Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

FLIPFLOPPROFITS.COM

FLIPFLOPPROFITS.COM
Shared Attributes
Domain
pinbank.net pinbank.net
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Aug 2024 1 year, 274 days
GTM GTM-AW-439749027 Dec 2022 Aug 2024 1 year, 233 days
GTM GTM-AW-313468456 May 2024 May 2024 16 days
GTM GTM-AW-308753853 Nov 2022 Nov 2022 One Off
GTM GTM-AW-306712238 Feb 2023 Feb 2023 One Off
getprobuildz.com getprobuildz.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
GTM GTM-AW-439749027 Dec 2022 Sep 2024 1 year, 264 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
GTM GTM-AW-308753853 Nov 2022 Nov 2022 One Off
GTM GTM-AW-306712238 Feb 2023 Feb 2023 One Off
tubematic.net tubematic.net
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
GTM GTM-AW-439749027 Dec 2022 Sep 2024 1 year, 264 days
GTM GTM-AW-313468456 May 2024 May 2024 20 days
GTM GTM-AW-308753853 Nov 2022 Nov 2022 One Off
GTM GTM-AW-306712238 Feb 2023 Feb 2023 One Off
spectra-app.com spectra-app.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
GTM GTM-AW-439749027 Dec 2022 Sep 2024 1 year, 264 days
GTM GTM-AW-10792224287 Sep 2023 Mar 2024 167 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
gptok.ai gptok.ai
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Sep 2024 1 year, 173 days
GTM GTM-AW-439749027 Mar 2023 Sep 2024 1 year, 159 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
GTM GTM-AW-10792224287 Jan 2024 Mar 2024 50 days
nftscracked.com nftscracked.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
GTM GTM-AW-439749027 Dec 2022 Sep 2024 1 year, 264 days
GTM GTM-AW-10792224287 Sep 2023 Mar 2024 167 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
quarsihub.com quarsihub.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Apr 2023 Sep 2024 1 year, 149 days
GTM GTM-AW-439749027 Apr 2023 Sep 2024 1 year, 135 days
GTM GTM-AW-10792224287 Sep 2023 Mar 2024 167 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
grabswirl.com grabswirl.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Sep 2024 1 year, 160 days
GTM GTM-AW-439749027 Mar 2023 Sep 2024 1 year, 159 days
GTM GTM-AW-10792224287 Sep 2023 Mar 2024 167 days
GTM GTM-AW-313468456 May 2024 Jul 2024 63 days
domaingpt.ai domaingpt.ai
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Sep 2024 1 year, 175 days
GTM GTM-AW-439749027 Mar 2023 Sep 2024 1 year, 161 days
GTM GTM-AW-10792224287 Sep 2023 Feb 2024 163 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
getvidproposal.com getvidproposal.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2023 Sep 2024 1 year, 133 days
GTM GTM-AW-439749027 Dec 2023 Sep 2024 270 days
GTM GTM-AW-10792224287 Sep 2023 Mar 2024 167 days
GTM GTM-AW-313468456 Jun 2024 Jul 2024 37 days
bingbangprofits.com bingbangprofits.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
GTM GTM-AW-439749027 Sep 2023 Sep 2024 359 days
GTM GTM-AW-10792224287 Sep 2023 Oct 2023 23 days
GTM GTM-AW-568337586 Jun 2023 Jun 2023 One Off
getpagesdeal.com getpagesdeal.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Jun 2023 Sep 2024 1 year, 110 days
GTM GTM-AW-439749027 Jul 2023 Sep 2024 1 year, 39 days
GTM GTM-AW-10792224287 Sep 2023 Mar 2024 167 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
trafficzion.com trafficzion.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Aug 2023 278 days
GTM GTM-AW-10792224287 Oct 2023 Nov 2023 11 days
GTM GTM-AW-10862372267 Jul 2024 Jul 2024 One Off
passionfuze.com passionfuze.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Jan 2023 Sep 2024 1 year, 238 days
GTM GTM-AW-10792224287 Sep 2023 Mar 2024 167 days
GTM GTM-AW-439749027 Jun 2023 Jul 2023 13 days
aicreativesuite.cc aicreativesuite.cc
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Apr 2024 Sep 2024 132 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2023 Nov 2023 One Off
visualtreasureai.live visualtreasureai.live
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2024 Aug 2024 86 days
GTM GTM-AW-439749027 May 2024 Aug 2024 73 days
GTM GTM-AW-313468456 May 2024 May 2024 One Off
dooengageyard.com dooengageyard.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Mar 2023 Sep 2024 1 year, 168 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
GTM GTM-AW-10792224287 Nov 2023 Nov 2023 One Off
createhealthwealthwisdom.com mydfyapp.createhealthwealthwisdom.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Jan 2024 Jan 2024 One Off
GTM GTM-AW-439749027 Jan 2024 Jan 2024 One Off
govumu.com govumu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Sep 2024 118 days
