HAPPYVALLEYDENTISTRY.COM
Shared Attributes
Domain
thundermountaindentistry.com thundermountaindentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jan 2012 Oct 2017 5 years, 257 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 300 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-117912474 Dec 2020 Jul 2021 231 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
fountainhillsdentalcare.com fountainhillsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 197 days
UA UA-117912474 Jan 2021 Jul 2021 189 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-22814484 Dec 2011 Feb 2012 51 days
lakeviewfamilydental.com lakeviewfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 282 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lifetimedentistryofsouthtulsa.com lifetimedentistryofsouthtulsa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 176 days
UA UA-22814484 May 2016 Oct 2017 1 year, 159 days
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
myportorangedentist.com myportorangedentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-22814484 Mar 2013 Mar 2013 One Off
oakwoodfamilydentalcare.com oakwoodfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
UA UA-117912474 Nov 2020 Jul 2021 250 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 13 days
dfdentistry.com dfdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
NR NR-DD11B77600 May 2016 Nov 2017 1 year, 189 days
UA UA-117912474 Nov 2020 Jul 2021 249 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
smilesdentistryofmitchellville.com smilesdentistryofmitchellville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 224 days
UA UA-22814484 Oct 2013 Dec 2014 1 year, 66 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
thedentistplaceorangepark.com thedentistplaceorangepark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Oct 2017 5 years, 338 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 300 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
tomokafamilydentistry.com tomokafamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Oct 2017 5 years, 237 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 261 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
dentistinftmyers.com dentistinftmyers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 117 days
UA UA-22814484 May 2013 May 2013 1 day
duggapfamilydentistry.com duggapfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-22814484 Jan 2016 Oct 2017 1 year, 278 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 141 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalshawnee.com familydentalshawnee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jan 2015 Sep 2017 2 years, 253 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 290 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
melbournefamilydental.com melbournefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Dec 2011 Oct 2017 5 years, 283 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 233 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
houghtonfamilydentalcare.com houghtonfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 223 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
arrowheadcreeksidedental.com arrowheadcreeksidedental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 216 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
UA UA-117912474 Nov 2020 Jun 2021 229 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
comfortablecaresouthtrail.com comfortablecaresouthtrail.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Oct 2017 5 years, 234 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 23 days
familydentistryarnold.com familydentistryarnold.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jan 2012 Oct 2017 5 years, 279 days
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 309 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 306 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
reflectiondentallittleriver.com reflectiondentallittleriver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Sep 2017 5 years, 204 days
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 322 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
santanmountaindental.com santanmountaindental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 284 days
NR NR-DD11B77600 Mar 2017 Mar 2018 1 year, 6 days
UA UA-117912474 Nov 2020 Jul 2021 240 days
UA UA-55336258 Mar 2017 Jul 2017 145 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
bowlinggreenfamilydental.com bowlinggreenfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Sep 2017 5 years, 299 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 302 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
bullheadcitydentist.com bullheadcitydentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-117912474 Nov 2020 Jun 2021 238 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
moderndentaleastvalley.com moderndentaleastvalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
creativesmilesgreenfield.com creativesmilesgreenfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Oct 2017 5 years, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
crossroadsfamilydentalcare.com crossroadsfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 255 days
UA UA-117912474 Nov 2020 Jul 2021 246 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
deervalleyfamilydentistry.com deervalleyfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-117912474 Nov 2020 Jul 2021 248 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
desertsmilesdentistry.com desertsmilesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 186 days
UA UA-117912474 Nov 2020 Jul 2021 249 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mydentistada.com mydentistada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 May 2015 Sep 2017 2 years, 120 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mydentistardmore.com mydentistardmore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 May 2015 Oct 2017 2 years, 152 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
heartlandfamilydentalcare.com heartlandfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Sep 2017 5 years, 307 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 121 days
littleriverfamilydental.com littleriverfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2015 Sep 2017 2 years, 202 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 181 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
truesmilesonline.com truesmilesonline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Oct 2017 5 years, 237 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 346 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 316 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
chandlersmiles.com chandlersmiles.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 213 days
UA UA-117912474 Nov 2020 Jul 2021 242 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Oct 2016 Feb 2017 116 days
creativesmileschampaign.com creativesmileschampaign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Sep 2017 5 years, 307 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 245 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dekalbdentalgroup.com dekalbdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Oct 2017 5 years, 326 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 117 days
dentaldesignslakesidevillage.com dentaldesignslakesidevillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-22814484 May 2012 May 2012 1 day
dentalvillagesierravista.com dentalvillagesierravista.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 304 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-117912474 Nov 2020 Jul 2021 248 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 55 days
dentistquincy.com dentistquincy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 223 days
UA UA-55336258 Mar 2017 Aug 2018 1 year, 181 days
NR NR-DD11B77600 Mar 2017 Mar 2018 1 year, 6 days
UA UA-22814484 Feb 2017 Sep 2017 213 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakesidevillagedentist.com lakesidevillagedentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jan 2012 Sep 2017 5 years, 246 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 296 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 239 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
landmarkdentalcare.com landmarkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Oct 2017 5 years, 233 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 310 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 12 days
mountaincrestdental.com mountaincrestdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
UA UA-55336258 Nov 2017 Jun 2018 199 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 132 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
puschpeakfamilydental.com puschpeakfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 227 days
NR NR-DD11B77600 Oct 2016 Mar 2018 1 year, 144 days
UA UA-55336258 Sep 2017 Aug 2018 364 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
lakemionadentalcare.com lakemionadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 239 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakewalesdentistry.com lakewalesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 239 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lexingtondentist.com lexingtondentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 174 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lifetimedentistryofchickasha.com lifetimedentistryofchickasha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 191 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
linderhofdental.com linderhofdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 310 days
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 309 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
machesneyparkfamilydental.com machesneyparkfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 341 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 12 days
marionfamilydental.com marionfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 86 days
marketplacedentalcare.com marketplacedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 286 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
marklandfamilydental.com marklandfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Sep 2017 5 years, 303 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Feb 2018 1 year, 108 days
millcreekdentalcarefl.com millcreekdentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 284 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
moorecompletedental.com moorecompletedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 321 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mydentistweatherfordtx.com mydentistweatherfordtx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 118 days
neibauerdentalmanassas.com neibauerdentalmanassas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 13 days
neibauerdentalwaldorf.com neibauerdentalwaldorf.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
broadlandscompletedental.com broadlandscompletedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 111 days
northcharlestonfamilydental.com northcharlestonfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 251 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
dentalcareofbraselton.com dentalcareofbraselton.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 46 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofsapulpa.com dentalcareofsapulpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
okeechobeedentalcare.com okeechobeedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 285 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
dentalcareofsolon.com dentalcareofsolon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 311 days
NR NR-DD11B77600 Jun 2017 Mar 2018 254 days
UA UA-55336258 Feb 2018 Jun 2018 136 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalgroupcarbondale.com dentalgroupcarbondale.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
eastbroadfamilydentistry.com eastbroadfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
capesmilesdentistry.com capesmilesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
plazaboulevarddental.com plazaboulevarddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 138 days
UA UA-55336258 Nov 2017 Jun 2018 225 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pleasantgrovedentaltn.com pleasantgrovedentaltn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 191 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
premierdentistryofblythewood.com premierdentistryofblythewood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
reflectiondentalmanassas.com reflectiondentalmanassas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
rockinghamdentalgroupepping.com rockinghamdentalgroupepping.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 272 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
adamsdairyfamilydentalcare.com adamsdairyfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 192 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
affordabledentistrycolumbia.com affordabledentistrycolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 315 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
shadowbrookdentist.com shadowbrookdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 149 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
armedforcesdentalcenter.com armedforcesdentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 227 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
arnolddentalcenter.com arnolddentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 300 days
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 296 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 112 days
smileforlifedentalcare.com smileforlifedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 339 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smileokc.com smileokc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 320 days
UA UA-55336258 Feb 2018 Aug 2018 211 days
NR NR-DD11B77600 Jul 2017 Feb 2018 191 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesatheathbrook.com smilesatheathbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 236 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesonsouthern.com smilesonsouthern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2023 101 days
