Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

DENTALIMPLANTSDAYTONOH.COM

DENTALIMPLANTSDAYTONOH.COM
Shared Attributes
Domain
minidentalimplantsclintontownshipmi.com minidentalimplantsclintontownshipmi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Mar 2020 6 years, 156 days
minidentalimplantsellicottcitymd.com minidentalimplantsellicottcitymd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Nov 2018 5 years, 40 days
minidentalimplantsindianapolisin.com minidentalimplantsindianapolisin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Apr 2018 4 years, 193 days
minidentalimplantslakecityfl.com minidentalimplantslakecityfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Nov 2018 5 years, 40 days
minidentalimplantsmckeesportpa.com minidentalimplantsmckeesportpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantsnaplesfl.com minidentalimplantsnaplesfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Nov 2018 5 years, 40 days
minidentalimplantsranchomirageca.com minidentalimplantsranchomirageca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Oct 2017 3 years, 358 days
minidentalimplantsverobeachfl.com minidentalimplantsverobeachfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
dentalimplantsdesmoines.com dentalimplantsdesmoines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Jun 2018 4 years, 248 days
dentalimplantsdetroitmi.com dentalimplantsdetroitmi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Oct 2018 5 years, 15 days
dentalimplantseriepa.com dentalimplantseriepa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 332 days
dentalimplantseurekamo.com dentalimplantseurekamo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 332 days
dentalimplantsfolsomca.com dentalimplantsfolsomca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 332 days
dentalimplantsgrandrapidsmi.com dentalimplantsgrandrapidsmi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Dec 2016 3 years, 59 days
dentalimplantshagerstownmd.com dentalimplantshagerstownmd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Mar 2020 6 years, 156 days
dentalimplantsspringborooh.com dentalimplantsspringborooh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Jun 2018 Jun 2018 One Off
dentalimplantstroymo.com dentalimplantstroymo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Mar 2020 6 years, 156 days
minidentalimplantsallentownpa.com minidentalimplantsallentownpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantsburtonmi.com minidentalimplantsburtonmi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantschicago.com minidentalimplantschicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantsconovernc.com minidentalimplantsconovernc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantsjacksonvillefl.com minidentalimplantsjacksonvillefl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Mar 2020 6 years, 156 days
minidentalimplantsplanotx.com minidentalimplantsplanotx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Oct 2017 3 years, 358 days
minidentalimplantstampafl.com minidentalimplantstampafl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Mar 2020 6 years, 156 days
dentalimplantsdaytonabeachfl.com dentalimplantsdaytonabeachfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Oct 2018 5 years, 15 days
dentalimplantsedmondok.com dentalimplantsedmondok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Jun 2018 4 years, 248 days
dentalimplantshackensacknj.com dentalimplantshackensacknj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Oct 2018 5 years, 15 days
dentalimplantsmountpleasantsc.com dentalimplantsmountpleasantsc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Mar 2016 Mar 2020 3 years, 361 days
dentalimplantsdecaturmi.com dentalimplantsdecaturmi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Mar 2020 6 years, 156 days
dentalimplantsdeforestwi.com dentalimplantsdeforestwi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Apr 2018 4 years, 193 days
dentalimplantsduxburyma.com dentalimplantsduxburyma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Apr 2018 4 years, 193 days
dentalimplantsgahannaoh.com dentalimplantsgahannaoh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Oct 2018 5 years, 15 days
minidentalimplantsbatonrougela.com minidentalimplantsbatonrougela.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantsglencarbonil.com minidentalimplantsglencarbonil.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantshoustontx.com minidentalimplantshoustontx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Nov 2018 5 years, 40 days
minidentalimplantslasvegasnv.com minidentalimplantslasvegasnv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Jul 2019 5 years, 262 days
minidentalimplantsorangeparkfl.com minidentalimplantsorangeparkfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 May 2019 5 years, 215 days
minidentalimplantswhitehallpa.com minidentalimplantswhitehallpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
cosmeticdentistryjacksonms.com cosmeticdentistryjacksonms.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Jun 2016 Oct 2017 1 year, 114 days
dentalimplantsconovernc.com dentalimplantsconovernc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Mar 2016 Mar 2018 1 year, 353 days
