe.top cdn888.wanpe.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
devm.ir zero.devm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
mindroom3.ir ceo2.mindroom3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
539346345.xyz zijian.539346345.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 45 days
ddsj.site check.ddsj.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
acg10086.xyz cf.acg10086.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
474101149.xyz bp.474101149.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 65 days
968999.xyz bp.968999.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
991314520.xyz bp.991314520.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
exceptionalcustomerrelationshipmanagement.site bp.exceptionalcustomerrelationshipmanagement.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
01110011.ir dl.mirror.01110011.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
itsfine.ir dl.mirror.itsfine.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
nkjdbf3wiwofbeio23e23hde2sdcsonc92jdsskz1kinjd22dxwx2is2naxsxjx.online dl.nkjdbf3wiwofbeio23e23hde2sdcsonc92jdsskz1kinjd22dxwx2is2naxsxjx.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
968333.xyz gg.968333.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 20 days
ylks.xyz lh.ylks.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
520xixi.top ma.520xixi.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
shadowkala.ir no.shadowkala.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ebg.ir nl.ebg.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
aliff.ir sa.aliff.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
1ping.wang ss.1ping.wang
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
hunas.cc tw.hunas.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
hope8964.nyc.mn ty.hope8964.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 50 days
ylks.xyz vv.ylks.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
3j7.net b.3j7.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 37 days
860529.xyz b.860529.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
vnm.cloudns.asia f.vnm.cloudns.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
deep-black.ir g.deep-black.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 69 days
m0sen.ir m.m0sen.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 38 days
smlie.pp.ua m.smlie.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
asrnoor.ir x.asrnoor.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
fang.pp.ua x.fang.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
ccapvcd.buzz cloud.ccapvcd.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
vicloud.ir cloudcloudcloudcloudcloud.vicloud.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mytopmov.ir cold.mytopmov.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 83 days
glxderver5.info cybmik-1.glxderver5.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
mobailfarid3.ir darabmehrshad.mobailfarid3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
dawang.site dawang.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 35 days
dena1403.online dena1403.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
kejbahs.ir dowloaduploadtestspeedspeedtest.kejbahs.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 78 days
dsoheilb1.ir ehsan.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
ezdemo.top ezdemo.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
fileforum.com fileforum.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3427 Dec 2024 Dec 2024 One Off
fojii.co.uk fojii.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 76 days
ahmadamm.ir fpco.ahmadamm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 63 days
jsilver.loseyourip.com free.jsilver.loseyourip.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
irangr8.info fun.irangr8.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 26 days
gamatex.site gamatex.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 32 days
armanm.ir gcore.armanm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
gdwubin.link gdwubin.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 11 days
aaok.vip gfw.aaok.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
8168888.xyz gitbpb.8168888.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
gobpb.shop gobpb.shop
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 13 days
kazusama.sbs kazusama.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 6 days
yxuu.cn hello.yxuu.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
313552.xyz hih.313552.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
hiox.top hiox.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 2 days
mtbrand.ir hirmandi.mtbrand.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
pm67.ir infobpb.pm67.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
speedytest.cfd internetspeedtest.speedytest.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
weydev.top izg-vpn.weydev.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
abedism.ir mohamadahmadi.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
joney.ac.cn joney.ac.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
karshenashamrah.ir karshenashamrah.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 28 days
dsoheilb.ir kave.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 14 days
dsoheilb.ir mohsen.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
bachebiapain.ir kitkat.bachebiapain.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 16 days
abedism.ir konideraz.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
slambenchmarking.xyz leaf.slambenchmarking.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
testlless.uk linxblinsx.testlless.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
khamoosh.site liveuk.khamoosh.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 26 days
liyingpeng.sbs lixiansheng.liyingpeng.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 4 days
bachebiapain.ir mahsa3.bachebiapain.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 16 days
safavidempire.org mainpagepbp.safavidempire.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
dsoheilb.ir majid.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 28 days
mios3c.com meow.mios3c.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 59 days
zabanamooz.tech mom475.getconf.zabanamooz.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
miladsali74.ir msi.miladsali74.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mtkarimi.online mtkarimi.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 24 days
kingbuy.top mybpbwork.kingbuy.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fastwebsite.design mypanel.fastwebsite.design
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
metroplus1.ir navid2.metroplus1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
caspiancoldrolled.ir navid3-bpb.caspiancoldrolled.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 65 days
gdpvless.top newtop1.gdpvless.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 35 days
forir.ir oblivion.forir.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
lilyatr.ir onlineshop.lilyatr.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 80 days
openio.cfd openio.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 45 days
memarinama.com page.memarinama.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 54 days
spysoos.link page.spysoos.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
svpae.asia page2.svpae.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
algholami.ir page4.algholami.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 21 days
kalinvan.ir pages.kalinvan.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
l95.ir pages.l95.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
vitfrank.link pages.vitfrank.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
fandogh2.ir panel.fandogh2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
ooog.top panel.ooog.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
858303300.xyz panel2.858303300.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
dj18.top panel245.dj18.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
fergaltnt.ir panelalihasanisingaporemnuffefjjbvfedchjjhgfvjibvdw.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 54 days
fergaltnt.ir panelitalypanel2024kppihdcjvvdezyhvigxsgbjfdx.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fergaltnt.ir panelswed.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 12 days
fergaltnt.ir panelusa2hxbwjxbsjzbsbwjshbfeynwjdjs.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 54 days
fergaltnt.ir panelusaazimibfhdegjgd20mordadgdcfv.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 54 days
sefell.com pbp.cloudflare.sefell.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wdsnet.cn polymerization.wdsnet.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 24 days
sabajn.ir port.sabajn.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
8189818.xyz portal3.8189818.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
aghabeiki.homes pvg.aghabeiki.homes
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 63 days
proxyrouter.top pyf.proxyrouter.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
dsoheilb.ir ranjbaran.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
ehsanzz.ir gcore.ehsanzz.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 55 days
dsoheilb1.ir rezarahimi.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
dsoheilb.ir arsalan.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
maintaincourse.ir aboutbpbcourse.maintaincourse.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
brigand.asia dc.brigand.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 20 days
mobailfarid3.ir sajadmahmoodi.mobailfarid3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
samenrazavii.ir sanjesh.samenrazavii.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
250414.xyz sbwgh.250414.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
sdafsadfdsfsdert5rgsfsdffgrr43r3ewwftrt4y5yhtrgfsdf4t54.tech sdafsadfdsfsdert5rgsfsdffgrr43r3ewwftrt4y5yhtrgfsdf4t54.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 29 days
ebrahimakhgarian.ir agyg.jhfgg.ebrahimakhgarian.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
ashkanhidi.ir see.ashkanhidi.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 38 days
shamim6870.ir shamimem.shamim6870.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
lilyatr.ir shop.lilyatr.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
tabnack.ir side.tabnack.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
candyfree.top singbox.candyfree.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 19 days
lyv3518.top singbox.lyv3518.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 28 days
qmx.life singbox.qmx.life
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
zsp.pp.ua singbox.zsp.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
mobailfarid2.ir amirarsalan.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 55 days
askmen.com askmen.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