smiletodaydentistry.com smiletodaydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 315 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 283 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
springstreetfamilydentistry.com springstreetfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 194 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
sullivanfamilydentistry.com sullivanfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 320 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
sunnysidedentist.com sunnysidedentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Dec 2011 Oct 2017 5 years, 299 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 349 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 316 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
audubondentalcenter.com audubondentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 292 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Apr 2024 1 year, 145 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
terracedentalassociates.com terracedentalassociates.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 282 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
titusvillesmilesdentistry.com titusvillesmilesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 346 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 5 days
bartramfamilydental.com bartramfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2023 1 year, 87 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
baytreefamilydental.com baytreefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Dec 2016 Jun 2018 1 year, 189 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 112 days
towncenterdentallasvegas.com towncenterdentallasvegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 280 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
turtlecreekdentalcare.com turtlecreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 280 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 208 days
NR NR-DD11B77600 Feb 2017 Mar 2018 1 year, 36 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
vanburenfamilydentistry.com vanburenfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Aug 2024 1 year, 277 days
UA UA-55336258 Dec 2017 Aug 2018 249 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
virginiaparkwaydental.com virginiaparkwaydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 1 day
bonitadentalarts.com bonitadentalarts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 111 days
bretonbaydentistry.com bretonbaydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 294 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 84 days
wyliedental.com wyliedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
canoecreekfamilydental.com canoecreekfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 294 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
completedentalofokc.com completedentalofokc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 212 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
chesterfieldparkdental.com chesterfieldparkdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
citrustowerfamilydental.com citrustowerfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 274 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
coralridgedentalarts.com coralridgedentalarts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jun 2024 1 year, 213 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
cosmeticdentistrytampabay.com cosmeticdentistrytampabay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 118 days
dentalassociatesofgrovetown.com dentalassociatesofgrovetown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 240 days
UA UA-55336258 Dec 2017 Aug 2018 249 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
dentalcareatwestsideshoppes.com dentalcareatwestsideshoppes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
UA UA-55336258 Nov 2017 Apr 2018 170 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
dentalcareofmtvernon.com dentalcareofmtvernon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofroundlakebeach.com dentalcareofroundlakebeach.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 55 days
dentalsolutionsonline.com dentalsolutionsonline.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
dentistingainesvillega.com dentistingainesvillega.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 283 days
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 198 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentistinjoplin.com dentistinjoplin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 274 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
devinedentalcare.com devinedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 255 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dixonparkdental.com dixonparkdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Sep 2017 5 years, 204 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
edgewaterfamilydental.com edgewaterfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 222 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalatalafayacrossings.com familydentalatalafayacrossings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 286 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalcareoffitchburg.com familydentalcareoffitchburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 142 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalcareofwarrenton.com familydentalcareofwarrenton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 82 days
familydentalcaresycamore.com familydentalcaresycamore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 267 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 43 days
familydentalfortmyers.com familydentalfortmyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 90 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalofcanton.com familydentalofcanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 221 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalofseabrook.com familydentalofseabrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 306 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 290 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentistryofpoplarbluff.com familydentistryofpoplarbluff.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 101 days
franklindentalcare.com franklindentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 142 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
gatewaydentalcarewi.com gatewaydentalcarewi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
heritagedentalgroup.com heritagedentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 336 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hickorycreekfamilydentistry.com hickorycreekfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 16 days
indianriverdentistry.com indianriverdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 309 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 259 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
innovativedentistryofrockville.com innovativedentistryofrockville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 309 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 221 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
jungermanndentalcare.com jungermanndentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
keywestcrossingdental.com keywestcrossingdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
kingsleyfamilydentalcare.com kingsleyfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 346 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 245 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 133 days
lakejoydentalcare.com lakejoydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 169 days
UA UA-55336258 Feb 2018 Aug 2018 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
lakenonafamilydentistry.com lakenonafamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 310 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalcareofmedina.com familydentalcareofmedina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 309 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
libertycommonsfamilydental.com libertycommonsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 168 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
littlebullrundental.com littlebullrundental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 342 days
UA UA-55336258 Nov 2017 Aug 2018 300 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 70 days
norfolkdentalcare.com norfolkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 342 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 85 days
macombdentalcenter.com macombdentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 341 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 296 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 70 days
magnoliafamilydentistryla.com magnoliafamilydentistryla.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
UA UA-55336258 Sep 2017 Aug 2018 364 days
NR NR-DD11B77600 Jun 2017 Mar 2018 256 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 86 days
mechanicsburgfamilydentistry.com mechanicsburgfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 210 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
missionlakesdentalcare.com missionlakesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 232 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
modernsmilesdentistry.com modernsmilesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 321 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
molinefamilydental.com molinefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 86 days
mycharlestondentist.com mycharlestondentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 322 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mydentistbartlesville.com mydentistbartlesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 May 2015 Oct 2017 2 years, 149 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
mydentistduncan.com mydentistduncan.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mydentistparis.com mydentistparis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 118 days
mystonebridgedentist.com mystonebridgedentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 118 days
neibauerdentalcentralpark.com neibauerdentalcentralpark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
neibauerdentaldumfries.com neibauerdentaldumfries.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
neibauerdentalgarrisonville.com neibauerdentalgarrisonville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 322 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
neibauerdentalsouthriding.com neibauerdentalsouthriding.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 347 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
fourlakesfamilydental.com fourlakesfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 307 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 142 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
janesvillefamilydentalcare.com janesvillefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 349 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 106 days
oakleaffamilydental.com oakleaffamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 341 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
oakleaffamilydentistry.com oakleaffamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
crosswaterdentalcare.com crosswaterdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
UA UA-55336258 Sep 2017 Aug 2018 339 days
NR NR-DD11B77600 May 2017 Dec 2017 234 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
buckcreekfamilydental.com buckcreekfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 274 days
UA UA-55336258 Dec 2017 Aug 2018 223 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Sep 2017 Dec 2017 115 days
firstimpressionssmilecenter.com firstimpressionssmilecenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Aug 2018 1 year, 235 days
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 198 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
palmettocoastdental.com palmettocoastdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 304 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
UA UA-55336258 Mar 2018 Jun 2018 100 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
reedybranchfamilydentistry.com reedybranchfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
parklandfamilydentistry.com parklandfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jul 2018 1 year, 285 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 285 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
parksidegriffith.com parksidegriffith.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Dec 2011 Sep 2017 5 years, 265 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
penfielddentistry.com penfielddentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
UA UA-55336258 Jan 2017 Aug 2018 1 year, 225 days
NR NR-DD11B77600 Jan 2017 Mar 2018 1 year, 50 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 13 days
picayunedentalclinic.com picayunedentalclinic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 304 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Mar 2018 1 year, 144 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
poolerparkwaydentalcare.com poolerparkwaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 139 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
princecreekdentalcare.com princecreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 251 days
UA UA-55336258 Nov 2017 Jun 2018 225 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
quailspringsdentalcare.com quailspringsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 227 days
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
ridgepikedentalcare.com ridgepikedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
UA UA-55336258 Jun 2018 Aug 2018 69 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
rockinghamdentalgroupexeter.com rockinghamdentalgroupexeter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
broadwaydentalarts.com broadwaydentalarts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 312 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 185 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dublindentalcenterpa.com dublindentalcenterpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Apr 2018 Aug 2018 130 days