GTM GTM-AW-10829273347 Jun 2024 Jun 2024 One Off
overlapai.live overlapai.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Aug 2024 72 days
GTM GTM-AW-313468456 Jun 2024 Jun 2024 One Off
paymentoverload.com paymentoverload.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Aug 2023 265 days
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
primedesignai.com primedesignai.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Apr 2023 Apr 2023 One Off
GTM GTM-AW-439749027 Apr 2023 Apr 2023 One Off
aiwizard.live aiwizard.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Sep 2024 122 days
GTM GTM-AW-10792224287 Feb 2024 Mar 2024 14 days
vidproposals.co vidproposals.co
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Aug 2023 Mar 2024 199 days
GTM GTM-AW-439749027 Aug 2023 Nov 2023 71 days
bloxevo.com bloxevo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Sep 2024 109 days
GTM GTM-AW-10792224287 Jan 2024 Mar 2024 62 days
getaidvantage.com getaidvantage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Sep 2023 Sep 2024 345 days
GTM GTM-AW-313468456 May 2024 Jul 2024 82 days
getpowrsuite.com getpowrsuite.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
GTM GTM-AW-439749027 Mar 2023 Mar 2023 One Off
a1digitalproducts.com gettubetargeter.a1digitalproducts.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2023 Feb 2024 283 days
GTM GTM-AW-439749027 Feb 2024 Feb 2024 One Off
businessappstudio.com gettubetargeter.businessappstudio.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2023 Oct 2023 163 days
GTM GTM-AW-10792224287 Oct 2023 Oct 2023 One Off
qlmonline.com gettubetargeter.qlmonline.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Dec 2022 May 2023 167 days
GTM GTM-AW-439749027 Dec 2022 May 2023 160 days
voice2content.com voice2content.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Oct 2023 Aug 2024 283 days
GTM GTM-AW-10792224287 Dec 2023 Feb 2024 54 days
cashmoneysecrets.com cashmoneysecrets.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Sep 2024 121 days
GTM GTM-AW-313468456 Jul 2024 Jul 2024 3 days
contentartemis.com contentartemis.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
dropifyai.live dropifyai.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-313468456 Jun 2024 Jul 2024 57 days
GTM GTM-AW-439749027 Aug 2024 Sep 2024 20 days
247365marketing.info gettubetargeter.247365marketing.info
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Jun 2023 80 days
GTM GTM-AW-439749027 Mar 2023 Jun 2023 80 days
grabtweety.com grabtweety.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Mar 2024 1 year, 103 days
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
10xsocial.io 10xsocial.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 May 2024 1 year, 169 days
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
wormholewealth.com wormholewealth.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2023 282 days
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
everhostai.live everhostai.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-313468456 Jul 2024 Jul 2024 1 day
GTM GTM-AW-439749027 Sep 2024 Sep 2024 One Off
getneocloud.live getneocloud.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Dec 2023 Aug 2024 252 days
GTM GTM-AW-313468456 Jun 2024 Jun 2024 One Off
appstosuccess.com gettubetargeter.appstosuccess.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Feb 2024 337 days
GTM GTM-AW-439749027 Mar 2023 Feb 2024 337 days
jumpstartonlineprofits.com mydfyapp.jumpstartonlineprofits.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Oct 2023 Mar 2024 138 days
GTM GTM-AW-439749027 Oct 2023 Mar 2024 138 days
getneocast.com getneocast.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Jun 2024 Sep 2024 88 days
GTM GTM-AW-439749027 Jul 2024 Sep 2024 37 days
propelaikit.com propelaikit.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Aug 2023 Sep 2024 1 year, 33 days
GTM GTM-AW-10792224287 Feb 2024 Mar 2024 28 days
teckipro.com 10xsocial.teckipro.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Apr 2024 1 year, 132 days
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
videoreel.io videoreel.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
getdfyappbiz.com getdfyappbiz.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 May 2023 166 days
GTM GTM-AW-439749027 Feb 2023 May 2023 87 days
getexplainervideoai.com getexplainervideoai.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Jun 2024 Sep 2024 92 days