mobailfarid2.ir sohrabmahmoodi.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
soilmecir.com soilmecir.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 14 days
8p.ink socks.8p.ink
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 37 days
nightime.top anbu.nightime.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mahi30.ir app-view.mahi30.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
tech-offline.ir api5.tech-offline.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 12 days
douyu.pp.ua sub.douyu.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fysm.xyz aaa.fysm.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
yyds168.top sun.yyds168.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mobailfarid3.ir aqhanavid.mobailfarid3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
tehroon.fr tehroon.fr
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
bachebiapain.ir aurora.bachebiapain.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
testele.uk testele.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
babyboss.cfd babyboss.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
tomcatio.top tomcatio.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 31 days
winbeta.net bbb.winbeta.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
beaboss.fr beaboss.fr
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-185019 Dec 2024 Dec 2024 One Off
nscl.ir twisted-royal.nscl.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
yhealths.com beta.yhealths.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
black5un.ir black5un.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 63 days
mlihong.site vless.mlihong.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
shan-jx.uk vless888.shan-jx.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
salzy.my.id vlez.salzy.my.id
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
112583.xyz vpn.112583.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
chunkiu.uk vpn.chunkiu.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 66 days
drxiong.top vpn.drxiong.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 42 days
leertai.top vpn.leertai.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 80 days
maww.cn vpn.maww.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
chinasvip.buzz bnb.chinasvip.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
wbzhyh.pp.ua wbz.wbzhyh.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
kangjiegon.pp.ua bpb-1.kangjiegon.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
bjzkar.ren bpb-page.bjzkar.ren
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
jabisoft.ir bpb-pages.jabisoft.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
115411.xyz bpb-panel.115411.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
w-l-w.top bpb-worker-panel.w-l-w.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
brucelee1973.ir bpb.0.brucelee1973.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 17 days
010234.xyz bpb.010234.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
012321.xyz bpb.012321.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
0579.plus bpb.0579.plus
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
121409.xyz bpb.121409.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
129805.xyz bpb.129805.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
1314666.xyz bpb.1314666.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
175625738.xyz bpb.175625738.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
19770506.xyz bpb.19770506.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
197903.pp.ua bpb.197903.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
19900130.xyz bpb.19900130.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
19961110.xyz bpb.19961110.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
202320.xyz bpb.202320.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
210217.xyz bpb.210217.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
246888.xyz bpb.246888.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
2900900.xyz bpb.2900900.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
3344666.xyz bpb.3344666.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
340913.xyz bpb.340913.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 19 days
349471930.xyz bpb.349471930.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
360122.xyz bpb.360122.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
445vgh.buzz bpb.445vgh.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
4d7.ir bpb.4d7.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
519530.xyz bpb.519530.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
704072456.xyz bpb.704072456.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
880824.xyz bpb.880824.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
880996.xyz bpb.880996.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
891462.xyz bpb.891462.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
919000.xyz bpb.919000.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
9701853.xyz bpb.9701853.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
9954869.xyz bpb.9954869.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
9999.ooo bpb.9999.ooo
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
adeanna.sbs bpb.adeanna.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
aiol.love bpb.aiol.love
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
amy999.top bpb.amy999.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 63 days
ankstam.sbs bpb.ankstam.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 38 days
asemanbot.ir bpb.asemanbot.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
bestrivenna.pp.ua bpb.bestrivenna.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 60 days
boycejudith.xyz bpb.boycejudith.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 39 days
btc211.com bpb.btc211.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 25 days
chatgptvpn.top bpb.chatgptvpn.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
chengyishi.online bpb.chengyishi.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
cliechen.nyc.mn bpb.cliechen.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
cliechen.pp.ua bpb.cliechen.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
collectpetal.pp.ua bpb.collectpetal.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
czyt.tech bpb.czyt.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
d4.cc bpb.d4.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
deqsbgd.asia bpb.deqsbgd.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
diyi.pp.ua bpb.diyi.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 29 days
dos7.xyz bpb.dos7.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 57 days
dralong.com bpb.dralong.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
extls.pp.ua bpb.extls.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 30 days
ezable.cn bpb.ezable.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
frankin.top bpb.frankin.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 24 days
garychen.pp.ua bpb.garychen.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 53 days
goudan001.xyz bpb.goudan001.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
grassroots-project.app bpb.grassroots-project.app
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 51 days
hadaf.cloud bpb.hadaf.cloud
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
hai12app.top bpb.hai12app.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 51 days
hallo.loan bpb.hallo.loan
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
hlab.cc bpb.hlab.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
hsphome.xyz bpb.hsphome.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
hx208.top bpb.hx208.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
isas.io bpb.isas.io
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
isoho168.top bpb.isoho168.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
jacory.cn bpb.jacory.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
jimmie-yang.top bpb.jimmie-yang.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 77 days
jqka2222.lol bpb.jqka2222.lol
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
k151.com bpb.k151.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
kaishek.uk bpb.kaishek.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
kaizenclub.top bpb.kaizenclub.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 51 days
keale.nyc.mn bpb.keale.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
kedaye.site bpb.kedaye.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
liushilin.men bpb.liushilin.men
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
luyaohua.xyz bpb.luyaohua.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
lzandhyy.top bpb.lzandhyy.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 53 days
mazxyzxy.top bpb.mazxyzxy.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 82 days
mickey3721.xyz bpb.mickey3721.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 30 days
mmw1984.com bpb.mmw1984.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mokasi1.cn bpb.mokasi1.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
mxzhang.com bpb.mxzhang.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
n1c3.me bpb.n1c3.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
nastop.pp.ua bpb.nastop.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
njypp.com bpb.njypp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
no-free.uk bpb.no-free.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
orcm2.xyz bpb.orcm2.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
pl10000.org bpb.pl10000.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
qiuzhuowei.top bpb.qiuzhuowei.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
qj520.top bpb.qj520.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
qwq.pp.ua bpb.qwq.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
roudika.ir bpb.roudika.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 7 days
sayousay.me bpb.sayousay.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
sdchsd.cn bpb.sdchsd.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
sqrxz.top bpb.sqrxz.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
sunmengjie.top bpb.sunmengjie.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
tami.pp.ua bpb.tami.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 73 days
unixstudy.lol bpb.unixstudy.lol
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
vincval.uk bpb.vincval.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wanmin.me bpb.wanmin.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 24 days
wenjianken.link bpb.wenjianken.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
wobe.top bpb.wobe.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
wxrbbs.top bpb.wxrbbs.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 22 days
xiakayi.com bpb.xiakayi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xish.pp.ua bpb.xish.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 41 days