NR NR-DD11B77600 Sep 2017 Dec 2017 115 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
sawgrasscompletedentistry.com sawgrasscompletedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 147 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesathunterscreek.com smilesathunterscreek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 339 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesoncypresspoint.com smilesoncypresspoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 301 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesonnorthern.com smilesonnorthern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Oct 2023 1 year, 31 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
staugustinedentistry.com staugustinedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 283 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
104thfamilydental.com 104thfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 217 days
UA UA-55336258 Nov 2017 Aug 2018 300 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
sumterdentalcare.com sumterdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 349 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 316 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
sunsethillsdental.com sunsethillsdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 320 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
thedentistplaceocala.com thedentistplaceocala.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 222 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
tracyorcharddentalcare.com tracyorcharddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 281 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
traditionparkwaydentalcare.com traditionparkwaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 May 2024 1 year, 183 days
NR NR-DD11B77600 Jun 2017 Mar 2018 256 days
UA UA-55336258 Dec 2017 Jun 2018 174 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
valleysmilesdentalcare.com valleysmilesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 193 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
villagecrestfamilydental.com villagecrestfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 317 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 192 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 22 days
blossomparkdentalcare.com blossomparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 295 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 84 days
bluebonnetdentalcaretx.com bluebonnetdentalcaretx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 84 days
warnerrobinsfamilydentistry.com warnerrobinsfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 168 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 24 days
wheatfamilydental.com wheatfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 170 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
whiteriverdental.com whiteriverdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Oct 2017 5 years, 327 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Mar 2018 1 year, 144 days
willistonfamilydental.com willistonfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 138 days
UA UA-22814484 Nov 2011 Feb 2012 103 days
wintergardenvillagedental.com wintergardenvillagedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 316 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
woodmontfamilydentistry.com woodmontfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
collegeavedental.com collegeavedental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Aug 2024 1 year, 269 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
crescenthilldentalcare.com crescenthilldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 245 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
crossroadsdentistrytn.com crossroadsdentistrytn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 44 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
davenportvillagedental.com davenportvillagedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Nov 2017 Nov 2017 One Off
dellagiodentist.com dellagiodentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatcolumbuscrossing.com dentalcareatcolumbuscrossing.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 254 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofcolumbia.com dentalcareofcolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofdavenport.com dentalcareofdavenport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofpflugerville.com dentalcareofpflugerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 250 days
NR NR-DD11B77600 Aug 2016 Mar 2018 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofpowell.com dentalcareofpowell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jan 2017 Jun 2018 1 year, 158 days
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 46 days
NR NR-DD11B77600 Jan 2017 Feb 2018 1 year, 22 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareonsanantonio.com dentalcareonsanantonio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 240 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentaldesignslakeland.com dentaldesignslakeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 223 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentaldesignslasvegas.com dentaldesignslasvegas.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalgrouprockford.com dentalgrouprockford.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 102 days
dentistinnaples.com dentistinnaples.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentistplymouthnh.com dentistplymouthnh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dicksondentalcare.com dicksondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 259 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 249 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalcareofsmyrna.com familydentalcareofsmyrna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Dec 2022 Dec 2023 355 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalcareofowasso.com familydentalcareofowasso.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
familydentalcareofrogers.com familydentalcareofrogers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 Jul 2016 Feb 2018 1 year, 202 days
UA UA-55336258 Jan 2017 Jun 2018 1 year, 158 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
familydentistryofshortpump.com familydentistryofshortpump.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 101 days
familydentistryofyukon.com familydentistryofyukon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 101 days
eaglecreekdental.com eaglecreekdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Oct 2017 5 years, 342 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
edgewoodfamilydental.com edgewoodfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 271 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
eventidefamilydentistry.com eventidefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
fairfieldfamilydentaloh.com fairfieldfamilydentaloh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 142 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
glenburniedentalcare.com glenburniedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 100 days
glencarbonfamilydentistry.com glencarbonfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 317 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
greenmountfamilydentistry.com greenmountfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 317 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 245 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
greenwoodfamilydental.com greenwoodfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 257 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 123 days
hollywoodparkdental.com hollywoodparkdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Apr 2013 Oct 2017 4 years, 178 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
islandwalkdentalcare.com islandwalkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 314 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lifetimedentistryatshortpump.com lifetimedentistryatshortpump.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 71 days
limestonesmiles.com limestonesmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 310 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 168 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
rockycreekdentalcare.com rockycreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 250 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Apr 2018 Jun 2018 55 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
burtonsvilledentalcare.com burtonsvilledentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 213 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
seasidelifetimedentistry.com seasidelifetimedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 238 days
UA UA-55336258 Mar 2017 Jun 2018 1 year, 106 days
NR NR-DD11B77600 Mar 2017 Mar 2018 1 year, 6 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
settlerswalkdentalcare.com settlerswalkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 351 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
alegredentalbosque.com alegredentalbosque.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 258 days
UA UA-55336258 Mar 2017 Aug 2018 1 year, 181 days
NR NR-DD11B77600 Mar 2017 Mar 2018 1 year, 6 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
skymarksfamilydentalcare.com skymarksfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 302 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesatjulingtoncreek.com smilesatjulingtoncreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2017 Aug 2018 1 year, 211 days
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 151 days
NR NR-DD11B77600 Feb 2017 Mar 2018 1 year, 36 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesforliferichmond.com smilesforliferichmond.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 320 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesonbeachboulevard.com smilesonbeachboulevard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 151 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilestudioonline.com smilestudioonline.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Jun 2017 Feb 2018 220 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
smilewright.com smilewright.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-22814484 Nov 2011 Feb 2012 103 days
apalacheefamilydental.com apalacheefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 193 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
southernhillsdentalcare.com southernhillsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 224 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
NR NR-DD11B77600 Sep 2017 Sep 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
carolinagentledental.com carolinagentledental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
springvalleydentist.com springvalleydentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 249 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
stluciefamilydental.com stluciefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 315 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
catoctincornerdentistry.com catoctincornerdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
UA UA-55336258 Jun 2018 Aug 2018 49 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
atlanticfamilydentalfl.com atlanticfamilydentalfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2023 1 year, 87 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
austellfamilydentalcare.com austellfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 292 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 187 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
baytownedentalcenter.com baytownedentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Oct 2017 5 years, 235 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2023 331 days
bearbranchdental.com bearbranchdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 257 days
UA UA-55336258 Nov 2017 Jun 2018 199 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
bearcanyondental.com bearcanyondental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Jun 2024 1 year, 206 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 184 days
NR NR-DD11B77600 Oct 2016 Feb 2018 1 year, 108 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
tulsahillsdentalcare.com tulsahillsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 193 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
vermilionfamilydental.com vermilionfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 317 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 280 days
NR NR-DD11B77600 Jul 2016 Dec 2017 1 year, 164 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 22 days
vieradental.com vieradental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 279 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 22 days
villageplazadentaldesigns.com villageplazadentaldesigns.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 317 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 231 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 22 days
bocaparkdentallasvegas.com bocaparkdentallasvegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 308 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 294 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
bradentonsmilesdentistry.com bradentonsmilesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 111 days
westtowndentalcaresc.com westtowndentalcaresc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Nov 2022 Mar 2024 1 year, 128 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
westyorkdentalcare.com westyorkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Dec 2022 Apr 2024 1 year, 112 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
whisperingoaksfamilydental.com whisperingoaksfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 261 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
whitehousefamilydentalcare.com whitehousefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 170 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
whiteoakdentist.com whiteoakdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Jan 2017 Aug 2018 1 year, 232 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