GTM GTM-AW-313468456 May 2024 May 2024 One Off
businessappstudio.com getlocalcentric.businessappstudio.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Jun 2023 Jul 2023 41 days
GTM GTM-AW-439749027 Jun 2023 Jun 2023 One Off
marketingsparkle.com getlocalcentric.marketingsparkle.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Aug 2023 Aug 2023 One Off
GTM GTM-AW-439749027 Aug 2023 Aug 2023 One Off
grabxclusive.com grabxclusive.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Apr 2024 Sep 2024 129 days
GTM GTM-AW-10792224287 Jan 2024 Jan 2024 One Off
prezentar.com prezentar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-10792224287 Sep 2023 Mar 2024 167 days
GTM GTM-AW-308753853 Nov 2022 Nov 2022 One Off
getautomationai.com getautomationai.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Jun 2024 Sep 2024 74 days
letsmail.co letsmail.co
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Aug 2023 256 days
imseotools.com local.imseotools.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Sep 2023 Sep 2023 One Off
a1digitalproducts.com localcentric.a1digitalproducts.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Jun 2023 80 days
lumpsumpower.com lumpsumpower.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 May 2023 174 days
mailermatic.co mailermatic.co
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Jan 2024 1 year, 60 days
multilive.stream multilive.stream
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Aug 2023 261 days
franknai.com franknai.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Jun 2024 Sep 2024 78 days
pixalbot.com pixalbot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
aiopendoor.com aiopendoor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Jul 2024 Sep 2024 62 days
smartprimeequity.com smartprimeequity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Jun 2024 28 days
autoprofitsites.net autoprofitsites.net
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Nov 2023 354 days
clickagency.io topnotchmarketingsolutions1790.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
trafficzionmethod.com trafficzionmethod.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
trafficziononline.com trafficziononline.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
videxploai.com videxploai.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Aug 2024 Sep 2024 7 days
clickagency.io vmbagency2403.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
serpscout.net go.serpscout.net
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Mar 2024 1 year, 129 days
deltahost.live deltahost.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2023 May 2023 One Off
engageyard.pro engageyard.pro
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Sep 2023 Sep 2023 One Off
funnelmates.co funnelmates.co
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Dec 2022 24 days
coursewiz.co gettubetargeter.coursewiz.co
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Feb 2023 Feb 2023 One Off
makewifimoney.biz gettubetargeter.makewifimoney.biz
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Jan 2023 Jan 2023 One Off
income-engine.com income-engine.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 May 2023 170 days
clickagency.io innewberlin.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
invisiblemethod.com invisiblemethod.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Jan 2023 42 days
clickagency.io clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Sep 2024 1 year, 177 days
getshortsai.com getshortsai.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Jul 2024 Sep 2024 37 days
clickagency.io marketingmagiq976.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
clickagency.io myleads1117.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
clickagency.io onlineconexion1501.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Jun 2023 79 days
pageclickz.com pageclickz.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Apr 2023 Dec 2023 233 days
adaleadz.com adaleadz.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2023 May 2024 1 year, 1 day
aininjakit.com aininjakit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-313468456 May 2024 Jul 2024 76 days
clickagency.io sharonbailey-getupkeepgoing1743.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
clickagency.io smartmoneysystems2284.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
10xprofitsites.com 10xprofitsites.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