yanzhe.top bpb.yanzhe.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
yukinoshita.link bpb.yukinoshita.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
yyyj.me bpb.yyyj.me
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
zcmfa.xyz bpb.zcmfa.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zinmyo.top bpb.zinmyo.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zjls515.pub bpb.zjls515.pub
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
168168568.xyz bpb1.168168568.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
kevinbai.top bpb1.kevinbai.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 78 days
8211321.xyz bpb123.8211321.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
lowa.nyc.mn bpb2.lowa.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
lileoxiu.nyc.mn bpb264.lileoxiu.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 28 days
aced.nyc.mn bpb3.aced.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
iaai.love bpb6.iaai.love
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
jiajuser.com bpbcf.jiajuser.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
iaai.love bpbgit.iaai.love
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
feiyuan.org bpbhk.feiyuan.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 37 days
mohsekarim2.ir bpbjadid.mohsekarim2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
sccx.ltd bpbpanel.sccx.ltd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
topnop.top bpbptop.topnop.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
spidercuteelite.ir bpbspcute.spidercuteelite.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
feiyuan.org bpbus.feiyuan.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 37 days
ehsanranjer.ir bpbv233.ehsanranjer.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
bihu.co bpbwk.bihu.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 27 days
mehrabzhp.ir wiki.mehrabzhp.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 29 days
33229981.xyz work5.33229981.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
steamplayer.bf worldbak.steamplayer.bf
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
xuylin.xyz xuylin.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
bachebiapain.ir yeganbeyegan.bachebiapain.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 45 days
yueyue.lat yueyue.lat
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
sdjfkkdjfsd64df5dfsdfgf.sbs zijian3.sdjfkkdjfsd64df5dfsdfgf.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
zou888666.nyc.mn zou888666.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 14 days
peeass.asia cc.peeass.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 34 days
096000.xyz bb.096000.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
010798.xyz bp.010798.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
qcy.pp.ua bp.qcy.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
devclouds.ir bw.devclouds.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 69 days
icm.pp.ua cf.icm.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
farelra.my.id cf.proxy.farelra.my.id
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
ebg.ir de.ebg.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
satzo.ir et.satzo.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
amirimani047.ir fg.amirimani047.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 21 days
xiaojing.nyc.mn kj.xiaojing.nyc.mn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
258741.xyz pb.258741.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mah-group.ir sl.mah-group.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 31 days
sadegh67.ir sm.mahmood.sadegh67.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mogami.cc st.mogami.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
sjavadgh.ir st.sjavadgh.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ebg.ir us.ebg.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 56 days
zhonghaoyuan.cn vl.zhonghaoyuan.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
861314.xyz tz.861314.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
applle3.ir a.applle3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 62 days
hina.ninja b.hina.ninja
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
pouriyaa.ir b.pouriyaa.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
goodmoring235.cn k.goodmoring235.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
hhy.ink p.hhy.ink
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 23 days
funxbox.xyz s.funxbox.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
szyi.site s.szyi.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 26 days
hikingpacking.com w.hikingpacking.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 33 days
babyboss.cfd x.babyboss.cfd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 38 days
159987.xyz y.159987.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
ccipaptv.buzz cloudf.ccipaptv.buzz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 65 days
dsoheilb.ir davoood.dsoheilb.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
cloud-ip.biz deadpool.premiummm.cloud-ip.biz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
ejustageram.ir desmotaheri.ejustageram.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
gheibipour.ir dev4.gheibipour.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 24 days
55042731.xyz dingyue.55042731.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
cekay.cn diy.cekay.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 25 days
directed.ir dns.directed.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 69 days
dongwenbao.pp.ua dongwenbao.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
818626.xyz dyp.818626.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
crossback.de edge.crossback.de
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
energyphysioclinic.com energyphysioclinic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 72 days
anymath.ir ether-cannon-embellish-prewashed.anymath.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 24 days
medicaldream.ir fast-2.medicaldream.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
alborzpatrik.online fedgetunnel6.alborzpatrik.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 21 days
mianmianku.com flash.mianmianku.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 83 days
ro.to freefq.ro.to
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fuxiaoxin.sbs fuxiaoxin.sbs
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 16 days
40cheraagh.ir galar2galar2galar2.40cheraagh.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
galaxy811.xyz galaxy811.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 10 days
donyayeemrooz.ir geihgerig.donyayeemrooz.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
sudatech.store global.sudatech.store
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
gnctrhc.xyz gnctrhc.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mrcowhides.ir halo.mrcowhides.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
hamed-azizi.com hamedazizi.art.hamed-azizi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 73 days
downloadbazha.ir harry.downloadbazha.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
mehr1dad.ir hello-world-lively-dust-bb7d.mehr1dad.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
tarhe.click hessel.tarhe.click
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
holypal.top holypalbpb.holypal.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
holypal.top holypalworkbpb.holypal.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 50 days
fergaltnt.ir hongkongdomins.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 54 days
optimizeseo.site hossein.optimizeseo.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 2 days
iclarified.com iclarified.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-538904910 Dec 2024 Dec 2024 One Off
skyman.cloud infinisky.skyman.cloud
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 29 days
cloudns.nz iran.clickeyourip.cloudns.nz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
armanm.ir irankojeafoqjfoqfjqoofjqghjqjqqjgkqjggjqfjqofjqiwehghikhssssswo.armanm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
dsoheilb1.ir jafari1sl.dsoheilb1.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
jerryworld.xyz jerryworld.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 74 days
applle3.ir koreapanelvippopp.applle3.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 24 days
linziblog.org linziblog.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 22 days
khamoosh.site live.khamoosh.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 32 days
lonei.com lonei.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
luyuan.pp.ua luyuan.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
maddress.site maddress.site
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
sardabirnews.com magic.sardabirnews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 8 days
sarisam.ir mahbouobemazan.sarisam.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
erfanhub.ir manager.erfanhub.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 70 days
abedism.ir matin.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
ipz.pp.ua meiguo.ipz.pp.ua
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
nscl.ir meri.nscl.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 82 days
mhtadayon.ir mht.mhtadayon.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 1 day
918518.xyz mianban.918518.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
bilbilaki.ir milile.bilbilaki.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 38 days
yxhx1043.ir mlmfe.yxhx1043.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
goshime.com mobile.goshime.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 24 days
mobailfarid2.ir mohsennaderi.mobailfarid2.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
abedism.ir mojtabarahimi.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
downloadbazha.ir monadi.downloadbazha.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
ejusta.ir monameysabume.ejusta.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 25 days
mkjh.ir mortal.1.kombat.pack.mkjh.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
cloudns.nz morteza.m2rayng-pro.cloudns.nz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
downloadbazz.ir najaf.downloadbazz.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 41 days
caspiancoldrolled.ir navid-bpb.caspiancoldrolled.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 65 days
odie.xyz nbpb.odie.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 82 days
armanm.ir netherland.armanm.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mraniki.top october.mraniki.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 29 days
badboy.cc page.badboy.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Oct 2024 One Off
tanzunsx.ir page.tanzunsx.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
algholami.ir page3.algholami.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 21 days