whitewatervalleydental.com whitewatervalleydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 4 days
wiregrassfamilydentalcare.com wiregrassfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 260 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
woodlandheightsfamilydental.com woodlandheightsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Sep 2017 320 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 15 days
cartervilledental.com cartervilledental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Aug 2024 1 year, 271 days
UA UA-55336258 Oct 2016 Mar 2018 1 year, 144 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
cedarcreekdentalcare.com cedarcreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 213 days
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
championsgatedentistry.com championsgatedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
UA UA-55336258 Nov 2017 Jun 2018 225 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 25 days
comfortablecarebeeridge.com comfortablecarebeeridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 110 days
completedentalofeaston.com completedentalofeaston.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
cornerlakefamilydental.com cornerlakefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
GTM GTM-OPT-W4SQKXH Nov 2022 Aug 2024 1 year, 269 days
NR NR-DD11B77600 Jul 2016 Dec 2017 1 year, 164 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
creativesmilesdentalcare.com creativesmilesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
UA UA-55336258 Feb 2017 Jun 2018 1 year, 136 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
creativesmilesmurfreesboro.com creativesmilesmurfreesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 44 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
crestwooddentalcare.com crestwooddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 276 days
UA UA-55336258 Oct 2016 Nov 2017 1 year, 19 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 118 days
mynorthatlantadentist.com mynorthatlantadentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 185 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 118 days
debarydentalcare.com debarydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 311 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
defiancecenterfordentistry.com defiancecenterfordentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalartsofsayville.com dentalartsofsayville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
UA UA-55336258 Jul 2017 Aug 2018 1 year, 11 days
NR NR-DD11B77600 Jun 2017 Dec 2017 182 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatcrystalpark.com dentalcareatcrystalpark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 68 days
dentalcareatplainfieldcrossing.com dentalcareatplainfieldcrossing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareattrinitylakes.com dentalcareattrinitylakes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
UA UA-55336258 Mar 2018 Apr 2018 45 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 44 days
dentalcareofbellevue.com dentalcareofbellevue.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 117 days
dentalcareofdeltona.com dentalcareofdeltona.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 287 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareoffairfield.com dentalcareoffairfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 304 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 250 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofhuntsville.com dentalcareofhuntsville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 46 days
UA UA-55336258 Nov 2017 Aug 2018 275 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
dentalcareoflakewylie.com dentalcareoflakewylie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Aug 2018 1 year, 239 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 223 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofnorman.com dentalcareofnorman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 117 days
dentalcareofpearland.com dentalcareofpearland.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 240 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofwestmelbourne.com dentalcareofwestmelbourne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jan 2017 Aug 2018 1 year, 208 days
NR NR-DD11B77600 Jan 2017 Mar 2018 1 year, 58 days
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 46 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentistinclearwater.com dentistinclearwater.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
dentistrypluslexington.com dentistrypluslexington.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
eastbrewsterdental.com eastbrewsterdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 229 days
UA UA-55336258 Feb 2018 Aug 2018 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
familydentalcareofmuskego.com familydentalcareofmuskego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 142 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalcareofpowdersville.com familydentalcareofpowdersville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 14 days
familydentalcaresouthlakeland.com familydentalcaresouthlakeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 235 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalofcedarpark.com familydentalofcedarpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 309 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
flsmiles.com flsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 235 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
fortworthtxdentist.com fortworthtxdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
UA UA-55336258 Jun 2018 Aug 2018 51 days
gainesvillefamilydentalcare.com gainesvillefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 290 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
gainesvillesmilesdentalcare.com gainesvillesmilesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 290 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 May 2017 Aug 2018 1 year, 118 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
gallatindentalcare.com gallatindentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 220 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
galleriadentalhenderson.com galleriadentalhenderson.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 114 days
gatewaysmilesdentistry.com gatewaysmilesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 271 days
NR NR-DD11B77600 Sep 2016 Feb 2018 1 year, 141 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mycrossroadsdentist.com mycrossroadsdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 104 days
mydentistftsmith.com mydentistftsmith.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Jul 2017 Aug 2018 1 year, 36 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mydentistbrokenarrow.com mydentistbrokenarrow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
greatplainsfamilydentistryenid.com greatplainsfamilydentistryenid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 225 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
greatsouthernsmiles.com greatsouthernsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 172 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
greenhillsfamilydentistry.com greenhillsfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Nov 2011 Oct 2017 5 years, 329 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 245 days
myontariodentist.com myontariodentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 185 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hartlandfamilydentalcare.com hartlandfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 298 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hersheydentalgroup.com hersheydentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 43 days
hesselparkdentistry.com hesselparkdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 298 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
longwoodfamilydentistry.com longwoodfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 326 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
howellbranchdentalcare.com howellbranchdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 134 days
lakelandfldentistry.com lakelandfldentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 239 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakepointedentistrytx.com lakepointedentistrytx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 120 days
leevistadental.com leevistadental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 309 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lifetimedentalofflowermound.com lifetimedentalofflowermound.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Apr 2018 Aug 2018 121 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 119 days
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
lifetimedentalofnorman.com lifetimedentalofnorman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
NR NR-DD11B77600 Jun 2017 Sep 2017 67 days
UA UA-55336258 Jun 2018 Aug 2018 52 days
lifetimedentistrybradenton.com lifetimedentistrybradenton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 80 days
lifetimedentistryladylake.com lifetimedentistryladylake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 310 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 237 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lifetimedentistryofroyalpalm.com lifetimedentistryofroyalpalm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 105 days
lifetimefamilydentalcare.com lifetimefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 296 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 176 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lifetimesmilesdentalcare.com lifetimesmilesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 296 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 105 days
lochridgedentalcare.com lochridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 213 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mortonfamilydental.com mortonfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 11 days
neibauerdentalharrisoncrossing.com neibauerdentalharrisoncrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
oldemillfamilydental.com oldemillfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 187 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
pebblecreekdental.com pebblecreekdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jan 2017 Aug 2018 1 year, 233 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
NR NR-DD11B77600 Jan 2017 Feb 2018 1 year, 22 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
rioranchodentistnm.com rioranchodentistnm.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 254 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
pompanobeachfamilydental.com pompanobeachfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 286 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
riverviewsmilesdental.com riverviewsmilesdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 272 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
prestwickpointedental.com prestwickpointedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 304 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
reservoirdentalgroup.com reservoirdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 272 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
ricecreekfamilydentistry.com ricecreekfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
NR NR-DD11B77600 Dec 2016 Feb 2018 1 year, 54 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
rivercrestcommonsfamilydental.com rivercrestcommonsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
UA UA-55336258 Nov 2017 Aug 2018 274 days
NR NR-DD11B77600 Nov 2017 Feb 2018 90 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
riversdentalcare.com riversdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 161 days
UA UA-55336258 Oct 2016 Feb 2018 1 year, 109 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
hammondfamilydental.com hammondfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 53 days
royaloaksdental.com royaloaksdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 285 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 May 2017 Aug 2018 1 year, 118 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
lifetimefamilydentalva.com lifetimefamilydentalva.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 133 days
byronfamilydentalcare.com byronfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
cambridgefamilydentistry.com cambridgefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
camphilldentist.com camphilldentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 302 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 239 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
affordabledentistryrockford.com affordabledentistryrockford.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 86 days
hamlingrovesdentalcare.com hamlingrovesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 336 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
alegredentalpetroglyphs.com alegredentalpetroglyphs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 258 days
UA UA-55336258 Jun 2017 Aug 2018 1 year, 66 days
NR NR-DD11B77600 May 2017 Mar 2018 308 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
caminorealdentaltx.com caminorealdentaltx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 294 days
UA UA-55336258 Mar 2017 Aug 2018 1 year, 181 days
NR NR-DD11B77600 Mar 2017 Dec 2017 297 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 124 days
siennadental.com siennadental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 249 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smiledesigndental.com smiledesigndental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Dec 2011 Oct 2017 5 years, 276 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Jan 2017 Aug 2018 1 year, 225 days
smileforlifedental.com smileforlifedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 321 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesatcarolinaforest.com smilesatcarolinaforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 283 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesatgoosecreek.com smilesatgoosecreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 283 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