aiebooksuite.net aiebooksuite.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Aug 2024 Aug 2024 One Off
trafficbeast.net trafficbeast.net
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Aug 2023 278 days
clickagency.io tymongroup2841.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
aiaffiliatemachine.com aiaffiliatemachine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Sep 2024 110 days
bigticketcommissions.net bigticketcommissions.net
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Sep 2023 Sep 2024 1 year, 15 days
viraldashboard.live viraldashboard.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Aug 2024 117 days
clickagency.io witcheswithoutborders1786.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
starcommissions.com wormholewealth.starcommissions.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Aug 2023 271 days
wpdefense.live wpdefense.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Jun 2024 Sep 2024 82 days
linkable.studio jv.linkable.studio
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Oct 2023 Oct 2023 One Off
clickhomeincome.com clickhomeincome.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 May 2024 1 year, 190 days
clickkagency.com clickkagency.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2023 May 2023 One Off
ezprofitpages.com ezprofitpages.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Dec 2023 1 year, 9 days
getbrainboxapp.com getbrainboxapp.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
getpowrsuite.co getpowrsuite.co
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Dec 2022 25 days
grabembassy.com grabembassy.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2023 307 days
getwebwise.live getwebwise.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Sep 2024 106 days
getpixasuiteai.com getpixasuiteai.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Apr 2024 Sep 2024 129 days
agencycliks.com agencycliks.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2023 Sep 2024 1 year, 128 days
larocheagency.com larocheagency.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Apr 2023 Sep 2024 1 year, 163 days
scrapeit.cloud scrapeit.cloud
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Mar 2024 1 year, 128 days
softsites.live softsites.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Aug 2024 Sep 2024 10 days
therethinkacademy.com therethinkacademy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-561913114 Jul 2023 Jul 2023 One Off
trafficzionapp.com trafficzionapp.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Aug 2023 278 days
videoagencyfunnels.com videoagencyfunnels.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Dec 2023 1 year, 27 days
webinarcreator.live webinarcreator.live
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Feb 2023 87 days
webinarwithjohn.com webinarwithjohn.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
wpcontentfactory.com wpcontentfactory.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Nov 2023 344 days
wphost.live wphost.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Aug 2024 Sep 2024 7 days
getjetwebinar.com getjetwebinar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Sep 2024 118 days
getviddle.co getviddle.co
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Mar 2023 126 days
grabenergize.com grabenergize.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Dec 2022 26 days
clickagency.io inranking1185.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
clickagency.io leadeasily891.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
clickagency.io miniweb2744.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
netconcept.cc netconcept.cc
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2024 Sep 2024 182 days
nethostglobal.com nethostglobal.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Apr 2023 Sep 2024 1 year, 156 days
aitrafficblitz.com aitrafficblitz.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2024 Sep 2024 124 days
clickagency.io oabconsulting781.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
clickagency.io pages1390.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
primebook.live primebook.live
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Jan 2023 Jan 2023 One Off
prrage.com prrage.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024 1 year, 300 days
aiviralnews.com aiviralnews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-313468456 May 2024 May 2024 One Off
aiplatformcreator.com aiplatformcreator.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Aug 2024 Aug 2024 One Off