algholami.ir page5.algholami.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 21 days
dgtaler.ir pages.dgtaler.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
linux-title.ir pages.linux-title.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 27 days
136119.xyz pan.136119.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
1989064.xyz panel.1989064.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
aminge.xyz panel.aminge.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 37 days
diginaakoo.ir panel.diginaakoo.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 56 days
gamewelldone.com panel.gamewelldone.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 23 days
godky.cn panel.godky.cn
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 32 days
3d.tc panel.lovemm.3d.tc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
app.tc panel.lovemm.app.tc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
niucoucou.top panel.niucoucou.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
happyrobotics.com panel1.happyrobotics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
fergaltnt.ir panelemiratevipirancenteral2.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 12 days
fergaltnt.ir panelgermany.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fergaltnt.ir panelgermanypanelgermany.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Dec 2024 54 days
fergaltnt.ir panelhongkonghongkongmn.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
fergaltnt.ir panelturkiye.fergaltnt.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
mangasell.ir parspack.com.mangasell.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Dec 2024 2 days
5866117.xyz pbp.5866117.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 40 days
65205118.xyz pbp.65205118.xyz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Oct 2024 20 days
longtzst.eu pbp.longtzst.eu
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
abedism.ir pcpc.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 39 days
guaiguai999.org peipei.guaiguai999.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 40 days
abedism.ir pesaranam.abedism.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
mamatune.top pfr6.mamatune.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Nov 2024 Nov 2024 One Off
sony5plus.ir podcast.sony5plus.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
hiworld.ir pol.hiworld.ir
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 40 days
kiyarash6.lol poori.kiyarash6.lol
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Nov 2024 79 days
c5e2c2ff58894c639bd26dcfcdc4bf86.cloud ppp.c5e2c2ff58894c639bd26dcfcdc4bf86.cloud
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Oct 2024 Nov 2024 39 days
xeryx.top proxy.xeryx.top
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 One Off
fengrui.link rayapi.fengrui.link
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Dec 2024 84 days
rccrhost.com rccrhost.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-K7SNBZ Sep 2024 Sep 2024 7 days
BPB.MORTEZASHAMLOO.IR
Non IP Attributes
Attribute First Last
GTM GTM-K7SNBZ Sep 2024 Dec 2024
OX OX-539074089 Dec 2024 Dec 2024
OX OX-539164681 Dec 2024 Dec 2024
OX OX-537127704 Dec 2024 Dec 2024
OX OX-539079344 Dec 2024 Dec 2024
OX OX-538904910 Dec 2024 Dec 2024
NEX NEX-3427 Dec 2024 Dec 2024
NEX NEX-650147 Dec 2024 Dec 2024
IEX IEX-183785 Dec 2024 Dec 2024
IEX IEX-185019 Dec 2024 Dec 2024
CA CA-PUB-3121563445182145 Dec 2024 Dec 2024
RUB RUB-11576 Dec 2024 Dec 2024
RUB RUB-18576 Dec 2024 Dec 2024
DM DM-100298 Dec 2024 Dec 2024
SHAR SHAR-AAB3FB7D Dec 2024 Dec 2024
AOL AOL-56740 Dec 2024 Dec 2024
YAHO YAHO-54954 Dec 2024 Dec 2024
YAHO YAHO-58286 Dec 2024 Dec 2024
CTX CTX-561495 Dec 2024 Dec 2024
MEDI MEDI-8CUYEJ1S6 Dec 2024 Dec 2024
MEDI MEDI-8CUYUTY34 Dec 2024 Dec 2024
SONO SONO-3CA00B51C4 Dec 2024 Dec 2024
SONO SONO-800F1BA406 Dec 2024 Dec 2024
APS APS-3336 Dec 2024 Dec 2024
PUBM PUBM-157326 Dec 2024 Dec 2024
SVRN SVRN-235106 Dec 2024 Dec 2024
LIJI LIJI-235106 Dec 2024 Dec 2024
TRIP TRIP-12458 Dec 2024 Dec 2024
CRIT CRIT-B-062691 Dec 2024 Dec 2024
MGRID MGRID-E4CMGJ Dec 2024 Dec 2024
ONET ONET-7E0BF488EE44332 Dec 2024 Dec 2024
ONET ONET-7E0BF488EE44332-OB Dec 2024 Dec 2024
YUME YUME-2070966140 Dec 2024 Dec 2024
SMAA SMAA-1100036483 Dec 2024 Dec 2024
TAPP TAPP-35919 Dec 2024 Dec 2024
INFO INFO-3353280 Dec 2024 Dec 2024
BPB.MORTEZASHAMLOO.IR
Overlap Attribute Domains
bpb.mortezashamloo.ir bpb.mortezashamloo.ir
moonjanebi.com moonjanebi.com
mortezashamloo.mortezashamloo.ir mortezashamloo.mortezashamloo.ir
testaw.mtbrand.ir testaw.mtbrand.ir
bpb245.ehsanzz.ir bpb245.ehsanzz.ir
downdetector.dk downdetector.dk
abcds.mkzh2shjyz.top abcds.mkzh2shjyz.top
downdetector.com.ar downdetector.com.ar
aws.mtbrand.ir aws.mtbrand.ir
ru.mounesi.ir ru.mounesi.ir
downdetector.co.il downdetector.co.il
neginkarimi.mobailfarid2.ir neginkarimi.mobailfarid2.ir
downdetector.co.nz downdetector.co.nz
bpb.mohsekarim7.ir bpb.mohsekarim7.ir
falk.mounesi.online falk.mounesi.online
downdetector.cl downdetector.cl
calculateact.com calculateact.com
log.moonfix.ir log.moonfix.ir
moonfix.ir moonfix.ir
downdetector.com.co downdetector.com.co
mahjanebi.ir mahjanebi.ir
primee.mtbrand.ir primee.mtbrand.ir
aghanavid.mobailfarid2.ir aghanavid.mobailfarid2.ir
mirzaii1.mtbrand.ir mirzaii1.mtbrand.ir
mirabdolbaghi.ir mirabdolbaghi.ir
doo.moonfix.ir doo.moonfix.ir
falk.mounesi.ir falk.mounesi.ir
downdetector.cz downdetector.cz
cd.mahjanebi.ir cd.mahjanebi.ir
cf.linjunzs.cn cf.linjunzs.cn
downdetector.gr downdetector.gr
testip.mobailfarid3.ir testip.mobailfarid3.ir
pfr3.mamatune.top pfr3.mamatune.top
pfr4.mamatune.top pfr4.mamatune.top
relay.burger-plus.ir relay.burger-plus.ir
bpb.hzdragon.top bpb.hzdragon.top
downdetector.ec downdetector.ec
vala.computationaladvancements.com vala.computationaladvancements.com
open.caiyongchao.top open.caiyongchao.top
allestoringen.nl allestoringen.nl
dir.moonfix.ir dir.moonfix.ir
epic.mahdibm.com epic.mahdibm.com
bpbp.krislovingmyrna.sbs bpbp.krislovingmyrna.sbs
downdetector.pt downdetector.pt
downdetector.jp downdetector.jp
eregon.computationaladvancements.com eregon.computationaladvancements.com
vless-panel.bluehat358.my.id vless-panel.bluehat358.my.id
hi.mahjanebi.ir hi.mahjanebi.ir
downdetector.se downdetector.se
cn.lirytin.pw cn.lirytin.pw
downdetector.it downdetector.it
snap.hiworld3.ir snap.hiworld3.ir
downdetector.at downdetector.at
downdetector.sg downdetector.sg
pbp.gebotai.cc pbp.gebotai.cc
downdetector.fi downdetector.fi
downdetector.ie downdetector.ie
bpb.linspire.cc bpb.linspire.cc
free.waznimey.loseyourip.com free.waznimey.loseyourip.com
070809.xyz 070809.xyz
sub.haichuan.online sub.haichuan.online
downdetector.fr downdetector.fr
downdetector.co.uk downdetector.co.uk
downdetector.ro downdetector.ro
downdetector.sk downdetector.sk
pfr2.mamatune.top pfr2.mamatune.top
bpbw.john19820.top bpbw.john19820.top
downdetector.hk downdetector.hk
downdetector.pe downdetector.pe
mainsub.iranfilm-dl.online mainsub.iranfilm-dl.online
bpb.haibin7.xyz bpb.haibin7.xyz
houjue83.com houjue83.com
banyungong.space banyungong.space
downdetector.tw downdetector.tw
downdetector.hu downdetector.hu
downdetector.id downdetector.id
downdetector.hr downdetector.hr
allestoringen.be allestoringen.be
channelbiz.es channelbiz.es
wincustomize.com wincustomize.com
downdetector.in downdetector.in
channelbiz.de channelbiz.de
qj.net qj.net
channelbiz.fr channelbiz.fr
downdetector.pk downdetector.pk
downdetector.pl downdetector.pl
downdetector.ca downdetector.ca
geekgirlauthority.com geekgirlauthority.com
windowsxlive.net windowsxlive.net
extremetech.com extremetech.com
itespresso.fr itespresso.fr
downdetector.mx downdetector.mx
downdetector.web.tr downdetector.web.tr
mobiletechreview.com mobiletechreview.com
siliconweek.com siliconweek.com
downdetector.com.au downdetector.com.au
androidcommunity.com androidcommunity.com
downdetector.ph downdetector.ph
downloadcrew.com downloadcrew.com
itespresso.es itespresso.es
laile.lyv3518.top laile.lyv3518.top
lerarn.doway.ir lerarn.doway.ir
liukaiblog.cn liukaiblog.cn
lsls.682095.xyz lsls.682095.xyz
lxy.530302.xyz lxy.530302.xyz
majid.majidarchive.ir majid.majidarchive.ir
mcbpb120.hly110-cf.com mcbpb120.hly110-cf.com
mdy0505.tsy103.site mdy0505.tsy103.site
mehdbarzddsarkelaa.ejusta.ir mehdbarzddsarkelaa.ejusta.ir
mehdimlm.dsoheilb.ir mehdimlm.dsoheilb.ir
mehran.abedism.ir mehran.abedism.ir
mermer.bachebiapain.ir mermer.bachebiapain.ir
mirab.amir.mashhad.hamed.aseman.skymobiletm.ir mirab.amir.mashhad.hamed.aseman.skymobiletm.ir
mirza.amirranger.online mirza.amirranger.online
mnasjfjdbdjcjdjfhdjfhejsbxjdjxhdjxjwjdnrvdjxbdjxbelwbxhdndjcjsj.fergaltnt.ir mnasjfjdbdjcjdjfhdjfhejsbxjdjxhdjxjwjdnrvdjxbdjxbelwbxhdndjcjsj.fergaltnt.ir
moon.nscl.ir moon.nscl.ir
rezaei.dsoheilb1.ir rezaei.dsoheilb1.ir
mynet.jssean.top mynet.jssean.top
mypanel.kodenul.my.id mypanel.kodenul.my.id
mywork.bilbilak.xyz mywork.bilbilak.xyz
nginx-f.bachebiapain.ir nginx-f.bachebiapain.ir
notebooks.com notebooks.com
onlysluts.us onlysluts.us
ookla.com ookla.com
rasulkarimi.dsoheilb.ir rasulkarimi.dsoheilb.ir
page.algholami.ir page.algholami.ir
page.iolo.ir page.iolo.ir
page.ps4link.ru page.ps4link.ru
pages.0hoo.ir pages.0hoo.ir
pages.772013.xyz pages.772013.xyz
rayanetcenter.ir rayanetcenter.ir
rayo.rayo.ip-dynamic.org rayo.rayo.ip-dynamic.org
panel.100661.xyz panel.100661.xyz
panel.237271.xyz panel.237271.xyz
panel.codemind.ir panel.codemind.ir
panel.dj18.top panel.dj18.top
panel.familynetwork.ir panel.familynetwork.ir
panel.music110.top panel.music110.top
panel.usa.fergaltnt.ir panel.usa.fergaltnt.ir
panel.zdxq.xyz panel.zdxq.xyz
panel245.812345678.xyz panel245.812345678.xyz
panelswitzerlandvipmnippiookio.fergaltnt.ir panelswitzerlandvipmnippiookio.fergaltnt.ir
mohsentoy.ir mohsentoy.ir
pbp.freegift.pp.ua pbp.freegift.pp.ua
pbp.mumumumushu.org pbp.mumumumushu.org
peybeton.ir peybeton.ir
pfr1.mamatune.top pfr1.mamatune.top
pgs.frdosi.ir pgs.frdosi.ir
pooorism.abedism.ir pooorism.abedism.ir
peransasarejus.hafasamcompany.ir peransasarejus.hafasamcompany.ir
pro.4flw.com pro.4flw.com
pxf.yca888.nyc.mn pxf.yca888.nyc.mn
rezamahmoodi.mobailfarid2.ir rezamahmoodi.mobailfarid2.ir
rga.12233345.xyz rga.12233345.xyz
applle3singaporemn23kko.applle3.ir applle3singaporemn23kko.applle3.ir
royaei.dsoheilb1.ir royaei.dsoheilb1.ir
arashkhalili.mobailfarid2.ir arashkhalili.mobailfarid2.ir
saeedjafari.dsoheilb.ir saeedjafari.dsoheilb.ir
saihan.asia saihan.asia
saliminz784.getconf.zabanamooz.tech saliminz784.getconf.zabanamooz.tech
saman.abedism.ir saman.abedism.ir
adbt.ir adbt.ir
afggtfx.higf.alirezamansoury.ir afggtfx.higf.alirezamansoury.ir
aghaforughi.abedism.ir aghaforughi.abedism.ir
netco.candidwears.ir netco.candidwears.ir
aiol.xyz aiol.xyz
aloalo.dsoheilb.ir aloalo.dsoheilb.ir
seyedpc.shop seyedpc.shop
alinight.abedism.ir alinight.abedism.ir
sherrytsang.cfd sherrytsang.cfd
shopvipback.uk shopvipback.uk
singlyq.tro.4683239.xyz singlyq.tro.4683239.xyz
singbox.cheni96.top singbox.cheni96.top
singbox.jackdrogba.top singbox.jackdrogba.top
singbox.jsczczc.nyc.mn singbox.jsczczc.nyc.mn
singbox.kaiserxu.asia singbox.kaiserxu.asia
soscctv.ir soscctv.ir