dentalimplantsdurhamnc.com dentalimplantsdurhamnc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 332 days
dentalimplantsellicottcitymd.com dentalimplantsellicottcitymd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Apr 2017 Sep 2018 1 year, 154 days
dentalimplantslexingtonky.com dentalimplantslexingtonky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 324 days
minidentalimplantsbirminghammi.com minidentalimplantsbirminghammi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantscharlestonsc.com minidentalimplantscharlestonsc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Mar 2016 Mar 2020 3 years, 361 days
minidentalimplantscrotononhudsonny.com minidentalimplantscrotononhudsonny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantsdunnnc.com minidentalimplantsdunnnc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantskalamazoomi.com minidentalimplantskalamazoomi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
minidentalimplantsmanchesternh.com minidentalimplantsmanchesternh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Nov 2018 5 years, 40 days
minidentalimplantsphoenixaz.com minidentalimplantsphoenixaz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Nov 2018 5 years, 40 days
minidentalimplantssalisburymd.com minidentalimplantssalisburymd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Nov 2018 5 years, 40 days
minidentalimplantsstauntonva.com minidentalimplantsstauntonva.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-38877920 Oct 2013 Sep 2018 4 years, 345 days
DENTALIMPLANTSDAYTONOH.COM
Non IP Attributes
Attribute First Last
UA UA-38877920 Oct 2013 Mar 2020
DENTALIMPLANTSDAYTONOH.COM
Overlap Attribute Domains
minidentalimplantsclintontownshipmi.com minidentalimplantsclintontownshipmi.com
minidentalimplantsellicottcitymd.com minidentalimplantsellicottcitymd.com
minidentalimplantsindianapolisin.com minidentalimplantsindianapolisin.com
minidentalimplantslakecityfl.com minidentalimplantslakecityfl.com
minidentalimplantsmckeesportpa.com minidentalimplantsmckeesportpa.com
minidentalimplantsnaplesfl.com minidentalimplantsnaplesfl.com
minidentalimplantsranchomirageca.com minidentalimplantsranchomirageca.com
minidentalimplantsverobeachfl.com minidentalimplantsverobeachfl.com
dentalimplantsdesmoines.com dentalimplantsdesmoines.com
dentalimplantsdetroitmi.com dentalimplantsdetroitmi.com
dentalimplantseriepa.com dentalimplantseriepa.com
dentalimplantseurekamo.com dentalimplantseurekamo.com
dentalimplantsfolsomca.com dentalimplantsfolsomca.com
dentalimplantsgrandrapidsmi.com dentalimplantsgrandrapidsmi.com
dentalimplantshagerstownmd.com dentalimplantshagerstownmd.com
dentalimplantsspringborooh.com dentalimplantsspringborooh.com
dentalimplantstroymo.com dentalimplantstroymo.com
minidentalimplantsallentownpa.com minidentalimplantsallentownpa.com
minidentalimplantsburtonmi.com minidentalimplantsburtonmi.com
minidentalimplantschicago.com minidentalimplantschicago.com
minidentalimplantsconovernc.com minidentalimplantsconovernc.com
minidentalimplantsjacksonvillefl.com minidentalimplantsjacksonvillefl.com
minidentalimplantsplanotx.com minidentalimplantsplanotx.com
minidentalimplantstampafl.com minidentalimplantstampafl.com
dentalimplantsdaytonabeachfl.com dentalimplantsdaytonabeachfl.com
dentalimplantsedmondok.com dentalimplantsedmondok.com
dentalimplantshackensacknj.com dentalimplantshackensacknj.com
dentalimplantsmountpleasantsc.com dentalimplantsmountpleasantsc.com
dentalimplantsdaytonoh.com dentalimplantsdaytonoh.com
dentalimplantsdecaturmi.com dentalimplantsdecaturmi.com
dentalimplantsdeforestwi.com dentalimplantsdeforestwi.com
dentalimplantsduxburyma.com dentalimplantsduxburyma.com
dentalimplantsgahannaoh.com dentalimplantsgahannaoh.com
minidentalimplantsbatonrougela.com minidentalimplantsbatonrougela.com
minidentalimplantsglencarbonil.com minidentalimplantsglencarbonil.com
minidentalimplantshoustontx.com minidentalimplantshoustontx.com
minidentalimplantslasvegasnv.com minidentalimplantslasvegasnv.com
minidentalimplantsorangeparkfl.com minidentalimplantsorangeparkfl.com
minidentalimplantswhitehallpa.com minidentalimplantswhitehallpa.com
cosmeticdentistryjacksonms.com cosmeticdentistryjacksonms.com
dentalimplantsconovernc.com dentalimplantsconovernc.com
dentalimplantsdurhamnc.com dentalimplantsdurhamnc.com
dentalimplantsellicottcitymd.com dentalimplantsellicottcitymd.com
dentalimplantslexingtonky.com dentalimplantslexingtonky.com
minidentalimplantsbirminghammi.com minidentalimplantsbirminghammi.com
minidentalimplantscharlestonsc.com minidentalimplantscharlestonsc.com
minidentalimplantscrotononhudsonny.com minidentalimplantscrotononhudsonny.com
minidentalimplantsdunnnc.com minidentalimplantsdunnnc.com
minidentalimplantskalamazoomi.com minidentalimplantskalamazoomi.com
minidentalimplantsmanchesternh.com minidentalimplantsmanchesternh.com
minidentalimplantsphoenixaz.com minidentalimplantsphoenixaz.com
minidentalimplantssalisburymd.com minidentalimplantssalisburymd.com
minidentalimplantsstauntonva.com minidentalimplantsstauntonva.com
DENTALIMPLANTSDAYTONOH.COM
IP History

Click the IP addresses to see over domains using them.