clickagency.io thakampent.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
trafficlinkr.com trafficlinkr.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Sep 2024 Sep 2024 6 days
unifyai.live unifyai.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 May 2024 One Off
limitlesspassionacademy.com blackfridayspecial.limitlesspassionacademy.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Feb 2023 Dec 2023 286 days
clickagency.io virooz965.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Jul 2023 120 days
wavecloud.live wavecloud.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Feb 2024 Sep 2024 204 days
xpertmarketer.com xpertmarketer.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2024 Mar 2024 One Off
getadaleadz.com getadaleadz.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Oct 2023 331 days
getcontentgorilla.com getcontentgorilla.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 Jul 2024 Aug 2024 38 days
dfyroyalapps.com getlocalcentric.dfyroyalapps.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Aug 2023 134 days
getwhitelabelstudio.com getwhitelabelstudio.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Jun 2023 190 days
marketallpro.com localcentric.marketallpro.com
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P May 2023 Jun 2023 41 days
magickfunnels.net magickfunnels.net
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Oct 2023 317 days
miagenciadigital.online miagenciadigital.online
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Apr 2023 Apr 2023 One Off
clickagency.io mindspiritdevelopment2125.clickagency.io
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Mar 2023 Mar 2023 One Off
mobiappai.live mobiappai.live
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-AW-439749027 May 2024 Sep 2024 116 days
pagebundle.online pagebundle.online
Attribute Value First Detected Last Detected Overlap Duration
AD AD-4RT76HY4CVCEVPHEANWH4P Jan 2024 Jan 2024 One Off
FLIPFLOPPROFITS.COM
Non IP Attributes
Attribute First Last
AD AD-4RT76HY4CVCEVPHEANWH4P Nov 2022 Sep 2024
GTM GTM-AW-439749027 Dec 2022 Sep 2024
GTM GTM-AW-10792224287 Sep 2023 Mar 2024
GTM GTM-AW-313468456 May 2024 Jul 2024
GTM GTM-AW-308753853 Nov 2022 Nov 2022
GTM GTM-AW-306712238 Feb 2023 Feb 2023
GTM GTM-AW-10864906425 May 2023 May 2023
GTM GTM-AW-568337586 Jun 2023 Jun 2023
GTM GTM-AW-561913114 Jul 2023 Jul 2023
GTM GTM-AW-10867247910 Oct 2023 Oct 2023
GTM GTM-AW-10829273347 Jun 2024 Jun 2024
GTM GTM-AW-10862372267 Jul 2024 Jul 2024
GTM GTM-AW-10831673865 Sep 2024 Sep 2024
FLIPFLOPPROFITS.COM
Overlap Attribute Domains
flipflopprofits.com flipflopprofits.com
pinbank.net pinbank.net
getprobuildz.com getprobuildz.com
tubematic.net tubematic.net
spectra-app.com spectra-app.com
gptok.ai gptok.ai
nftscracked.com nftscracked.com
quarsihub.com quarsihub.com
grabswirl.com grabswirl.com
domaingpt.ai domaingpt.ai
getvidproposal.com getvidproposal.com
bingbangprofits.com bingbangprofits.com
getpagesdeal.com getpagesdeal.com
trafficzion.com trafficzion.com
passionfuze.com passionfuze.com
aicreativesuite.cc aicreativesuite.cc
visualtreasureai.live visualtreasureai.live
dooengageyard.com dooengageyard.com
mydfyapp.createhealthwealthwisdom.com mydfyapp.createhealthwealthwisdom.com
govumu.com govumu.com
overlapai.live overlapai.live
paymentoverload.com paymentoverload.com
primedesignai.com primedesignai.com
aiwizard.live aiwizard.live
vidproposals.co vidproposals.co
bloxevo.com bloxevo.com
getaidvantage.com getaidvantage.com
getpowrsuite.com getpowrsuite.com
gettubetargeter.a1digitalproducts.com gettubetargeter.a1digitalproducts.com
gettubetargeter.businessappstudio.com gettubetargeter.businessappstudio.com
gettubetargeter.qlmonline.com gettubetargeter.qlmonline.com
voice2content.com voice2content.com
cashmoneysecrets.com cashmoneysecrets.com
contentartemis.com contentartemis.com
dropifyai.live dropifyai.live
gettubetargeter.247365marketing.info gettubetargeter.247365marketing.info
grabtweety.com grabtweety.com
10xsocial.io 10xsocial.io
wormholewealth.com wormholewealth.com
everhostai.live everhostai.live
getneocloud.live getneocloud.live
gettubetargeter.appstosuccess.com gettubetargeter.appstosuccess.com
mydfyapp.jumpstartonlineprofits.com mydfyapp.jumpstartonlineprofits.com
getneocast.com getneocast.com
propelaikit.com propelaikit.com
10xsocial.teckipro.com 10xsocial.teckipro.com
videoreel.io videoreel.io
getdfyappbiz.com getdfyappbiz.com
getexplainervideoai.com getexplainervideoai.com