southlakedentalcarefl.com southlakedentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 119 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
southeastdentist.com southeastdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 315 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 283 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
southerndentalcenter.com southerndentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 194 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
springfielddc.com springfielddc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Oct 2017 5 years, 238 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
stadiumfamilydentistry.com stadiumfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 224 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
casadydentalcare.com casadydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 302 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 213 days
NR NR-DD11B77600 Sep 2016 Dec 2017 1 year, 103 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
stluciewestdentalcare.com stluciewestdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
stonecreekfamilydentistry.com stonecreekfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 315 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 266 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
aberdeendentalcare.com aberdeendentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 56 days
sunstonedental.com sunstonedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 301 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Jun 2018 1 year, 183 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
middleburgfamilydentalcare.com middleburgfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 311 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 284 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
miltonfamilydentalcare.com miltonfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 166 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
thedentistplacespringhill.com thedentistplacespringhill.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 246 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
thedentistplacespringhillkids.com thedentistplacespringhillkids.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 281 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
bayberrydental.com bayberrydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 313 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Apr 2018 Aug 2018 130 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
beautifulsmilesbydesign.com beautifulsmilesbydesign.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 257 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Apr 2018 Apr 2018 One Off
bellepointdental.com bellepointdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 313 days
UA UA-55336258 Jul 2017 Jun 2018 326 days
NR NR-DD11B77600 Jun 2017 Dec 2017 182 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
universityfamilydentistry.com universityfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 255 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
waterfordlakesdentistry.com waterfordlakesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 336 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 24 days
yourdanvilledentist.com yourdanvilledentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 279 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 22 days
citrusgrovedentalcare.com citrusgrovedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 225 days
NR NR-DD11B77600 Sep 2016 Mar 2018 1 year, 177 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
clarksvillefamilydental.com clarksvillefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jan 2012 Oct 2017 5 years, 272 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
festusdental.com festusdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 290 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Sep 2017 Aug 2018 340 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
coconutcreekwinningsmiles.com coconutcreekwinningsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 279 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 256 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
completedentalcaremansfield.com completedentalcaremansfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 85 days
completedentallakecity.com completedentallakecity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 231 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
completedentistryestero.com completedentistryestero.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 330 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
crossroadsdentaldallas.com crossroadsdentaldallas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
crosstimbersfamilydental.com crosstimbersfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 330 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
ddsassociates.com ddsassociates.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 Feb 2017 Mar 2018 1 year, 36 days
UA UA-55336258 Mar 2017 Dec 2017 297 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofbixby.com dentalcareofbixby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 250 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofhampton.com dentalcareofhampton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 55 days
dentalcareofsouthaiken.com dentalcareofsouthaiken.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofwestminster.com dentalcareofwestminster.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofwestoverhills.com dentalcareofwestoverhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 254 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentistarkadelphia.com dentistarkadelphia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 311 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
diamondvalleydental.com diamondvalleydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 82 days
dunedindentalcare.com dunedindentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 116 days
eastrochesterfamilydentistry.com eastrochesterfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 291 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
evansvillefamilydental.com evansvillefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 305 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
familydentalofbelair.com familydentalofbelair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
familydentaloflexington.com familydentaloflexington.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 253 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalorlandpark.com familydentalorlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 287 days
UA UA-22814484 Jan 2013 Feb 2014 1 year, 17 days
familydentistryaustin.com familydentistryaustin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 246 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 116 days
frontstreetfamilydentistry.com frontstreetfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 114 days
harbisonhilldentistry.com harbisonhilldentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 262 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
getahealthysmile.com getahealthysmile.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 317 days
NR NR-DD11B77600 Oct 2016 Mar 2018 1 year, 144 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
granddentistryfl.com granddentistryfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 262 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
grandtraversedentalcare.com grandtraversedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 248 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
greenwaycenterdentistry.com greenwaycenterdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 245 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 225 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hanburydentalcare.com hanburydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Apr 2018 Aug 2018 130 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 121 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
hartsvilledentistsc.com hartsvilledentistsc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hersheyplazadental.com hersheyplazadental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 298 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
highwaykdentalcare.com highwaykdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 220 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 103 days
hillviewfamilydental.com hillviewfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Oct 2017 5 years, 239 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
honeygrovefamilydentistry.com honeygrovefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 317 days
NR NR-DD11B77600 Jul 2016 Feb 2018 1 year, 202 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
indianapolisdentaldesigns.com indianapolisdentaldesigns.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2024 1 year, 119 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
innerharbordental.com innerharbordental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 171 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
killianroaddentalcare.com killianroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 302 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
NR NR-DD11B77600 Dec 2016 Feb 2018 1 year, 54 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakegibsondental.com lakegibsondental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 215 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
landstowndentalcare.com landstowndentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
lebanondentalcare.com lebanondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 169 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lifetimedentistryofportorange.com lifetimedentistryofportorange.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 289 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lifetimestpeters.com lifetimestpeters.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 296 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
litchfieldfamilydentistry.com litchfieldfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Sep 2017 5 years, 204 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 320 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
littleroaddentalcare.com littleroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mastershanddental.com mastershanddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 268 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 105 days
midtowndentalcare.com midtowndentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 112 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
missionhillsdentistry.com missionhillsdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 132 days
mytotalcaredental.com mytotalcaredental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 104 days
naturecoastdentalcare.com naturecoastdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Feb 2017 Jun 2018 1 year, 136 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
neibauerdentalbowie.com neibauerdentalbowie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
neibauerdentalcosnerscorner.com neibauerdentalcosnerscorner.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 322 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
neibauerdentalcrofton.com neibauerdentalcrofton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
neibauerdentalhyattsville.com neibauerdentalhyattsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
northwestokcdentalcare.com northwestokcdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 13 days
oakridgedentalcare.com oakridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 239 days
UA UA-55336258 Feb 2017 Apr 2018 1 year, 81 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
palmcoastdentalcare.com palmcoastdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 304 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
palmettodentalhealth.com palmettodentalhealth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 251 days
NR NR-DD11B77600 Aug 2016 Dec 2017 1 year, 137 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pennpremierdental.com pennpremierdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 312 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 304 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
peppertreedental.com peppertreedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
UA UA-55336258 Sep 2017 Aug 2018 364 days
NR NR-DD11B77600 Jul 2017 Feb 2018 190 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
perfectsmilesdental.com perfectsmilesdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2024 1 year, 136 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pickeringtonfamilydental.com pickeringtonfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Aug 2018 1 year, 257 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2024 1 year, 137 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
quirtfamilydentistry-plover.com quirtfamilydentistry-plover.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
lakesaintlouisdentist.com lakesaintlouisdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
lakesidedentalcareaz.com lakesidedentalcareaz.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 133 days
dentalcareofprincefrederick.com dentalcareofprincefrederick.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
longbowdentalcare.com longbowdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 213 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mahanvillagedentalcare.com mahanvillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
UA UA-55336258 Nov 2017 Aug 2018 300 days
NR NR-DD11B77600 Sep 2017 Mar 2018 189 days
morningsidefamilydentalil.com morningsidefamilydentalil.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
mydentistrussellville.com mydentistrussellville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 119 days
naplespremierdentistry.com naplespremierdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 13 days
nashborovillagefamilydental.com nashborovillagefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2023 1 year, 5 days
neibauerdentalfalmouth.com neibauerdentalfalmouth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