api.parskala.cloud api.parskala.cloud
speed.hesabfun.ir speed.hesabfun.ir
speed.moallemfile.ir speed.moallemfile.ir
speedtesttestuploaddownloadspeeft.kejbahs.cfd speedtesttestuploaddownloadspeeft.kejbahs.cfd
spring.mermerrnd.sbs spring.mermerrnd.sbs
api1.tech-offline.ir api1.tech-offline.ir
abed.abedism.ir abed.abedism.ir
sub.laixianzheng.nyc.mn sub.laixianzheng.nyc.mn
ahmadqhanbari.mobailfarid3.ir ahmadqhanbari.mobailfarid3.ir
ambpb.metroplus1.ir ambpb.metroplus1.ir
svaezz.downloadbazha.ir svaezz.downloadbazha.ir
test.6686888.xyz test.6686888.xyz
testni.nscl.ir testni.nscl.ir
babycalmdown.oppc.ir babycalmdown.oppc.ir
bache-paieene-shahr.decorationdesign1403.ir bache-paieene-shahr.decorationdesign1403.ir
bache.kermanconcert.ir bache.kermanconcert.ir
tianya0728bpb.moxuetianya.com tianya0728bpb.moxuetianya.com
baoshi.bpb.ursfur.net baoshi.bpb.ursfur.net
batiti923.getconf.zabanamooz.tech batiti923.getconf.zabanamooz.tech
bbb.bbgzyxoicqq.sbs bbb.bbgzyxoicqq.sbs
bbb.zwp.world bbb.zwp.world
tuta744.getconf.zabanamooz.tech tuta744.getconf.zabanamooz.tech
twisted-royal.bachebiapain.ir twisted-royal.bachebiapain.ir
bgp.feyfey.uk bgp.feyfey.uk
uuijk.znj1968.xyz uuijk.znj1968.xyz
vbb.hrasad.ir vbb.hrasad.ir
ver.bangboo.xyz ver.bangboo.xyz
blog.bazivashadi.ir blog.bazivashadi.ir
vip.mtbrand.ir vip.mtbrand.ir
vless.babybirdcn.top vless.babybirdcn.top
vless.cm-vless.sbs vless.cm-vless.sbs
vlessda.zzy520.top vlessda.zzy520.top
vlab.chenghua.sbs vlab.chenghua.sbs
vpn2.pikachuenglish.com vpn2.pikachuenglish.com
wao.dubya.info wao.dubya.info
bpb-a.kkhome.top bpb-a.kkhome.top
bpb-page.5201989.xyz bpb-page.5201989.xyz
bpb-proxy.mie-ai.top bpb-proxy.mie-ai.top
bpb-worker-panel-bvz.20100207.xyz bpb-worker-panel-bvz.20100207.xyz
bpb-worker-panel.cxtz-001.top bpb-worker-panel.cxtz-001.top
bpb.023111.xyz bpb.023111.xyz
bpb.052360.xyz bpb.052360.xyz
bpb.070022.xyz bpb.070022.xyz
bpb.10086vip.uk bpb.10086vip.uk
bpb.113344.xyz bpb.113344.xyz
bpb.152492.xyz bpb.152492.xyz
bpb.1688598.xyz bpb.1688598.xyz
bpb.17800.buzz bpb.17800.buzz
bpb.1788888.xyz bpb.1788888.xyz
bpb.189789.xyz bpb.189789.xyz
bpb.19760929.xyz bpb.19760929.xyz
bpb.198122.xyz bpb.198122.xyz
bpb.19821124.xyz bpb.19821124.xyz
bpb.22446688.buzz bpb.22446688.buzz
bpb.28590328.xyz bpb.28590328.xyz
bpb.298999.xyz bpb.298999.xyz
bpb.345589.xyz bpb.345589.xyz
bpb.4007777.xyz bpb.4007777.xyz
bpb.404505606.xyz bpb.404505606.xyz
bpb.489822.xyz bpb.489822.xyz
bpb.520131445.xyz bpb.520131445.xyz
bpb.520299.xyz bpb.520299.xyz
bpb.542872490.xyz bpb.542872490.xyz
bpb.5583.world bpb.5583.world
bpb.61760238.xyz bpb.61760238.xyz
bpb.62283063.xyz bpb.62283063.xyz
bpb.6686888.xyz bpb.6686888.xyz
bpb.760925.xyz bpb.760925.xyz
bpb.811120.xyz bpb.811120.xyz
bpb.886123.xyz bpb.886123.xyz
bpb.999881.xyz bpb.999881.xyz
bpb.allin66.sbs bpb.allin66.sbs
bpb.aobo.pw bpb.aobo.pw
bpb.baranifact.ir bpb.baranifact.ir
bpb.bcfxclub.sbs bpb.bcfxclub.sbs
bpb.bigfu4nets.top bpb.bigfu4nets.top
bpb.bjzkar.ren bpb.bjzkar.ren
bpb.cgfriend.top bpb.cgfriend.top
bpb.coolsoul.co bpb.coolsoul.co
bpb.dafengzi.top bpb.dafengzi.top
bpb.daxiong.pp.ua bpb.daxiong.pp.ua
bpb.ddss.online bpb.ddss.online
bpb.dormitory5017.cyou bpb.dormitory5017.cyou
bpb.fans.hcfiller.com bpb.fans.hcfiller.com
bpb.flaresky.top bpb.flaresky.top
bpb.fluffy90.online bpb.fluffy90.online
bpb.fwangping.top bpb.fwangping.top
bpb.ghjytu112.top bpb.ghjytu112.top
bpb.gjz518.top bpb.gjz518.top
bpb.gnaygnoy.nyc.mn bpb.gnaygnoy.nyc.mn
bpb.gnaygnoylt.nyc.mn bpb.gnaygnoylt.nyc.mn
bpb.gptclub.top bpb.gptclub.top
bpb.gramyar.ir bpb.gramyar.ir
bpb.hanjiangke.nyc.mn bpb.hanjiangke.nyc.mn
bpb.hcksensor.top bpb.hcksensor.top
bpb.hellopluto.uk bpb.hellopluto.uk
bpb.hopol.win bpb.hopol.win
bpb.hutail.xyz bpb.hutail.xyz
bpb.hwd.pp.ua bpb.hwd.pp.ua
bpb.iori.pp.ua bpb.iori.pp.ua
bpb.isme.live bpb.isme.live
bpb.jijiang6.top bpb.jijiang6.top
bpb.kero990.pp.ua bpb.kero990.pp.ua
bpb.lala.0j0.jp bpb.lala.0j0.jp
bpb.ludeapd.top bpb.ludeapd.top
bpb.lyt.com.mp bpb.lyt.com.mp
bpb.me.onlyforme.ir bpb.me.onlyforme.ir
bpb.mirela.ir bpb.mirela.ir
bpb.mirshekaran.ir bpb.mirshekaran.ir
bpb.njyp.xyz bpb.njyp.xyz
bpb.notmmao.me bpb.notmmao.me
bpb.otan.org.uk bpb.otan.org.uk
bpb.payfirst.club bpb.payfirst.club
bpb.sandy1029.cloud bpb.sandy1029.cloud
bpb.snaily.top bpb.snaily.top
bpb.suxu.asia bpb.suxu.asia
bpb.ucvape.cc bpb.ucvape.cc
bpb.vitfrank.link bpb.vitfrank.link
bpb.vvcbill.914520.xyz bpb.vvcbill.914520.xyz
bpb.weiaixin.space bpb.weiaixin.space
bpb.weizhen.xyz bpb.weizhen.xyz
bpb.woskee.xyz bpb.woskee.xyz
bpb.wyz.pp.ua bpb.wyz.pp.ua
bpb.yeqing.me bpb.yeqing.me
bpb.yier.me bpb.yier.me
bpb.zhangwenkang.top bpb.zhangwenkang.top
bpb.zhj13.com bpb.zhj13.com
bpb0504.hkcool.pp.ua bpb0504.hkcool.pp.ua
bpb0716.aozorako.com bpb0716.aozorako.com
bpb1.050166.top bpb1.050166.top
bpb1.765423.xyz bpb1.765423.xyz
bpb18.19760929.xyz bpb18.19760929.xyz
bpb2.489822.xyz bpb2.489822.xyz
bpb202405.36950288.xyz bpb202405.36950288.xyz
bpb245.lgf5090.sbs bpb245.lgf5090.sbs
bpb27-1.lileoxiu.nyc.mn bpb27-1.lileoxiu.nyc.mn
bpb728.156889.xyz bpb728.156889.xyz
bpbnewadd.ww.msdjw.sbs bpbnewadd.ww.msdjw.sbs
bpbok1.61760238.xyz bpbok1.61760238.xyz
bpbpages.6666656.xyz bpbpages.6666656.xyz
bpbsingbox.liannian.com bpbsingbox.liannian.com
bpbtls.woshihutao123.ip-ddns.com bpbtls.woshihutao123.ip-ddns.com
bpbw.8p.ink bpbw.8p.ink
work.beggar.top work.beggar.top
wrck.sh-do-1x-2s.pro wrck.sh-do-1x-2s.pro
xbbb.zcdn.vip xbbb.zcdn.vip
xtangbao.top xtangbao.top
yiyuya.nyc.mn yiyuya.nyc.mn
yyds.yufour.top yyds.yufour.top
cdf.830323.xyz cdf.830323.xyz
cdf.cfalirez.top cdf.cfalirez.top
cdn3.persismotorsport.ir cdn3.persismotorsport.ir
ceshi.tagh.xyz ceshi.tagh.xyz
zidong.052088.xyz zidong.052088.xyz
cfp.kado.best cfp.kado.best
cfpanel.694016.xyz cfpanel.694016.xyz
cfw.mojecloud.ir cfw.mojecloud.ir
ba.applle3.ir ba.applle3.ir
ai.1362282.xyz ai.1362282.xyz
al.aliff.ir al.aliff.ir
check-host.top check-host.top
bp.catbank.cn bp.catbank.cn
cc.minghui.lol cc.minghui.lol
cf.3319.cloud-ip.biz cf.3319.cloud-ip.biz
cf.eatumom.cc cf.eatumom.cc
cf.willshen.top cf.willshen.top
dl.itsfine.ir dl.itsfine.ir
dl.test.itsfine.ir dl.test.itsfine.ir
fq.pswluo.cn fq.pswluo.cn
gr.masnavi.top gr.masnavi.top
kr.4reavless.xyz kr.4reavless.xyz
kv.jgyu.com kv.jgyu.com
ky.965000.xyz ky.965000.xyz
mn.jmnt.ir mn.jmnt.ir
su.deebian.com su.deebian.com
wk.meinpi.top wk.meinpi.top
ws.cherry.nl.am ws.cherry.nl.am
b.testgitcode.sbs b.testgitcode.sbs
b.yasharkia.ir b.yasharkia.ir
cla.xiaohhubs.top cla.xiaohhubs.top
x.is9630onjq4h7vduscu3shqvg7bnolxwvbg9gf3a4s2wrej2xbdtcvejabwugr2.cfd x.is9630onjq4h7vduscu3shqvg7bnolxwvbg9gf3a4s2wrej2xbdtcvejabwugr2.cfd
cloudflare.clickeyourip1.cloudns.nz cloudflare.clickeyourip1.cloudns.nz
contactus.tonal1.ir contactus.tonal1.ir
cqn9105.cn cqn9105.cn
crmbpb.freeairlaines.com crmbpb.freeairlaines.com
darkness-auth.ir darkness-auth.ir
demo.njuy159.xyz demo.njuy159.xyz
dev2.itdreamnetwork.ir dev2.itdreamnetwork.ir
eagmin.com eagmin.com
fan.geomatrix.ir fan.geomatrix.ir
fast-3.medicaldream.ir fast-3.medicaldream.ir
fengyaoxi0628.top fengyaoxi0628.top
fereydonsaediyan.mobailfarid2.ir fereydonsaediyan.mobailfarid2.ir
fgtr.mysbs.top fgtr.mysbs.top
file.stream2.byethost3.com file.stream2.byethost3.com
fishimahii.hafasamcompany.ir fishimahii.hafasamcompany.ir
fmp.mytopmov.ir fmp.mytopmov.ir
fpgh3834.675979.xyz fpgh3834.675979.xyz
free.ivvo.top free.ivvo.top
friends.skymobiletm.ir friends.skymobiletm.ir
frwrd.azinja.beonja.zabanamooz.tech frwrd.azinja.beonja.zabanamooz.tech
gjd.feiyihao.cn gjd.feiyihao.cn
hamed.maleki.expire.2025.05.05.asemanbot.ir hamed.maleki.expire.2025.05.05.asemanbot.ir
hasan.net.labtob.asemannetwork.ir hasan.net.labtob.asemannetwork.ir
hash2.metroplus1.ir hash2.metroplus1.ir
hello-world-lively-dust-bb7d.iamabiologist.ir hello-world-lively-dust-bb7d.iamabiologist.ir
hkk.xiaoyuediandao.top hkk.xiaoyuediandao.top
huio.top huio.top
installed.clickeyourip.cloudns.nz installed.clickeyourip.cloudns.nz
irena.kharidbacklink.com irena.kharidbacklink.com
itdog.cn.zula.ir.ssmy.ir.com.v2.peedtest.com.visa.org.zac.ir.mresearcher.ir itdog.cn.zula.ir.ssmy.ir.com.v2.peedtest.com.visa.org.zac.ir.mresearcher.ir
jamali2.dsoheilb.ir jamali2.dsoheilb.ir
janebistore.monster janebistore.monster
jjh0401.top jjh0401.top
join.bede.vpncustomize.speedtest.net.imgolden.site join.bede.vpncustomize.speedtest.net.imgolden.site
karing.csbl.top karing.csbl.top
karing.gongmu319.top karing.gongmu319.top
kharide-asan.world kharide-asan.world
wkun.xyz wkun.xyz
jpr.emuci.buzz jpr.emuci.buzz
jsom-panel.dengkenet.com jsom-panel.dengkenet.com
khomein.cprmehrvarzi.ir khomein.cprmehrvarzi.ir
kimismsnotplaceju.ejusta.ir kimismsnotplaceju.ejusta.ir
king.mojikach.ir king.mojikach.ir
kjgx0803.wwwguo7.xyz kjgx0803.wwwguo7.xyz
link.cvui.top link.cvui.top
majedali.dsoheilb1.ir majedali.dsoheilb1.ir
mamadoo.ggyhied.kiya7171.ir mamadoo.ggyhied.kiya7171.ir
mekxsw.online mekxsw.online
mnalihasanialihasanimnalihasaniwwwqpmkmk.fergaltnt.ir mnalihasanialihasanimnalihasaniwwwqpmkmk.fergaltnt.ir
mnpaneljapan1japan1.fergaltnt.ir mnpaneljapan1japan1.fergaltnt.ir
mobilebagheri.tech mobilebagheri.tech
mohadessarej.hafasamcompany.ir mohadessarej.hafasamcompany.ir
mohamadmahmoodi.mobailfarid2.ir mohamadmahmoodi.mobailfarid2.ir
mohammad.dsoheilb1.ir mohammad.dsoheilb1.ir
morero.mrr.ir morero.mrr.ir
multi.oppc.ir multi.oppc.ir
mybpb.captaink.top mybpb.captaink.top
mzz.046019.xyz mzz.046019.xyz
normal.mvm1988.ir normal.mvm1988.ir
omidsalmasi.abedism.ir omidsalmasi.abedism.ir
onerootman.jijunrong.one onerootman.jijunrong.one
page.im4n.ir page.im4n.ir
page.roudi.pw page.roudi.pw
page2.algholami.ir page2.algholami.ir
panel.497882.xyz panel.497882.xyz
panel.801702116.xyz panel.801702116.xyz
panel.820105.xyz panel.820105.xyz
panel.alighadrboland.ir panel.alighadrboland.ir
panel.shelinwilson.top panel.shelinwilson.top
panelaustralia.fergaltnt.ir panelaustralia.fergaltnt.ir
panelfrance.fergaltnt.ir panelfrance.fergaltnt.ir
panelgermany3vipiran.fergaltnt.ir panelgermany3vipiran.fergaltnt.ir
panelgermanyyyypp3.applle3.ir panelgermanyyyypp3.applle3.ir
panelhongkong3iranppipgallcenxoqjxe.fergaltnt.ir panelhongkong3iranppipgallcenxoqjxe.fergaltnt.ir
panelsingaporemnkjsjdbejbejxos.fergaltnt.ir panelsingaporemnkjsjdbejbejxos.fergaltnt.ir
pbbs.viravips.com pbbs.viravips.com
pbp.wuzhiyuan.pp.ua pbp.wuzhiyuan.pp.ua
pbp.ynlwin.site pbp.ynlwin.site
photographybay.com photographybay.com
portal.boxisoft.ir portal.boxisoft.ir
rapidbpb.gpt4all.cfd rapidbpb.gpt4all.cfd
haha.dreamyyds.buzz haha.dreamyyds.buzz
rwei.nyc.mn rwei.nyc.mn
areukid.dsoheilb1.ir areukid.dsoheilb1.ir
admindastres.erfanfamily.ir admindastres.erfanfamily.ir
satsw.ir satsw.ir
ariyaphone.ir ariyaphone.ir
sea.nscl.ir sea.nscl.ir
server-70535eb6804c584cdd9cc.fortgift.ir server-70535eb6804c584cdd9cc.fortgift.ir
alprbpb.metroplus1.ir alprbpb.metroplus1.ir
alfakher.isnapics.xyz alfakher.isnapics.xyz
amy999.piaoluo000.top amy999.piaoluo000.top
amirhos.dsoheilb1.ir amirhos.dsoheilb1.ir
simsim.roostashahreiran.ir simsim.roostashahreiran.ir
singbox.fangmilu.cc singbox.fangmilu.cc
soheil.dsoheilb1.ir soheil.dsoheilb1.ir
apachemonsterwild.kaizenclub.top apachemonsterwild.kaizenclub.top
speedtest.950117.xyz speedtest.950117.xyz