getlocalcentric.businessappstudio.com getlocalcentric.businessappstudio.com
getlocalcentric.marketingsparkle.com getlocalcentric.marketingsparkle.com
grabxclusive.com grabxclusive.com
prezentar.com prezentar.com
getautomationai.com getautomationai.com
letsmail.co letsmail.co
local.imseotools.com local.imseotools.com
localcentric.a1digitalproducts.com localcentric.a1digitalproducts.com
lumpsumpower.com lumpsumpower.com
mailermatic.co mailermatic.co
multilive.stream multilive.stream
franknai.com franknai.com
pixalbot.com pixalbot.com
aiopendoor.com aiopendoor.com
smartprimeequity.com smartprimeequity.com
autoprofitsites.net autoprofitsites.net
topnotchmarketingsolutions1790.clickagency.io topnotchmarketingsolutions1790.clickagency.io
trafficzionmethod.com trafficzionmethod.com
trafficziononline.com trafficziononline.com
videxploai.com videxploai.com
vmbagency2403.clickagency.io vmbagency2403.clickagency.io
go.serpscout.net go.serpscout.net
deltahost.live deltahost.live
engageyard.pro engageyard.pro
funnelmates.co funnelmates.co
gettubetargeter.coursewiz.co gettubetargeter.coursewiz.co
gettubetargeter.makewifimoney.biz gettubetargeter.makewifimoney.biz
income-engine.com income-engine.com
innewberlin.clickagency.io innewberlin.clickagency.io
invisiblemethod.com invisiblemethod.com
clickagency.io clickagency.io
getshortsai.com getshortsai.com
marketingmagiq976.clickagency.io marketingmagiq976.clickagency.io
myleads1117.clickagency.io myleads1117.clickagency.io
onlineconexion1501.clickagency.io onlineconexion1501.clickagency.io
pageclickz.com pageclickz.com
adaleadz.com adaleadz.com
aininjakit.com aininjakit.com
sharonbailey-getupkeepgoing1743.clickagency.io sharonbailey-getupkeepgoing1743.clickagency.io
smartmoneysystems2284.clickagency.io smartmoneysystems2284.clickagency.io
10xprofitsites.com 10xprofitsites.com
aiebooksuite.net aiebooksuite.net
trafficbeast.net trafficbeast.net
tymongroup2841.clickagency.io tymongroup2841.clickagency.io
aiaffiliatemachine.com aiaffiliatemachine.com
bigticketcommissions.net bigticketcommissions.net
viraldashboard.live viraldashboard.live
witcheswithoutborders1786.clickagency.io witcheswithoutborders1786.clickagency.io
wormholewealth.starcommissions.com wormholewealth.starcommissions.com
wpdefense.live wpdefense.live
jv.linkable.studio jv.linkable.studio
clickhomeincome.com clickhomeincome.com
clickkagency.com clickkagency.com
ezprofitpages.com ezprofitpages.com
getbrainboxapp.com getbrainboxapp.com
getpowrsuite.co getpowrsuite.co
grabembassy.com grabembassy.com
getwebwise.live getwebwise.live
getpixasuiteai.com getpixasuiteai.com
agencycliks.com agencycliks.com
larocheagency.com larocheagency.com
scrapeit.cloud scrapeit.cloud
softsites.live softsites.live
therethinkacademy.com therethinkacademy.com
trafficzionapp.com trafficzionapp.com
videoagencyfunnels.com videoagencyfunnels.com
webinarcreator.live webinarcreator.live
webinarwithjohn.com webinarwithjohn.com
wpcontentfactory.com wpcontentfactory.com
wphost.live wphost.live
getjetwebinar.com getjetwebinar.com
getviddle.co getviddle.co
grabenergize.com grabenergize.com
inranking1185.clickagency.io inranking1185.clickagency.io
leadeasily891.clickagency.io leadeasily891.clickagency.io
miniweb2744.clickagency.io miniweb2744.clickagency.io
netconcept.cc netconcept.cc
nethostglobal.com nethostglobal.com
aitrafficblitz.com aitrafficblitz.com
oabconsulting781.clickagency.io oabconsulting781.clickagency.io
pages1390.clickagency.io pages1390.clickagency.io
primebook.live primebook.live
prrage.com prrage.com
aiviralnews.com aiviralnews.com
aiplatformcreator.com aiplatformcreator.com
thakampent.clickagency.io thakampent.clickagency.io
trafficlinkr.com trafficlinkr.com
unifyai.live unifyai.live
blackfridayspecial.limitlesspassionacademy.com blackfridayspecial.limitlesspassionacademy.com
virooz965.clickagency.io virooz965.clickagency.io
wavecloud.live wavecloud.live
xpertmarketer.com xpertmarketer.com
getadaleadz.com getadaleadz.com
getcontentgorilla.com getcontentgorilla.com
getlocalcentric.dfyroyalapps.com getlocalcentric.dfyroyalapps.com
getwhitelabelstudio.com getwhitelabelstudio.com
localcentric.marketallpro.com localcentric.marketallpro.com
magickfunnels.net magickfunnels.net
miagenciadigital.online miagenciadigital.online
mindspiritdevelopment2125.clickagency.io mindspiritdevelopment2125.clickagency.io
mobiappai.live mobiappai.live
pagebundle.online pagebundle.online
FLIPFLOPPROFITS.COM
IP History

Click the IP addresses to see over domains using them.