neibauerdentalfortbelvoir.com neibauerdentalfortbelvoir.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
neibauerdentalherndon.com neibauerdentalherndon.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
UA UA-22814484 Mar 2016 Sep 2017 1 year, 173 days
dentalcareatmaderavista.com dentalcareatmaderavista.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-117912474 Nov 2020 Jul 2021 248 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 117 days
ofallondental.com ofallondental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
okaloosafamilydentistry.com okaloosafamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Nov 2017 Aug 2018 274 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
oswegocommonsfamilydental.com oswegocommonsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
paddockplacedental.com paddockplacedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 125 days
dentaldesignoffortwayne.com dentaldesignoffortwayne.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
bonitaesterodental.com bonitaesterodental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
UA UA-55336258 Apr 2018 Aug 2018 104 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
peoriafamilydental.com peoriafamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
pickettsmilldentalcare.com pickettsmilldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2024 1 year, 137 days
portofinobaydentalcare.com portofinobaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 228 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
poughkeepsiedentalny.com poughkeepsiedentalny.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 304 days
NR NR-DD11B77600 Jun 2017 Mar 2018 256 days
GTM GTM-5MGLNPZ Sep 2024 Sep 2024 5 days
prairielakesdentalcare.com prairielakesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 326 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
prairieridgedentalcare.com prairieridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
prairieviewfamilydental.com prairieviewfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
prattvilledentalcare.com prattvilledentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 312 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
pricecreekdentistry.com pricecreekdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Mar 2018 Aug 2018 175 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
dentalcareofsouthelgin.com dentalcareofsouthelgin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
richmondfamilydental.com richmondfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 322 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
easleydentist.com easleydentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalcareofedmond.com dentalcareofedmond.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 Jun 2016 Feb 2018 1 year, 216 days
acworthstationdentalcare.com acworthstationdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Nov 2017 Aug 2018 274 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2023 118 days
sandbridgefamilydentalcare.com sandbridgefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 313 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
severnaparkdentalcare.com severnaparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 351 days
NR NR-DD11B77600 Jul 2017 Mar 2018 226 days
UA UA-55336258 Apr 2018 Aug 2018 130 days
southlakefamilydentalsc.com southlakefamilydentalsc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Jan 2017 Aug 2018 1 year, 233 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
springridgedentalcare.com springridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Nov 2017 Aug 2018 300 days
NR NR-DD11B77600 Jul 2017 Mar 2018 226 days
stauntondentist.com stauntondentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
stevensonfamilydental.com stevensonfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
UA UA-55336258 Feb 2017 Jun 2018 1 year, 136 days
UA UA-22814484 Jul 2016 Sep 2017 1 year, 71 days
sugarloaffamilydental.com sugarloaffamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 119 days
summitfairdentalcare.com summitfairdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 316 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 313 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
audubondentalgroupmemphis.com audubondentalgroupmemphis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
UA UA-55336258 Jul 2017 Aug 2018 1 year, 36 days
NR NR-DD11B77600 Jun 2017 Mar 2018 256 days
thomasvilleroaddentalcare.com thomasvilleroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
UA UA-55336258 Jan 2017 Jun 2018 1 year, 158 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
tillerydentallaurel.com tillerydentallaurel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 261 days
universityplacedental.com universityplacedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
washingtonfamilydentalcare.com washingtonfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
westfallschurchdental.com westfallschurchdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Feb 2018 1 year, 108 days
westuniversityfamilydentistry.com westuniversityfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 170 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
willowknollsdental.com willowknollsdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 302 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Feb 2018 1 year, 108 days
casadysquareorthodontics.com casadysquareorthodontics.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Sep 2016 Dec 2017 1 year, 103 days
GTM GTM-OPT-W4SQKXH Nov 2022 May 2023 154 days
completedentalcarefl.com completedentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
completedentalcarerichmond.com completedentalcarerichmond.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 324 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
coalcreekfamilydental.com coalcreekfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 225 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
creativesmileswinghaven.com creativesmileswinghaven.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
crowvalleydental.com crowvalleydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
dentalcareofgreencastle.com dentalcareofgreencastle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalcareofspringhill.com dentalcareofspringhill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
dentalcareofstjoseph.com dentalcareofstjoseph.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentist-in-tulsa.com dentist-in-tulsa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2022 42 days
dentistinlawton.com dentistinlawton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
dentistryonwalnutgrove.com dentistryonwalnutgrove.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Jun 2018 Aug 2018 50 days
distinctivedentalsolutions.com distinctivedentalsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
familydentalcareeastpeoria.com familydentalcareeastpeoria.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 306 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
familydentalofthornton.com familydentalofthornton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
familydentistryofnorthlake.com familydentistryofnorthlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 306 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2023 164 days
farmingtondentalcare.com farmingtondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
harrisonbridgedentalcare.com harrisonbridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
independencefdc.com independencefdc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 351 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Nov 2017 Aug 2018 274 days
indianlakefamilydental.com indianlakefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 351 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
lakesidedentalne.com lakesidedentalne.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
familydentalcareofolathe.com familydentalcareofolathe.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
leblancdds.com leblancdds.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Oct 2023 1 year, 29 days
UA UA-55336258 Nov 2017 Aug 2018 275 days
NR NR-DD11B77600 Nov 2017 Mar 2018 100 days
meridiandentalcentre.com meridiandentalcentre.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Mar 2018 1 year, 144 days
meridiandentalfalcon.com meridiandentalfalcon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 233 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Jul 2018 Aug 2018 47 days
murrellsinletdentistry.com murrellsinletdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
mydentistgrandview.com mydentistgrandview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2023 272 days
mydentistmuskogee.com mydentistmuskogee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Dec 2022 79 days
myhighlandvillagedentist.com myhighlandvillagedentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2023 138 days
mystpetersdentist.com mystpetersdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
neibauerdentaldalecity.com neibauerdentaldalecity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
neibauerdentallaplata.com neibauerdentallaplata.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 186 days
neibauerdentalleesburg.com neibauerdentalleesburg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
neibauerdentaloxonhill.com neibauerdentaloxonhill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
foxlakedentalcare.com foxlakedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 14 days
UA UA-55336258 Aug 2018 Aug 2018 One Off
northmyrtlebeachdentistry.com northmyrtlebeachdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Sep 2017 Jun 2018 289 days
northpointedentalcarein.com northpointedentalcarein.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
effinghamdentalgroup.com effinghamdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 330 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Jun 2016 Nov 2017 1 year, 153 days
oakhillsdentalcarebr.com oakhillsdentalcarebr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
fcdentalcarewaynesboro.com fcdentalcarewaynesboro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
papilliondentalcare.com papilliondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
parkplacedentalin.com parkplacedentalin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Dec 2017 Dec 2017 One Off
parkwaydentalcare.com parkwaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
UA UA-55336258 Nov 2017 Dec 2017 51 days
regalvalleydentalcare.com regalvalleydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 211 days
NR NR-DD11B77600 Feb 2017 Feb 2018 1 year, 1 day
plymouthmeetingfamilydental.com plymouthmeetingfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
quirtfamilydentistry-merrill.com quirtfamilydentistry-merrill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
quirtfamilydentistry-schofield.com quirtfamilydentistry-schofield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
rayviewdentalhealth.com rayviewdentalhealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
highlandilfamilydentistry.com highlandilfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
rollingridgedentalcare.com rollingridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
affordabledentistrybloomington.com affordabledentistrybloomington.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 299 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
alliancedentalgroup.com alliancedentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 292 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
smilesondelaware.com smilesondelaware.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
ashbyparkrestorative.com ashbyparkrestorative.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
UA UA-55336258 Aug 2018 Aug 2018 19 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
fcdentalcarechambersburg.com fcdentalcarechambersburg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 211 days
stmatthewsdental.com stmatthewsdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
adamsdentalcenter.com adamsdentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
UA UA-55336258 Nov 2017 Aug 2018 246 days
NR NR-DD11B77600 Sep 2017 Nov 2017 90 days
sunsetavenuedental.com sunsetavenuedental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
UA UA-55336258 Dec 2016 Dec 2017 1 year, 15 days
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2022 One Off
terrehautedental.com terrehautedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Feb 2018 1 year, 108 days
fortsmithsmiles.com fortsmithsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Feb 2018 1 year, 108 days
baldwinparkfamilydental.com baldwinparkfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 292 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
twinsburgdental.com twinsburgdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 316 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
unforgettablesmiles.com unforgettablesmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 286 days
blackmountaindentalcare.com blackmountaindentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 214 days
UA UA-117912474 Nov 2020 Jun 2021 235 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
villagegrovedentalcare.com villagegrovedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 219 days
UA UA-117912474 Dec 2020 Jul 2021 227 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 22 days
warfielddentalcenter.com warfielddentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
waterfordfamilydentistry.com waterfordfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
weatherfordcompletedental.com weatherfordcompletedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 303 days
NR NR-DD11B77600 May 2017 Mar 2018 308 days
UA UA-55336258 Nov 2017 Aug 2018 299 days
westfielddentalcenter.com westfielddentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Feb 2018 1 year, 108 days
wheatlandfamilydental.com wheatlandfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Jan 2017 Aug 2018 1 year, 233 days
brookschooldentalcare.com brookschooldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
woodlandfamilydentalcare.com woodlandfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