speedtest.meganet.com.pl speedtest.meganet.com.pl
app-state.amirardi.pw app-state.amirardi.pw
srvdl.centralpto.com srvdl.centralpto.com
abc.aoo.ink abc.aoo.ink
abdolah.mobailfarid2.ir abdolah.mobailfarid2.ir
sub.drkordmirza.com sub.drkordmirza.com
sub2.javad490.ir sub2.javad490.ir
atefamooramzaeju.ejusta.ir atefamooramzaeju.ejusta.ir
auto.khamoosh.site auto.khamoosh.site
test.dsoheilb.ir test.dsoheilb.ir
test.k0o.ir test.k0o.ir
test.medicalhistory.ir test.medicalhistory.ir
test241010.betterid.cfd test241010.betterid.cfd
baasiri.pro baasiri.pro
bahman.dsoheilb1.ir bahman.dsoheilb1.ir
tls.vesslan.site tls.vesslan.site
bearblog.site bearblog.site
tsang.preciousleaf.xyz tsang.preciousleaf.xyz
usa.armanm.ir usa.armanm.ir
user1441.freeairlaines.com user1441.freeairlaines.com
biubiu.dtshot8.com biubiu.dtshot8.com
virussisvsis.ir virussisvsis.ir
vless2.v2com.sbs vless2.v2com.sbs
vless5.ylyns.sbs vless5.ylyns.sbs
bnopb.majaaaz.ir bnopb.majaaaz.ir
vpn.cloudvalley.host vpn.cloudvalley.host
vpn.akljsdklajdsl.pp.ua vpn.akljsdklajdsl.pp.ua
vpn3.520123.top vpn3.520123.top
wahed945.getconf.zabanamooz.tech wahed945.getconf.zabanamooz.tech
wall.lzws.top wall.lzws.top
warppage3.johnnykhu.asia warppage3.johnnykhu.asia
wbpb.ariesljm.buzz wbpb.ariesljm.buzz
bpb-mhi.medicalhistory.ir bpb-mhi.medicalhistory.ir
bpb-net-us.aceking.work bpb-net-us.aceking.work
bpb-panel.mymjze.cfd bpb-panel.mymjze.cfd
bpb.02251007.xyz bpb.02251007.xyz
bpb.0591cn.com bpb.0591cn.com
bpb.13807735.xyz bpb.13807735.xyz
bpb.15minutes.work bpb.15minutes.work
bpb.16885885.xyz bpb.16885885.xyz
bpb.169986.xyz bpb.169986.xyz
bpb.1987000.xyz bpb.1987000.xyz
bpb.198968.xyz bpb.198968.xyz
bpb.220814.site bpb.220814.site
bpb.220814.xyz bpb.220814.xyz
bpb.2234566.xyz bpb.2234566.xyz
bpb.2678123.xyz bpb.2678123.xyz
bpb.27777777.xyz bpb.27777777.xyz
bpb.292775.xyz bpb.292775.xyz
bpb.320402.xyz bpb.320402.xyz
bpb.3344550.xyz bpb.3344550.xyz
bpb.360669.xyz bpb.360669.xyz
bpb.37dns.vip bpb.37dns.vip
bpb.37ltd.com bpb.37ltd.com
bpb.3890276.xyz bpb.3890276.xyz
bpb.502401.xyz bpb.502401.xyz
bpb.517000.xyz bpb.517000.xyz
bpb.5377811.sbs bpb.5377811.sbs
bpb.55555555.best bpb.55555555.best
bpb.557668.xyz bpb.557668.xyz
bpb.557707.xyz bpb.557707.xyz
bpb.56318989.xyz bpb.56318989.xyz
bpb.604.ltd bpb.604.ltd
bpb.665655.xyz bpb.665655.xyz
bpb.690711.xyz bpb.690711.xyz
bpb.710110875.xyz bpb.710110875.xyz
bpb.720720720.xyz bpb.720720720.xyz
bpb.778945.xyz bpb.778945.xyz
bpb.8155053.com bpb.8155053.com
bpb.880399.xyz bpb.880399.xyz
bpb.890218.xyz bpb.890218.xyz
bpb.906051999.xyz bpb.906051999.xyz
bpb.952300.xyz bpb.952300.xyz
bpb.96b.in bpb.96b.in
bpb.999607.xyz bpb.999607.xyz
bpb.aigg.eu bpb.aigg.eu
bpb.ascarparts.com bpb.ascarparts.com
bpb.baynixk.sbs bpb.baynixk.sbs
bpb.belper.xyz bpb.belper.xyz
bpb.bldcn.top bpb.bldcn.top
bpb.buntool.com bpb.buntool.com
bpb.chatsmc.online bpb.chatsmc.online
bpb.chuange.pp.ua bpb.chuange.pp.ua
bpb.cjmahdi.ir bpb.cjmahdi.ir
bpb.cztor.us.kg bpb.cztor.us.kg
bpb.dadazhou.sbs bpb.dadazhou.sbs
bpb.darkwatercity.online bpb.darkwatercity.online
bpb.ddmonster.top bpb.ddmonster.top
bpb.ddxm.pp.ua bpb.ddxm.pp.ua
bpb.duoduola.cn bpb.duoduola.cn
bpb.dy81.link bpb.dy81.link
bpb.fanshu.de bpb.fanshu.de
bpb.fes.hk bpb.fes.hk
bpb.finanzam.com bpb.finanzam.com
bpb.fordust.top bpb.fordust.top
bpb.fsramon163.pp.ua bpb.fsramon163.pp.ua
bpb.fx-hl.com bpb.fx-hl.com
bpb.g22.top bpb.g22.top
bpb.haogougou.uk bpb.haogougou.uk
bpb.hldart.com bpb.hldart.com
bpb.ho3yn19.ir bpb.ho3yn19.ir
bpb.hustonstars.top bpb.hustonstars.top
bpb.icm.pp.ua bpb.icm.pp.ua
bpb.iuyi.top bpb.iuyi.top
bpb.jack132b01.nyc.mn bpb.jack132b01.nyc.mn
bpb.jaylensong.top bpb.jaylensong.top
bpb.john19820.top bpb.john19820.top
bpb.joinspace.pp.ua bpb.joinspace.pp.ua
bpb.junsixie.xyz bpb.junsixie.xyz
bpb.jushenqi.top bpb.jushenqi.top
bpb.kiandevteam.ir bpb.kiandevteam.ir
bpb.knightzzk.nyc.mn bpb.knightzzk.nyc.mn
bpb.komogroup.top bpb.komogroup.top
bpb.len.pp.ua bpb.len.pp.ua
bpb.linjabao.top bpb.linjabao.top
bpb.liq.pp.ua bpb.liq.pp.ua
bpb.liuchunqi.xyz bpb.liuchunqi.xyz
bpb.maovps.link bpb.maovps.link
bpb.meihao.buzz bpb.meihao.buzz
bpb.mk496366013.buzz bpb.mk496366013.buzz
bpb.moah79.top bpb.moah79.top
bpb.mxiancn.top bpb.mxiancn.top
bpb.myfreepass.ir bpb.myfreepass.ir
bpb.nibey.online bpb.nibey.online
bpb.ntok.top bpb.ntok.top
bpb.octopuslol.com bpb.octopuslol.com
bpb.pandagit.ir bpb.pandagit.ir
bpb.pandar.pp.ua bpb.pandar.pp.ua
bpb.parhde.ir bpb.parhde.ir
bpb.ph75738.pp.ua bpb.ph75738.pp.ua
bpb.ptstb.top bpb.ptstb.top
bpb.qdmg.club bpb.qdmg.club
bpb.qingxin.lol bpb.qingxin.lol
bpb.rsjhh.xyz bpb.rsjhh.xyz
bpb.saonian.online bpb.saonian.online
bpb.seyedx.ir bpb.seyedx.ir
bpb.slz.pp.ua bpb.slz.pp.ua
bpb.sxjcqx.cn bpb.sxjcqx.cn
bpb.tagh.xyz bpb.tagh.xyz
bpb.theshy.sbs bpb.theshy.sbs
bpb.trojapages.myboxes.cfd bpb.trojapages.myboxes.cfd
bpb.upchao.cn bpb.upchao.cn
bpb.water.pp.ua bpb.water.pp.ua
bpb.wiilsvless.sbs bpb.wiilsvless.sbs
bpb.wits.ink bpb.wits.ink
bpb.wkxs.de bpb.wkxs.de
bpb.xgcz.xyz bpb.xgcz.xyz
bpb.xinfujia.uk bpb.xinfujia.uk
bpb.xuketfe.top bpb.xuketfe.top
bpb.xuuuu.top bpb.xuuuu.top
bpb.zxqzz.sbs bpb.zxqzz.sbs
bpb01.totoro.studio bpb01.totoro.studio
bpb0705.737389.xyz bpb0705.737389.xyz
bpb1.otan.org.uk bpb1.otan.org.uk
bpb10.swqz.mom bpb10.swqz.mom
bpb2.1288025.xyz bpb2.1288025.xyz
bpb2.345589.xyz bpb2.345589.xyz
bpb2.cf.chenheyao05.top bpb2.cf.chenheyao05.top
bpb2.ehsanranjer.ir bpb2.ehsanranjer.ir
bpb2.now9888.com bpb2.now9888.com
bpb2.unitycourses.xi.to bpb2.unitycourses.xi.to
bpb2.vitfrank.link bpb2.vitfrank.link
bpb21.tanzunsx.ir bpb21.tanzunsx.ir
bpb244.hanweid.nyc.mn bpb244.hanweid.nyc.mn
bpb27-4.lileoxiu.nyc.mn bpb27-4.lileoxiu.nyc.mn
bpb3.wenjianken.com bpb3.wenjianken.com
bpbfrag1.cpiforpersia.uk bpbfrag1.cpiforpersia.uk
bpbkkk.bihu.co bpbkkk.bihu.co
bpbpanel.ddss.online bpbpanel.ddss.online
bpbpg.tczn.work bpbpg.tczn.work
bpbsia.amirktb.ir bpbsia.amirktb.ir
bpbsingbox.edtdigital.top bpbsingbox.edtdigital.top
bpbv.52pm.ink bpbv.52pm.ink
bpbv3.ehsanranjer.ir bpbv3.ehsanranjer.ir
bpbw.pangx.buzz bpbw.pangx.buzz
bpbwork-kxsw-0a2ad23.xdty.top bpbwork-kxsw-0a2ad23.xdty.top
bptest.tableshikhu2.sbs bptest.tableshikhu2.sbs
bpw.v0pc.com bpw.v0pc.com
welamirmohamy.ejusta.ir welamirmohamy.ejusta.ir
wol.lepc.vip wol.lepc.vip
bus.581525.xyz bus.581525.xyz
workers.5288z.com workers.5288z.com
writer239.getconf.zabanamooz.tech writer239.getconf.zabanamooz.tech
wzybpb.vopc.cn wzybpb.vopc.cn
xbkj0507.vvbaby.net xbkj0507.vvbaby.net
xianggang.7zp.pp.ua xianggang.7zp.pp.ua
xjwlmq.taoyang1893.xyz xjwlmq.taoyang1893.xyz
yong.nyc.mn yong.nyc.mn
cdn-core-e2906f77aea7f9c09a8a863c81c628ff.fortgift.ir cdn-core-e2906f77aea7f9c09a8a863c81c628ff.fortgift.ir
zendebadiranoirani.hdancer.site zendebadiranoirani.hdancer.site
cesuwang.520691.xyz cesuwang.520691.xyz
cfb.1096.pp.ua cfb.1096.pp.ua
cfbpb.jochon.cn cfbpb.jochon.cn
cfdns.51changjiang.cfd cfdns.51changjiang.cfd
cfvless.betterman.xyz cfvless.betterman.xyz
cfw.930405.xyz cfw.930405.xyz
znr.fengyan.buzz znr.fengyan.buzz
zula.speedtest.net.mangasell.ir zula.speedtest.net.mangasell.ir
ak.ericking.online ak.ericking.online
ae.ebg.ir ae.ebg.ir
cc.110233.xyz cc.110233.xyz
cc.helloethan.sbs cc.helloethan.sbs
cf.888888800.xyz cf.888888800.xyz
cf.bpb1.xyz cf.bpb1.xyz
bp.alumglass.org bp.alumglass.org
bp.youwan.buzz bp.youwan.buzz
de.eee.armanm.ir de.eee.armanm.ir
df.game.naver.com.vlez.salzy.my.id df.game.naver.com.vlez.salzy.my.id
dy.aibeluga.top dy.aibeluga.top
eu.mordaab.ir eu.mordaab.ir
fa.memarinama.com fa.memarinama.com
fw.35dog.com fw.35dog.com
gc.dorianv.ir gc.dorianv.ir
hm.alirez.space hm.alirez.space
hn.aouto.link hn.aouto.link
kr.akn.pp.ua kr.akn.pp.ua
mh.370066259.xyz mh.370066259.xyz
mm.jvmm.ir mm.jvmm.ir
mb.elims.top mb.elims.top
sg.avidez.my.id sg.avidez.my.id
tz.8189.in tz.8189.in
uk.ebg.ir uk.ebg.ir
us.bright.nyc.mn us.bright.nyc.mn
yy.funxbox.xyz yy.funxbox.xyz
b.ibajrqw.top b.ibajrqw.top
m.pagal.ir m.pagal.ir
p.asrnoor.ir p.asrnoor.ir
p.asrnour.ir p.asrnour.ir
m.wo.dubya.info m.wo.dubya.info
cloudflared.ir cloudflared.ir
cybmik-1.bfrserver2.info cybmik-1.bfrserver2.info
cybmik-1.krfserver3.info cybmik-1.krfserver3.info
dev2.netdreamworks.com dev2.netdreamworks.com
division2map.com division2map.com
dopraxkunt.site dopraxkunt.site
edbpb.harchi.pooyasharifi8208.ir edbpb.harchi.pooyasharifi8208.ir
ehsanfatahi.mobailfarid2.ir ehsanfatahi.mobailfarid2.ir
emergency.call.reza2143sava.ir emergency.call.reza2143sava.ir
emrica987.getconf.zabanamooz.tech emrica987.getconf.zabanamooz.tech
explore.streetdirectory.sg explore.streetdirectory.sg
farangiesmaeju.ejusta.ir farangiesmaeju.ejusta.ir
fast-3.medicaltreatment.ir fast-3.medicaltreatment.ir
fftest.developergitblog.cfd fftest.developergitblog.cfd
singbox.caomiao.work singbox.caomiao.work
form.trmusic.ir form.trmusic.ir
free.iamerfan.ir free.iamerfan.ir
freeg.jsdhksjksdklsdjk.ir freeg.jsdhksjksdklsdjk.ir
fuck.19861215.xyz fuck.19861215.xyz
galar1galar2galar3.40cheraagh.ir galar1galar2galar3.40cheraagh.ir
germanykmndhsudhwjshwhsbsjdoooowwbb4.applle3.ir germanykmndhsudhwjshwhsbsjdoooowwbb4.applle3.ir
gitnew.ro.to gitnew.ro.to
goh.pokh.lol goh.pokh.lol
gold.4flw.com gold.4flw.com
gorazu.ir gorazu.ir
hamidapadana.dsoheilb.ir hamidapadana.dsoheilb.ir
hkg.hunas.cc hkg.hunas.cc
hkr.emuci.buzz hkr.emuci.buzz
ieju6ee.32634369.xyz ieju6ee.32634369.xyz
imansheykhi.mobailfarid2.ir imansheykhi.mobailfarid2.ir
iranjojeafoqjfoqfjqoofjqghjqjqqjgkqjggjqfjqofjqiwehghikhssssswo.mtbrand.ir iranjojeafoqjfoqfjqoofjqghjqjqqjgkqjggjqfjqofjqiwehghikhssssswo.mtbrand.ir
isaaghaemateemaza.ejusta.ir isaaghaemateemaza.ejusta.ir
itespresso.de itespresso.de
izakcenter.online izakcenter.online
jdkk.135857.xyz jdkk.135857.xyz
jdrj0704.wwwguo7.xyz jdrj0704.wwwguo7.xyz
jenny.proxy-ip.vip jenny.proxy-ip.vip
rasool.yazdian.expire.2024.05.29.asemanbot.ir rasool.yazdian.expire.2024.05.29.asemanbot.ir
abolfazlalz.ir abolfazlalz.ir
abrokamon.decorationdesign1403.ir abrokamon.decorationdesign1403.ir
bpq.buzzloom.buzz bpq.buzzloom.buzz
abasjafari.dsoheilb.ir abasjafari.dsoheilb.ir
aboutus.damavand.uk aboutus.damavand.uk
yufour.top yufour.top
safe.erfanfamily.ir safe.erfanfamily.ir
safetvpn-playpoint-benana.blitz-vpn.site safetvpn-playpoint-benana.blitz-vpn.site
admin.saleh2323.ir admin.saleh2323.ir
sgdfgdf.k0o.ir sgdfgdf.k0o.ir
shad3s.iminitor.ir shad3s.iminitor.ir
shop.dsoheilb.ir shop.dsoheilb.ir
ameneh.maintainhydraulic.ir ameneh.maintainhydraulic.ir
simurghcloud.ir simurghcloud.ir
singapore.fergaltnt.ir singapore.fergaltnt.ir
singbox.520love.store singbox.520love.store
singbox.cloudwl.win singbox.cloudwl.win
singbox.hkkvray2.top singbox.hkkvray2.top
amir58.filimoiran.com amir58.filimoiran.com
sock.bewuyeluo.top sock.bewuyeluo.top
andylau19801.nyc.mn andylau19801.nyc.mn
speedtest.mehr1dad.ir speedtest.mehr1dad.ir
speedtest.myprojectsghost.online speedtest.myprojectsghost.online
asad.jkhg.alichamani.ir asad.jkhg.alichamani.ir
srv1.paad724.com srv1.paad724.com
store.cotton24.ir store.cotton24.ir
sturgeon.pp.ua sturgeon.pp.ua
suxu.asia suxu.asia
taherirezasar.mylifehf.ir taherirezasar.mylifehf.ir
arashkhalili1.mobailfarid3.ir arashkhalili1.mobailfarid3.ir
taptunnel.space taptunnel.space
tatataheri.ejustageram.ir tatataheri.ejustageram.ir
test.ccsyue.cn test.ccsyue.cn
test.ep3hnm.ir test.ep3hnm.ir
test3.erfanhub.ir test3.erfanhub.ir
testbpb.385119.xyz testbpb.385119.xyz
text.ye28.nyc.mn text.ye28.nyc.mn
bbb.xdwsh.com bbb.xdwsh.com
bbppbb.barbybar.ir bbppbb.barbybar.ir
bbr.810820830.xyz bbr.810820830.xyz
tunnel2.blfs.top tunnel2.blfs.top
bia.giordanobruno.ir bia.giordanobruno.ir
uniquephysio.ca uniquephysio.ca
user141.freeairlaines.com user141.freeairlaines.com
user1442.freeairlaines.com user1442.freeairlaines.com
vavan.ir vavan.ir
blog75.sourena33.sbs blog75.sourena33.sbs
vlesspbp.samvpn.xyz vlesspbp.samvpn.xyz
vpn.fasurus.life vpn.fasurus.life
bob.kenshi.nyc.mn bob.kenshi.nyc.mn
vpn.jiroutiao.com vpn.jiroutiao.com
vpnbpb.5lp.xyz vpnbpb.5lp.xyz
vpnn.luta.one vpnn.luta.one
bpb-aqil-panel.pars-android.com bpb-aqil-panel.pars-android.com
bpb-mdr.medicaldream.ir bpb-mdr.medicaldream.ir
bpb-mtr.medicaltreatment.ir bpb-mtr.medicaltreatment.ir
bpb-panel.cxtz-001.top bpb-panel.cxtz-001.top
bpb-panel.hiyamykh.pp.ua bpb-panel.hiyamykh.pp.ua
bpb-worker.itbearser.top bpb-worker.itbearser.top
bpb.052222.xyz bpb.052222.xyz
bpb.0618033.xyz bpb.0618033.xyz
bpb.065169.xyz bpb.065169.xyz
bpb.1009.top bpb.1009.top
bpb.111518.xyz bpb.111518.xyz
bpb.118558.xyz bpb.118558.xyz
bpb.11cm.com.cn bpb.11cm.com.cn
bpb.1288025.xyz bpb.1288025.xyz
bpb.137390740.xyz bpb.137390740.xyz
bpb.143314.xyz bpb.143314.xyz
bpb.1646.cc bpb.1646.cc
bpb.181918.xyz bpb.181918.xyz
bpb.19810324.xyz bpb.19810324.xyz
bpb.1981666.xyz bpb.1981666.xyz
bpb.1984.pp.ua bpb.1984.pp.ua
bpb.19990120.xyz bpb.19990120.xyz
bpb.2182569.xyz bpb.2182569.xyz
bpb.225514.xyz bpb.225514.xyz
bpb.3184583.best bpb.3184583.best
bpb.35573551.xyz bpb.35573551.xyz
bpb.3559670.xyz bpb.3559670.xyz
bpb.41857090.xyz bpb.41857090.xyz
bpb.51335133.xyz bpb.51335133.xyz
bpb.5206666.xyz bpb.5206666.xyz
bpb.5251314.xyz bpb.5251314.xyz
bpb.55519802.xyz bpb.55519802.xyz
bpb.690112.xyz bpb.690112.xyz
bpb.6968489.xyz bpb.6968489.xyz
bpb.740715.xyz bpb.740715.xyz
bpb.888028.xyz bpb.888028.xyz
bpb.8p.ink bpb.8p.ink
bpb.917520.xyz bpb.917520.xyz
bpb.92tc.net bpb.92tc.net
bpb.aa868.top bpb.aa868.top
bpb.abdavp.lol bpb.abdavp.lol
bpb.adtmanagement.com bpb.adtmanagement.com
bpb.aihowl.top bpb.aihowl.top
bpb.attack-on-titan.ir bpb.attack-on-titan.ir
bpb.baghdiq.nyc.mn bpb.baghdiq.nyc.mn
bpb.bamboodew.top bpb.bamboodew.top
bpb.bersinrose.ir bpb.bersinrose.ir
bpb.byteyam.com bpb.byteyam.com
bpb.ctscan.top bpb.ctscan.top
bpb.ddfhfgx888.top bpb.ddfhfgx888.top
bpb.dongbo88.xyz bpb.dongbo88.xyz
bpb.ele.pp.ua bpb.ele.pp.ua
bpb.elevenfamilies.link bpb.elevenfamilies.link
bpb.faceless.nyc.mn bpb.faceless.nyc.mn
bpb.falconerileather.site bpb.falconerileather.site
bpb.fthi.site bpb.fthi.site
bpb.goku.top bpb.goku.top
bpb.griphin.top bpb.griphin.top
bpb.happyboy.pp.ua bpb.happyboy.pp.ua
bpb.hellolsy.com bpb.hellolsy.com
bpb.hotik.asia bpb.hotik.asia
bpb.hzos.top bpb.hzos.top
bpb.iaai.love bpb.iaai.love
bpb.iwoyao123.top bpb.iwoyao123.top
bpb.juezhengjing.win bpb.juezhengjing.win
bpb.kkhome.top bpb.kkhome.top
bpb.klzhong.store bpb.klzhong.store
bpb.kmevps.ir bpb.kmevps.ir
bpb.kspn.top bpb.kspn.top
bpb.ktvlab.site bpb.ktvlab.site
bpb.lepidus.me bpb.lepidus.me
bpb.lesvtlss.sbs bpb.lesvtlss.sbs
bpb.liangzg.com bpb.liangzg.com
bpb.lingev2tst.top bpb.lingev2tst.top
bpb.lingjinglive.com bpb.lingjinglive.com
bpb.lingwudev.tech bpb.lingwudev.tech
bpb.luohao001.cn bpb.luohao001.cn
bpb.lvjinghuanjing.com bpb.lvjinghuanjing.com
bpb.miaoyang.win bpb.miaoyang.win
bpb.mmolive.com bpb.mmolive.com
bpb.mothan.tech bpb.mothan.tech
bpb.movenn.com bpb.movenn.com
bpb.mt9.ir bpb.mt9.ir
bpb.mutoworld.xyz bpb.mutoworld.xyz
bpb.myzxyzxy.top bpb.myzxyzxy.top
bpb.niu7.top bpb.niu7.top
bpb.noip.vip bpb.noip.vip
bpb.nptv.cn bpb.nptv.cn
bpb.ooya.site bpb.ooya.site
bpb.pag.9051246.xyz bpb.pag.9051246.xyz
bpb.pangx.buzz bpb.pangx.buzz
bpb.pt01524.win bpb.pt01524.win
bpb.putaotang.xyz bpb.putaotang.xyz
bpb.seafeng.cfd bpb.seafeng.cfd
bpb.shangool.ru bpb.shangool.ru
bpb.ssghdl888.xyz bpb.ssghdl888.xyz
bpb.sxpcloud.top bpb.sxpcloud.top
bpb.taronet.top bpb.taronet.top
bpb.teamos.net bpb.teamos.net
bpb.tgbg.pp.ua bpb.tgbg.pp.ua
bpb.vopc.cn bpb.vopc.cn
bpb.webvip.cc bpb.webvip.cc
bpb.whulhf.win bpb.whulhf.win
bpb.woohom.top bpb.woohom.top
bpb.wwszkt.top bpb.wwszkt.top
bpb.xencn.me bpb.xencn.me
bpb.xiaoaitongxue.love bpb.xiaoaitongxue.love
bpb.xir.cc bpb.xir.cc
bpb.xls.pp.ua bpb.xls.pp.ua
bpb.xxyy.asia bpb.xxyy.asia
bpb.yayajing.site bpb.yayajing.site
bpb.zhizhu.store bpb.zhizhu.store
bpb.zmdybh.com bpb.zmdybh.com
bpb0716.cnyohu.com bpb0716.cnyohu.com
bpb0716.zhongyoutc.com bpb0716.zhongyoutc.com
bpb10.niux.pp.ua bpb10.niux.pp.ua
bpb2-pages.cjmahdi.ir bpb2-pages.cjmahdi.ir
bpb2.20888802.xyz bpb2.20888802.xyz
bpb2.wits.ink bpb2.wits.ink
bpb23.3559670.xyz bpb23.3559670.xyz
bpb241last.ehsanzz.ir bpb241last.ehsanzz.ir
bpb243.arash-skating.ir bpb243.arash-skating.ir
bpb245.fwdf666668.top bpb245.fwdf666668.top
bpb26.hago.nyc.mn bpb26.hago.nyc.mn
bpb27-3.lileoxiu.nyc.mn bpb27-3.lileoxiu.nyc.mn
bpb3.lingela.sbs bpb3.lingela.sbs
bpb8.iaai.love bpb8.iaai.love
bpbnpvcpi.makingirangreatagain.com bpbnpvcpi.makingirangreatagain.com
bpbv2.ehsanskate.ir bpbv2.ehsanskate.ir
bpbvpn.2116088.xyz bpbvpn.2116088.xyz
bpbworker.6666656.xyz bpbworker.6666656.xyz
bpbworker.mohammadupl.com bpbworker.mohammadupl.com
bpbworker.pqbvm.com bpbworker.pqbvm.com
bpbwp.f2pool.com.cn bpbwp.f2pool.com.cn
bpbwpanel.jack132b01.nyc.mn bpbwpanel.jack132b01.nyc.mn
bpp.v0pc.com bpp.v0pc.com
wei.jackeyshone.link wei.jackeyshone.link
wooditforyou.shop wooditforyou.shop
worker-bpb.ifeng250.com worker-bpb.ifeng250.com
wqs.304307608.xyz wqs.304307608.xyz
xxxcnn.nyc.mn xxxcnn.nyc.mn
yakanet.online yakanet.online
yuyu.guaiguai999.org yuyu.guaiguai999.org
cdn888.wanpe.top cdn888.wanpe.top
zero.devm.ir zero.devm.ir
ceo2.mindroom3.ir ceo2.mindroom3.ir
zijian.539346345.xyz zijian.539346345.xyz
check.ddsj.site check.ddsj.site
cf.acg10086.xyz cf.acg10086.xyz
bp.474101149.xyz bp.474101149.xyz
bp.968999.xyz bp.968999.xyz
bp.991314520.xyz bp.991314520.xyz
bp.exceptionalcustomerrelationshipmanagement.site bp.exceptionalcustomerrelationshipmanagement.site
dl.mirror.01110011.ir dl.mirror.01110011.ir
dl.mirror.itsfine.ir dl.mirror.itsfine.ir
dl.nkjdbf3wiwofbeio23e23hde2sdcsonc92jdsskz1kinjd22dxwx2is2naxsxjx.online dl.nkjdbf3wiwofbeio23e23hde2sdcsonc92jdsskz1kinjd22dxwx2is2naxsxjx.online
gg.968333.xyz gg.968333.xyz
lh.ylks.xyz lh.ylks.xyz
ma.520xixi.top ma.520xixi.top
no.shadowkala.ir no.shadowkala.ir
nl.ebg.ir nl.ebg.ir
sa.aliff.ir sa.aliff.ir
ss.1ping.wang ss.1ping.wang
tw.hunas.cc tw.hunas.cc
ty.hope8964.nyc.mn ty.hope8964.nyc.mn
vv.ylks.xyz vv.ylks.xyz
b.3j7.net b.3j7.net
b.860529.xyz b.860529.xyz
f.vnm.cloudns.asia f.vnm.cloudns.asia
g.deep-black.ir g.deep-black.ir
m.m0sen.ir m.m0sen.ir
m.smlie.pp.ua m.smlie.pp.ua
x.asrnoor.ir x.asrnoor.ir
x.fang.pp.ua x.fang.pp.ua
cloud.ccapvcd.buzz cloud.ccapvcd.buzz
cloudcloudcloudcloudcloud.vicloud.ir cloudcloudcloudcloudcloud.vicloud.ir
cold.mytopmov.ir cold.mytopmov.ir
cybmik-1.glxderver5.info cybmik-1.glxderver5.info
darabmehrshad.mobailfarid3.ir darabmehrshad.mobailfarid3.ir
dawang.site dawang.site
dena1403.online dena1403.online
dowloaduploadtestspeedspeedtest.kejbahs.ir dowloaduploadtestspeedspeedtest.kejbahs.ir
ehsan.dsoheilb1.ir ehsan.dsoheilb1.ir
ezdemo.top ezdemo.top
fileforum.com fileforum.com
fojii.co.uk fojii.co.uk
fpco.ahmadamm.ir fpco.ahmadamm.ir
free.jsilver.loseyourip.com free.jsilver.loseyourip.com
fun.irangr8.info fun.irangr8.info
gamatex.site gamatex.site
gcore.armanm.ir gcore.armanm.ir
gdwubin.link gdwubin.link
gfw.aaok.vip gfw.aaok.vip
gitbpb.8168888.xyz gitbpb.8168888.xyz
gobpb.shop gobpb.shop
kazusama.sbs kazusama.sbs
hello.yxuu.cn hello.yxuu.cn
hih.313552.xyz hih.313552.xyz
hiox.top hiox.top
hirmandi.mtbrand.ir hirmandi.mtbrand.ir
infobpb.pm67.ir infobpb.pm67.ir
internetspeedtest.speedytest.cfd internetspeedtest.speedytest.cfd
izg-vpn.weydev.top izg-vpn.weydev.top
mohamadahmadi.abedism.ir mohamadahmadi.abedism.ir
joney.ac.cn joney.ac.cn
karshenashamrah.ir karshenashamrah.ir
kave.dsoheilb.ir kave.dsoheilb.ir
mohsen.dsoheilb.ir mohsen.dsoheilb.ir
kitkat.bachebiapain.ir kitkat.bachebiapain.ir
konideraz.abedism.ir konideraz.abedism.ir
leaf.slambenchmarking.xyz leaf.slambenchmarking.xyz
linxblinsx.testlless.uk linxblinsx.testlless.uk
liveuk.khamoosh.site liveuk.khamoosh.site
lixiansheng.liyingpeng.sbs lixiansheng.liyingpeng.sbs
mahsa3.bachebiapain.ir mahsa3.bachebiapain.ir
mainpagepbp.safavidempire.org mainpagepbp.safavidempire.org
majid.dsoheilb.ir majid.dsoheilb.ir
meow.mios3c.com meow.mios3c.com
mom475.getconf.zabanamooz.tech mom475.getconf.zabanamooz.tech
msi.miladsali74.ir msi.miladsali74.ir
mtkarimi.online mtkarimi.online
mybpbwork.kingbuy.top mybpbwork.kingbuy.top
mypanel.fastwebsite.design mypanel.fastwebsite.design
navid2.metroplus1.ir navid2.metroplus1.ir
navid3-bpb.caspiancoldrolled.ir navid3-bpb.caspiancoldrolled.ir
newtop1.gdpvless.top newtop1.gdpvless.top
oblivion.forir.ir oblivion.forir.ir
onlineshop.lilyatr.ir onlineshop.lilyatr.ir
openio.cfd openio.cfd
page.memarinama.com page.memarinama.com
page.spysoos.link page.spysoos.link
page2.svpae.asia page2.svpae.asia
page4.algholami.ir page4.algholami.ir
pages.kalinvan.ir pages.kalinvan.ir
pages.l95.ir pages.l95.ir
pages.vitfrank.link pages.vitfrank.link
panel.fandogh2.ir panel.fandogh2.ir
panel.ooog.top panel.ooog.top
panel2.858303300.xyz panel2.858303300.xyz
panel245.dj18.top panel245.dj18.top
panelalihasanisingaporemnuffefjjbvfedchjjhgfvjibvdw.fergaltnt.ir panelalihasanisingaporemnuffefjjbvfedchjjhgfvjibvdw.fergaltnt.ir
panelitalypanel2024kppihdcjvvdezyhvigxsgbjfdx.fergaltnt.ir panelitalypanel2024kppihdcjvvdezyhvigxsgbjfdx.fergaltnt.ir
panelswed.fergaltnt.ir panelswed.fergaltnt.ir
panelusa2hxbwjxbsjzbsbwjshbfeynwjdjs.fergaltnt.ir panelusa2hxbwjxbsjzbsbwjshbfeynwjdjs.fergaltnt.ir
panelusaazimibfhdegjgd20mordadgdcfv.fergaltnt.ir panelusaazimibfhdegjgd20mordadgdcfv.fergaltnt.ir
pbp.cloudflare.sefell.com pbp.cloudflare.sefell.com
polymerization.wdsnet.cn polymerization.wdsnet.cn
port.sabajn.ir port.sabajn.ir
portal3.8189818.xyz portal3.8189818.xyz
pvg.aghabeiki.homes pvg.aghabeiki.homes
pyf.proxyrouter.top pyf.proxyrouter.top
ranjbaran.dsoheilb.ir ranjbaran.dsoheilb.ir
gcore.ehsanzz.ir gcore.ehsanzz.ir
rezarahimi.dsoheilb1.ir rezarahimi.dsoheilb1.ir
arsalan.dsoheilb.ir arsalan.dsoheilb.ir
aboutbpbcourse.maintaincourse.ir aboutbpbcourse.maintaincourse.ir
dc.brigand.asia dc.brigand.asia
sajadmahmoodi.mobailfarid3.ir sajadmahmoodi.mobailfarid3.ir
sanjesh.samenrazavii.ir sanjesh.samenrazavii.ir
sbwgh.250414.xyz sbwgh.250414.xyz
sdafsadfdsfsdert5rgsfsdffgrr43r3ewwftrt4y5yhtrgfsdf4t54.tech sdafsadfdsfsdert5rgsfsdffgrr43r3ewwftrt4y5yhtrgfsdf4t54.tech
agyg.jhfgg.ebrahimakhgarian.ir agyg.jhfgg.ebrahimakhgarian.ir
see.ashkanhidi.ir see.ashkanhidi.ir
shamimem.shamim6870.ir shamimem.shamim6870.ir
shop.lilyatr.ir shop.lilyatr.ir
side.tabnack.ir side.tabnack.ir
singbox.candyfree.top singbox.candyfree.top
singbox.lyv3518.top singbox.lyv3518.top
singbox.qmx.life singbox.qmx.life
singbox.zsp.pp.ua singbox.zsp.pp.ua
amirarsalan.mobailfarid2.ir amirarsalan.mobailfarid2.ir
askmen.com askmen.com