champaigndentalgroup.com champaigndentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 302 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
clairmontdentalassociates.com clairmontdentalassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2023 169 days
creekwooddental.com creekwooddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
denarodentalcare.com denarodentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
UA UA-117912474 Nov 2020 Jul 2021 248 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofhendersonville.com dentalcareofhendersonville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalcareofshelbyville.com dentalcareofshelbyville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalgroupspringfield.com dentalgroupspringfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
dentalpluslogansport.com dentalpluslogansport.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
familydentalonlouetta.com familydentalonlouetta.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2023 Jun 2024 201 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
familydentistryoflargo.com familydentistryoflargo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Oct 2022 One Off
edisonfamilydentalcare.com edisonfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 286 days
UA UA-117912474 Nov 2020 Jul 2021 252 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
essingtondental.com essingtondental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 330 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
foresidefamilydental.com foresidefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Sep 2017 Jun 2018 289 days
NR NR-DD11B77600 Jun 2017 Mar 2018 256 days
greatmillsfamilydental.com greatmillsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 211 days
greensburgdentalcare.com greensburgdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
independencedentalcare.com independencedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 351 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
redbirddental.com redbirddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 312 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
reflectiondentalwestend.com reflectiondentalwestend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jan 2017 Jun 2018 1 year, 151 days
NR NR-DD11B77600 Jan 2017 Feb 2018 1 year, 16 days
UA UA-22814484 Feb 2012 Feb 2012 One Off
dentalcareateldersburgcommons.com dentalcareateldersburgcommons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
romeovillesmilesdentistry.com romeovillesmilesdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
UA UA-55336258 Nov 2017 Aug 2018 300 days
NR NR-DD11B77600 Nov 2017 Feb 2018 90 days
eastsidegeneraldentistry.com eastsidegeneraldentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
lortondental.com lortondental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 342 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 308 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
advanceddentistryschaumburg.com advanceddentistryschaumburg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
arlingtonriverfamilydental.com arlingtonriverfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2023 118 days
schertzfamilydental.com schertzfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
marketsquaredentalcare.com marketsquaredentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 213 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
signaturesmilesbroadway.com signaturesmilesbroadway.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 225 days
UA UA-117912474 Nov 2020 May 2021 197 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesatlakewoodranch.com smilesatlakewoodranch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2017 Aug 2018 1 year, 211 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2023 336 days
andersonsmiles.com andersonsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
springhousefamilydentistry.com springhousefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 302 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
steelyarddentalcare.com steelyarddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 283 days
UA UA-117912474 May 2021 Jul 2021 63 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
streetsofstcharlesdental.com streetsofstcharlesdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
suffolkcompletedentalcare.com suffolkcompletedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 349 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
summitplazadentalcare.com summitplazadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 349 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 316 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
beardstownfamilydental.com beardstownfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
belltowerdentalcare.com belltowerdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 332 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 125 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
universityparkwaydental.com universityparkwaydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
valleyparkdentalcare.com valleyparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
valparaisodental.com valparaisodental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
bloomingtonindentist.com bloomingtonindentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 302 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
wearegentledentistry.com wearegentledentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
UA UA-55336258 Oct 2016 Feb 2018 1 year, 108 days
weatherfordorthodontist.net weatherfordorthodontist.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 303 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
westcapefamilydental.com westcapefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
cambyfamilydentistry.com cambyfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
caneridgedentist.com caneridgedentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
clermontendodontics.com clermontendodontics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
UA UA-55336258 Feb 2017 Jun 2018 1 year, 136 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
columbiaprodental.com columbiaprodental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
comfortablecarevenice.com comfortablecarevenice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
cookcrossingdentalcare.com cookcrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
cottonridgedentalcare.com cottonridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-117912474 Jan 2021 Jul 2021 183 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 110 days
crystallakedentalassociates.com crystallakedentalassociates.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
deercreekdental.com deercreekdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalassociateswaldenwoods.com dentalassociateswaldenwoods.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
dentalcareofboilingsprings.com dentalcareofboilingsprings.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalcareofgrafton.com dentalcareofgrafton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Jul 2017 Jun 2018 326 days
NR NR-DD11B77600 Jun 2017 Mar 2018 256 days
dentalcareofmanassas.com dentalcareofmanassas.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2023 248 days
dentalcareoneastmain.com dentalcareoneastmain.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
dentalgroupbloomington.com dentalgroupbloomington.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Dec 2016 Jun 2018 1 year, 189 days
dentalgroupbourbonnais.com dentalgroupbourbonnais.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
econriverfamilydental.com econriverfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Jun 2018 1 year, 189 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 89 days
GTM GTM-OPT-W4SQKXH Nov 2022 Dec 2022 38 days
familydentalcareonwashington.com familydentalcareonwashington.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Feb 2017 Apr 2018 1 year, 81 days
familydentistryatriversidecrossing.com familydentistryatriversidecrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
familydentistryatsouthwood.com familydentistryatsouthwood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
farabeefamilydentalcare.com farabeefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
fountainsquarefamilydental.com fountainsquarefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Feb 2012 One Off
UA UA-55336258 Mar 2018 Mar 2018 One Off
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
mydentistspringfield.com mydentistspringfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
harpethdentalcare.com harpethdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
landmarkfamilydentalcare.com landmarkfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 310 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
londondentalcenter.com londondentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 342 days
NR NR-DD11B77600 Jan 2017 Mar 2018 1 year, 50 days
UA UA-55336258 Mar 2017 Nov 2017 272 days
longcreekdentalcare.com longcreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 342 days
UA UA-55336258 May 2017 Aug 2018 1 year, 95 days
NR NR-DD11B77600 Mar 2017 Mar 2018 1 year, 6 days
manordentalny.com manordentalny.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Aug 2018 Aug 2018 23 days
marshfielddental.com marshfielddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Jan 2017 Mar 2018 1 year, 58 days
merrillvilledental.com merrillvilledental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Sep 2017 5 years, 204 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
mulberrycreekdentalcare.com mulberrycreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
NR NR-DD11B77600 Dec 2016 Dec 2017 1 year, 15 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 119 days
neibauerdentalbrandywine.com neibauerdentalbrandywine.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 211 days
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 186 days
neibauerdentalwoodbridge.com neibauerdentalwoodbridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
newmarkdentalcare.com newmarkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Mar 2018 1 year, 144 days
northauroradental.com northauroradental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2023 273 days
northgatefamilydental.com northgatefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
northgeorgiasmiles.com northgeorgiasmiles.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
GTM GTM-OPT-W4SQKXH Sep 2022 Dec 2023 1 year, 82 days
northmayfamilydental.com northmayfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Jun 2018 1 year, 189 days
oakmontdentalcare.com oakmontdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2023 287 days
NR NR-DD11B77600 Jul 2017 Mar 2018 226 days
UA UA-55336258 Nov 2017 Dec 2017 51 days
pavilioncrossingdentalcare.com pavilioncrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
plantcitydentistry.com plantcitydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
porterdentalcenter.com porterdentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
UA UA-55336258 May 2017 Feb 2018 272 days
prairieplacefamilydental.com prairieplacefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 240 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
raintreefamilydentalcare.com raintreefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
lincolndentalcenteril.com lincolndentalcenteril.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
sarasotacompletedental.com sarasotacompletedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Apr 2018 1 year, 134 days
aestheticdentalinnovationstx.com aestheticdentalinnovationstx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 112 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
seasonsfamilydentalcare.com seasonsfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Mar 2018 1 year, 144 days
smiledesigndentalcenter.com smiledesigndentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Sep 2017 5 years, 204 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
smilesoncalumet.com smilesoncalumet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
lifetimedentalwoodlands.com lifetimedentalwoodlands.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 211 days
NR NR-DD11B77600 Feb 2017 Dec 2017 327 days
andersonscdentists.com andersonscdentists.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 308 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
southbenddental.com southbenddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
springviewdentalcare.com springviewdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Jan 2017 Aug 2018 1 year, 225 days
stonelakefamilydentistry.com stonelakefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 315 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 314 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
abilenedental.com abilenedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 84 days
UA UA-55336258 Dec 2016 Dec 2016 One Off
suncreekfamilydentistry.com suncreekfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 349 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
tanyardspringsfamilydentistry.com tanyardspringsfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 348 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
thelakesdentalcare.com thelakesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
bartlettdentalassociates.com bartlettdentalassociates.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
bayarbordentalcare.com bayarbordentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
beltonfamilydentalcare.com beltonfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
veronadentalcare.com veronadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Jun 2018 1 year, 183 days
blackmanfamilydental.com blackmanfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Nov 2017 Aug 2018 247 days
bloomingtonsmilecenter.com bloomingtonsmilecenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Sep 2017 5 years, 204 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
whittakerroaddental.com whittakerroaddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
calcasieudentalcare.com calcasieudentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 256 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