sohrabmahmoodi.mobailfarid2.ir sohrabmahmoodi.mobailfarid2.ir
soilmecir.com soilmecir.com
socks.8p.ink socks.8p.ink
anbu.nightime.top anbu.nightime.top
app-view.mahi30.ir app-view.mahi30.ir
api5.tech-offline.ir api5.tech-offline.ir
sub.douyu.pp.ua sub.douyu.pp.ua
aaa.fysm.xyz aaa.fysm.xyz
sun.yyds168.top sun.yyds168.top
aqhanavid.mobailfarid3.ir aqhanavid.mobailfarid3.ir
tehroon.fr tehroon.fr
aurora.bachebiapain.ir aurora.bachebiapain.ir
testele.uk testele.uk
babyboss.cfd babyboss.cfd
tomcatio.top tomcatio.top
bbb.winbeta.net bbb.winbeta.net
beaboss.fr beaboss.fr
twisted-royal.nscl.ir twisted-royal.nscl.ir
beta.yhealths.com beta.yhealths.com
black5un.ir black5un.ir
vless.mlihong.site vless.mlihong.site
vless888.shan-jx.uk vless888.shan-jx.uk
vlez.salzy.my.id vlez.salzy.my.id
vpn.112583.xyz vpn.112583.xyz
vpn.chunkiu.uk vpn.chunkiu.uk
vpn.drxiong.top vpn.drxiong.top
vpn.leertai.top vpn.leertai.top
vpn.maww.cn vpn.maww.cn
bnb.chinasvip.buzz bnb.chinasvip.buzz
wbz.wbzhyh.pp.ua wbz.wbzhyh.pp.ua
bpb-1.kangjiegon.pp.ua bpb-1.kangjiegon.pp.ua
bpb-page.bjzkar.ren bpb-page.bjzkar.ren
bpb-pages.jabisoft.ir bpb-pages.jabisoft.ir
bpb-panel.115411.xyz bpb-panel.115411.xyz
bpb-worker-panel.w-l-w.top bpb-worker-panel.w-l-w.top
bpb.0.brucelee1973.ir bpb.0.brucelee1973.ir
bpb.010234.xyz bpb.010234.xyz
bpb.012321.xyz bpb.012321.xyz
bpb.0579.plus bpb.0579.plus
bpb.121409.xyz bpb.121409.xyz
bpb.129805.xyz bpb.129805.xyz
bpb.1314666.xyz bpb.1314666.xyz
bpb.175625738.xyz bpb.175625738.xyz
bpb.19770506.xyz bpb.19770506.xyz
bpb.197903.pp.ua bpb.197903.pp.ua
bpb.19900130.xyz bpb.19900130.xyz
bpb.19961110.xyz bpb.19961110.xyz
bpb.202320.xyz bpb.202320.xyz
bpb.210217.xyz bpb.210217.xyz
bpb.246888.xyz bpb.246888.xyz
bpb.2900900.xyz bpb.2900900.xyz
bpb.3344666.xyz bpb.3344666.xyz
bpb.340913.xyz bpb.340913.xyz
bpb.349471930.xyz bpb.349471930.xyz
bpb.360122.xyz bpb.360122.xyz
bpb.445vgh.buzz bpb.445vgh.buzz
bpb.4d7.ir bpb.4d7.ir
bpb.519530.xyz bpb.519530.xyz
bpb.704072456.xyz bpb.704072456.xyz
bpb.880824.xyz bpb.880824.xyz
bpb.880996.xyz bpb.880996.xyz
bpb.891462.xyz bpb.891462.xyz
bpb.919000.xyz bpb.919000.xyz
bpb.9701853.xyz bpb.9701853.xyz
bpb.9954869.xyz bpb.9954869.xyz
bpb.9999.ooo bpb.9999.ooo
bpb.adeanna.sbs bpb.adeanna.sbs
bpb.aiol.love bpb.aiol.love
bpb.amy999.top bpb.amy999.top
bpb.ankstam.sbs bpb.ankstam.sbs
bpb.asemanbot.ir bpb.asemanbot.ir
bpb.bestrivenna.pp.ua bpb.bestrivenna.pp.ua
bpb.boycejudith.xyz bpb.boycejudith.xyz
bpb.btc211.com bpb.btc211.com
bpb.chatgptvpn.top bpb.chatgptvpn.top
bpb.chengyishi.online bpb.chengyishi.online
bpb.cliechen.nyc.mn bpb.cliechen.nyc.mn
bpb.cliechen.pp.ua bpb.cliechen.pp.ua
bpb.collectpetal.pp.ua bpb.collectpetal.pp.ua
bpb.czyt.tech bpb.czyt.tech
bpb.d4.cc bpb.d4.cc
bpb.deqsbgd.asia bpb.deqsbgd.asia
bpb.diyi.pp.ua bpb.diyi.pp.ua
bpb.dos7.xyz bpb.dos7.xyz
bpb.dralong.com bpb.dralong.com
bpb.extls.pp.ua bpb.extls.pp.ua
bpb.ezable.cn bpb.ezable.cn
bpb.frankin.top bpb.frankin.top
bpb.garychen.pp.ua bpb.garychen.pp.ua
bpb.goudan001.xyz bpb.goudan001.xyz
bpb.grassroots-project.app bpb.grassroots-project.app
bpb.hadaf.cloud bpb.hadaf.cloud
bpb.hai12app.top bpb.hai12app.top
bpb.hallo.loan bpb.hallo.loan
bpb.hlab.cc bpb.hlab.cc
bpb.hsphome.xyz bpb.hsphome.xyz
bpb.hx208.top bpb.hx208.top
bpb.isas.io bpb.isas.io
bpb.isoho168.top bpb.isoho168.top
bpb.jacory.cn bpb.jacory.cn
bpb.jimmie-yang.top bpb.jimmie-yang.top
bpb.jqka2222.lol bpb.jqka2222.lol
bpb.k151.com bpb.k151.com
bpb.kaishek.uk bpb.kaishek.uk
bpb.kaizenclub.top bpb.kaizenclub.top
bpb.keale.nyc.mn bpb.keale.nyc.mn
bpb.kedaye.site bpb.kedaye.site
bpb.liushilin.men bpb.liushilin.men
bpb.luyaohua.xyz bpb.luyaohua.xyz
bpb.lzandhyy.top bpb.lzandhyy.top
bpb.mazxyzxy.top bpb.mazxyzxy.top
bpb.mickey3721.xyz bpb.mickey3721.xyz
bpb.mmw1984.com bpb.mmw1984.com
bpb.mokasi1.cn bpb.mokasi1.cn
bpb.mxzhang.com bpb.mxzhang.com
bpb.n1c3.me bpb.n1c3.me
bpb.nastop.pp.ua bpb.nastop.pp.ua
bpb.njypp.com bpb.njypp.com
bpb.no-free.uk bpb.no-free.uk
bpb.orcm2.xyz bpb.orcm2.xyz
bpb.pl10000.org bpb.pl10000.org
bpb.qiuzhuowei.top bpb.qiuzhuowei.top
bpb.qj520.top bpb.qj520.top
bpb.qwq.pp.ua bpb.qwq.pp.ua
bpb.roudika.ir bpb.roudika.ir
bpb.sayousay.me bpb.sayousay.me
bpb.sdchsd.cn bpb.sdchsd.cn
bpb.sqrxz.top bpb.sqrxz.top
bpb.sunmengjie.top bpb.sunmengjie.top
bpb.tami.pp.ua bpb.tami.pp.ua
bpb.unixstudy.lol bpb.unixstudy.lol
bpb.vincval.uk bpb.vincval.uk
bpb.wanmin.me bpb.wanmin.me
bpb.wenjianken.link bpb.wenjianken.link
bpb.wobe.top bpb.wobe.top
bpb.wxrbbs.top bpb.wxrbbs.top
bpb.xiakayi.com bpb.xiakayi.com
bpb.xish.pp.ua bpb.xish.pp.ua
bpb.yanzhe.top bpb.yanzhe.top
bpb.yukinoshita.link bpb.yukinoshita.link
bpb.yyyj.me bpb.yyyj.me
bpb.zcmfa.xyz bpb.zcmfa.xyz
bpb.zinmyo.top bpb.zinmyo.top
bpb.zjls515.pub bpb.zjls515.pub
bpb1.168168568.xyz bpb1.168168568.xyz
bpb1.kevinbai.top bpb1.kevinbai.top
bpb123.8211321.xyz bpb123.8211321.xyz
bpb2.lowa.nyc.mn bpb2.lowa.nyc.mn
bpb264.lileoxiu.nyc.mn bpb264.lileoxiu.nyc.mn
bpb3.aced.nyc.mn bpb3.aced.nyc.mn
bpb6.iaai.love bpb6.iaai.love
bpbcf.jiajuser.com bpbcf.jiajuser.com
bpbgit.iaai.love bpbgit.iaai.love
bpbhk.feiyuan.org bpbhk.feiyuan.org
bpbjadid.mohsekarim2.ir bpbjadid.mohsekarim2.ir
bpbpanel.sccx.ltd bpbpanel.sccx.ltd
bpbptop.topnop.top bpbptop.topnop.top
bpbspcute.spidercuteelite.ir bpbspcute.spidercuteelite.ir
bpbus.feiyuan.org bpbus.feiyuan.org
bpbv233.ehsanranjer.ir bpbv233.ehsanranjer.ir
bpbwk.bihu.co bpbwk.bihu.co
wiki.mehrabzhp.ir wiki.mehrabzhp.ir
work5.33229981.xyz work5.33229981.xyz
worldbak.steamplayer.bf worldbak.steamplayer.bf
xuylin.xyz xuylin.xyz
yeganbeyegan.bachebiapain.ir yeganbeyegan.bachebiapain.ir
yueyue.lat yueyue.lat
zijian3.sdjfkkdjfsd64df5dfsdfgf.sbs zijian3.sdjfkkdjfsd64df5dfsdfgf.sbs
zou888666.nyc.mn zou888666.nyc.mn
cc.peeass.asia cc.peeass.asia
bb.096000.xyz bb.096000.xyz
bp.010798.xyz bp.010798.xyz
bp.qcy.pp.ua bp.qcy.pp.ua
bw.devclouds.ir bw.devclouds.ir
cf.icm.pp.ua cf.icm.pp.ua
cf.proxy.farelra.my.id cf.proxy.farelra.my.id
de.ebg.ir de.ebg.ir
et.satzo.ir et.satzo.ir
fg.amirimani047.ir fg.amirimani047.ir
kj.xiaojing.nyc.mn kj.xiaojing.nyc.mn
pb.258741.xyz pb.258741.xyz
sl.mah-group.ir sl.mah-group.ir
sm.mahmood.sadegh67.ir sm.mahmood.sadegh67.ir
st.mogami.cc st.mogami.cc
st.sjavadgh.ir st.sjavadgh.ir
us.ebg.ir us.ebg.ir
vl.zhonghaoyuan.cn vl.zhonghaoyuan.cn
tz.861314.xyz tz.861314.xyz
a.applle3.ir a.applle3.ir
b.hina.ninja b.hina.ninja
b.pouriyaa.ir b.pouriyaa.ir
k.goodmoring235.cn k.goodmoring235.cn
p.hhy.ink p.hhy.ink
s.funxbox.xyz s.funxbox.xyz
s.szyi.site s.szyi.site
w.hikingpacking.com w.hikingpacking.com
x.babyboss.cfd x.babyboss.cfd
y.159987.xyz y.159987.xyz
cloudf.ccipaptv.buzz cloudf.ccipaptv.buzz
davoood.dsoheilb.ir davoood.dsoheilb.ir
deadpool.premiummm.cloud-ip.biz deadpool.premiummm.cloud-ip.biz
desmotaheri.ejustageram.ir desmotaheri.ejustageram.ir
dev4.gheibipour.ir dev4.gheibipour.ir
dingyue.55042731.xyz dingyue.55042731.xyz
diy.cekay.cn diy.cekay.cn
dns.directed.ir dns.directed.ir
dongwenbao.pp.ua dongwenbao.pp.ua
dyp.818626.xyz dyp.818626.xyz
edge.crossback.de edge.crossback.de
energyphysioclinic.com energyphysioclinic.com
ether-cannon-embellish-prewashed.anymath.ir ether-cannon-embellish-prewashed.anymath.ir
fast-2.medicaldream.ir fast-2.medicaldream.ir
fedgetunnel6.alborzpatrik.online fedgetunnel6.alborzpatrik.online
flash.mianmianku.com flash.mianmianku.com
freefq.ro.to freefq.ro.to
fuxiaoxin.sbs fuxiaoxin.sbs
galar2galar2galar2.40cheraagh.ir galar2galar2galar2.40cheraagh.ir
galaxy811.xyz galaxy811.xyz
geihgerig.donyayeemrooz.ir geihgerig.donyayeemrooz.ir
global.sudatech.store global.sudatech.store
gnctrhc.xyz gnctrhc.xyz
halo.mrcowhides.ir halo.mrcowhides.ir
hamedazizi.art.hamed-azizi.com hamedazizi.art.hamed-azizi.com
harry.downloadbazha.ir harry.downloadbazha.ir
hello-world-lively-dust-bb7d.mehr1dad.ir hello-world-lively-dust-bb7d.mehr1dad.ir
hessel.tarhe.click hessel.tarhe.click
holypalbpb.holypal.top holypalbpb.holypal.top
holypalworkbpb.holypal.top holypalworkbpb.holypal.top
hongkongdomins.fergaltnt.ir hongkongdomins.fergaltnt.ir
hossein.optimizeseo.site hossein.optimizeseo.site
iclarified.com iclarified.com
infinisky.skyman.cloud infinisky.skyman.cloud
iran.clickeyourip.cloudns.nz iran.clickeyourip.cloudns.nz
irankojeafoqjfoqfjqoofjqghjqjqqjgkqjggjqfjqofjqiwehghikhssssswo.armanm.ir irankojeafoqjfoqfjqoofjqghjqjqqjgkqjggjqfjqofjqiwehghikhssssswo.armanm.ir
jafari1sl.dsoheilb1.ir jafari1sl.dsoheilb1.ir
jerryworld.xyz jerryworld.xyz
koreapanelvippopp.applle3.ir koreapanelvippopp.applle3.ir
linziblog.org linziblog.org
live.khamoosh.site live.khamoosh.site
lonei.com lonei.com
luyuan.pp.ua luyuan.pp.ua
maddress.site maddress.site
magic.sardabirnews.com magic.sardabirnews.com
mahbouobemazan.sarisam.ir mahbouobemazan.sarisam.ir
manager.erfanhub.ir manager.erfanhub.ir
matin.abedism.ir matin.abedism.ir
meiguo.ipz.pp.ua meiguo.ipz.pp.ua
meri.nscl.ir meri.nscl.ir
mht.mhtadayon.ir mht.mhtadayon.ir
mianban.918518.xyz mianban.918518.xyz
milile.bilbilaki.ir milile.bilbilaki.ir
mlmfe.yxhx1043.ir mlmfe.yxhx1043.ir
mobile.goshime.com mobile.goshime.com
mohsennaderi.mobailfarid2.ir mohsennaderi.mobailfarid2.ir
mojtabarahimi.abedism.ir mojtabarahimi.abedism.ir
monadi.downloadbazha.ir monadi.downloadbazha.ir
monameysabume.ejusta.ir monameysabume.ejusta.ir
mortal.1.kombat.pack.mkjh.ir mortal.1.kombat.pack.mkjh.ir
morteza.m2rayng-pro.cloudns.nz morteza.m2rayng-pro.cloudns.nz
najaf.downloadbazz.ir najaf.downloadbazz.ir
navid-bpb.caspiancoldrolled.ir navid-bpb.caspiancoldrolled.ir
nbpb.odie.xyz nbpb.odie.xyz
netherland.armanm.ir netherland.armanm.ir
october.mraniki.top october.mraniki.top
page.badboy.cc page.badboy.cc
page.tanzunsx.ir page.tanzunsx.ir
page3.algholami.ir page3.algholami.ir
page5.algholami.ir page5.algholami.ir
pages.dgtaler.ir pages.dgtaler.ir
pages.linux-title.ir pages.linux-title.ir
pan.136119.xyz pan.136119.xyz
panel.1989064.xyz panel.1989064.xyz
panel.aminge.xyz panel.aminge.xyz
panel.diginaakoo.ir panel.diginaakoo.ir
panel.gamewelldone.com panel.gamewelldone.com
panel.godky.cn panel.godky.cn
panel.lovemm.3d.tc panel.lovemm.3d.tc
panel.lovemm.app.tc panel.lovemm.app.tc
panel.niucoucou.top panel.niucoucou.top
panel1.happyrobotics.com panel1.happyrobotics.com
panelemiratevipirancenteral2.fergaltnt.ir panelemiratevipirancenteral2.fergaltnt.ir
panelgermany.fergaltnt.ir panelgermany.fergaltnt.ir
panelgermanypanelgermany.fergaltnt.ir panelgermanypanelgermany.fergaltnt.ir
panelhongkonghongkongmn.fergaltnt.ir panelhongkonghongkongmn.fergaltnt.ir
panelturkiye.fergaltnt.ir panelturkiye.fergaltnt.ir
parspack.com.mangasell.ir parspack.com.mangasell.ir
pbp.5866117.xyz pbp.5866117.xyz
pbp.65205118.xyz pbp.65205118.xyz
pbp.longtzst.eu pbp.longtzst.eu
pcpc.abedism.ir pcpc.abedism.ir
peipei.guaiguai999.org peipei.guaiguai999.org
pesaranam.abedism.ir pesaranam.abedism.ir
pfr6.mamatune.top pfr6.mamatune.top
podcast.sony5plus.ir podcast.sony5plus.ir
pol.hiworld.ir pol.hiworld.ir
poori.kiyarash6.lol poori.kiyarash6.lol
ppp.c5e2c2ff58894c639bd26dcfcdc4bf86.cloud ppp.c5e2c2ff58894c639bd26dcfcdc4bf86.cloud
proxy.xeryx.top proxy.xeryx.top
rayapi.fengrui.link rayapi.fengrui.link
rccrhost.com rccrhost.com
BPB.MORTEZASHAMLOO.IR
IP History

Click the IP addresses to see over domains using them.