canyonspringsfamilydental.com canyonspringsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
centerstreetfamilydentistry.com centerstreetfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
clairmontsmiles.com clairmontsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
UA UA-55336258 May 2017 Aug 2018 1 year, 92 days
NR NR-DD11B77600 Mar 2017 Nov 2017 246 days
comfortdentistsofplantation.com comfortdentistsofplantation.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 237 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
UA UA-55336258 Aug 2018 Aug 2018 One Off
completedentalofyork.com completedentalofyork.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
courseyfamilydental.com courseyfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
NR NR-DD11B77600 May 2017 Mar 2018 308 days
UA UA-55336258 Nov 2017 Aug 2018 275 days
crosspointfamilydental.com crosspointfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 276 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 245 days
deercreekfamilydentalcare.com deercreekfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
dentalcareatprairiecrossing.com dentalcareatprairiecrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Jan 2017 Aug 2018 1 year, 233 days
NR NR-DD11B77600 Jan 2017 Mar 2018 1 year, 58 days
dentalcareofanthemcrossroads.com dentalcareofanthemcrossroads.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-117912474 Nov 2020 Jul 2021 248 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 102 days
dentalcareofharrisburg.com dentalcareofharrisburg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalcareofhuntley.com dentalcareofhuntley.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
dentalcareoysterpoint.com dentalcareoysterpoint.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Jan 2017 Aug 2018 1 year, 233 days
dentistryplusclarksville.com dentistryplusclarksville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2023 331 days
dogwooddentalcarecarbondale.com dogwooddentalcarecarbondale.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Jun 2016 Mar 2018 1 year, 252 days
duckcreekfamilydental.com duckcreekfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
electriccitydentalcare.com electriccitydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 330 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Mar 2018 1 year, 144 days
fairviewdentalcolumbia.com fairviewdentalcolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 306 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
familydentalcarechampaign.com familydentalcarechampaign.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
familydentalcaresiouxcity.com familydentalcaresiouxcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2023 120 days
familydentalcaresouthbradenton.com familydentalcaresouthbradenton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
familydentistryofellisville.com familydentistryofellisville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
NR NR-DD11B77600 Jul 2016 Feb 2018 1 year, 202 days
UA UA-55336258 Feb 2017 Jun 2018 1 year, 136 days
geistdentalcare.com geistdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
gibsoniadentalcare.com gibsoniadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2017 Feb 2018 272 days
UA UA-55336258 Dec 2017 Aug 2018 249 days
greenstreetdentalcare.com greenstreetdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
greerfamilydentalcare.com greerfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 295 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
harrisonburgsmilemakers.com harrisonburgsmilemakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 223 days
heartlandcrossingdentalcare.com heartlandcrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
horizondentalcenter.com horizondentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 326 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
lakesidefamilydentistry.com lakesidefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 296 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
libertydentalcaremo.com libertydentalcaremo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
lifetimedentalatsanpedro.com lifetimedentalatsanpedro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Dec 2023 1 year, 64 days
UA UA-55336258 Apr 2018 Aug 2018 130 days
NR NR-DD11B77600 Nov 2017 Mar 2018 124 days
mapleridgedentalcare.com mapleridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2023 141 days
metroparkdentalarts.com metroparkdentalarts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
NR NR-DD11B77600 Jul 2017 Mar 2018 226 days
UA UA-55336258 Nov 2017 Apr 2018 170 days
monocacyriverdentalcare.com monocacyriverdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Dec 2017 Aug 2018 227 days
NR NR-DD11B77600 Sep 2017 Mar 2018 189 days
mydentistdurant.com mydentistdurant.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 119 days
mywildwooddentist.com mywildwooddentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
neibauerdentalculpeper.com neibauerdentalculpeper.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
nhdcsmiles.com nhdcsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
oakhillsfamilydental.com oakhillsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
oceanbaydentalcare.com oceanbaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
osceoladentalcare.com osceoladentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
parkwoodranchdentalcare.com parkwoodranchdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 227 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
planosmiledesign.com planosmiledesign.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 327 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
plumdrivedental.com plumdrivedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
GTM GTM-OPT-W4SQKXH Oct 2022 Oct 2022 One Off
quailhollowfamilydentistry.com quailhollowfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
quirtfamilydentistry-wausau.com quirtfamilydentistry-wausau.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
redrosefamilydental.com redrosefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
littlerockdentalcare.com littlerockdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 326 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
logmandental.com logmandental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
logmanndental.info logmanndental.info
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
mdcottagegrove.com mdcottagegrove.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 317 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mddowntownminneapolis.com mddowntownminneapolis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 324 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdelkriver.com mdelkriver.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 324 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdmaplewood.com mdmaplewood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 278 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mdshakopee.com mdshakopee.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 105 days
meadowsspringdentalcare.com meadowsspringdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 234 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mid-delcompletedentalcare.com mid-delcompletedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Jul 2016 Sep 2017 1 year, 49 days
midlothiandentist.com midlothiandentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 132 days
miradamarketdentalcare.com miradamarketdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 212 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
cdserviceslanden.com cdserviceslanden.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 120 days
cdservicesfairfield.com cdservicesfairfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 25 days
monroegadentist.com monroegadentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jan 2017 Feb 2017 31 days
UA UA-55336258 Jan 2017 Jan 2017 One Off
montvaledentalcenter.com montvaledentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Jan 2017 Jun 2018 1 year, 158 days
mountainpassdentalcare.com mountainpassdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 302 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mountainrangedentistry.com mountainrangedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 284 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mulberrycreekfamilydental.com mulberrycreekfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Apr 2018 Apr 2018 One Off
mvcannondds.com mvcannondds.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
UA UA-55336258 Oct 2016 Mar 2017 138 days
mydentistclaremore.com mydentistclaremore.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
mydentistincmuskogee.com mydentistincmuskogee.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Oct 2016 144 days
UA UA-55336258 Oct 2016 Oct 2016 One Off
mydentistsouthwestern.com mydentistsouthwestern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
mydentistwichitafalls.com mydentistwichitafalls.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
neibauerdentalfairfax.com neibauerdentalfairfax.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
centennialcompletedental.com centennialcompletedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 256 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofriverbend.com dentalcareofriverbend.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareoffuquayvarina.com dentalcareoffuquayvarina.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Jan 2024 1 year, 47 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatlittleriver.com dentalcareatlittleriver.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
nonaplacedentalcare.com nonaplacedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 322 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
dentalcareofbonaire.com dentalcareofbonaire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
darwinfamilydentalcare.com darwinfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
pdpcentralwestend.com pdpcentralwestend.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 286 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pdpsouthcountyfenton.com pdpsouthcountyfenton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 251 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
fdnewberlin.com fdnewberlin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
quirtfamilydentistry-wittenberg.com quirtfamilydentistry-wittenberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
redhawkdentalcare.com redhawkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 323 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
afiniadentaleastgate.com afiniadentaleastgate.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 86 days
abilenedental.net abilenedental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2016 Mar 2017 78 days
UA UA-55336258 Dec 2016 Mar 2017 78 days
ruppelorthodontics.com ruppelorthodontics.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
eastavenuedentalcare.com eastavenuedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 330 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 116 days
santacruzriverdental.com santacruzriverdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
afreshnewsmile.com afreshnewsmile.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Mar 2018 Mar 2018 One Off
affordabledentistrychampaign.com affordabledentistrychampaign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
armeniafamilydentalcare.com armeniafamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
devinedentistrysc.com devinedentistrysc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
embreymilldentalcare.com embreymilldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 330 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
arnolddentist.com arnolddentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
smilecda.com smilecda.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 283 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
antiochdentalcare.com antiochdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
southkiplingdentalcare.com southkiplingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 194 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
southpointecompletedental.com southpointecompletedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 236 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
statecollegedentistry.com statecollegedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
summerparkdentalcare.com summerparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 246 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
sunridgedentalcareoregon.com sunridgedentalcareoregon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 320 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
tamayadentalcare.com tamayadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 157 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
thedeerfieldbeachdentist.com thedeerfieldbeachdentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 83 days
UA UA-55336258 Dec 2017 Jun 2018 174 days
themurfreesborodentist.com themurfreesborodentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
badgerhillsdentalcare.com badgerhillsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 112 days
bakerfamilyaz.com bakerfamilyaz.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Oct 2016 Mar 2018 1 year, 133 days
UA UA-55336258 Dec 2017 Jun 2018 163 days
baldwinparkfamilydentistry.com baldwinparkfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
UA UA-55336258 Dec 2017 Dec 2017 One Off
thomasrogersdds.com thomasrogersdds.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
thomastondental.com thomastondental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 193 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
tigerdentistry.com tigerdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 299 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
banyandentalcarenaples.com banyandentalcarenaples.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH May 2023 Sep 2024 1 year, 111 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 111 days
timothyroaddentalcare.com timothyroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 262 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
todaysfamilydentalwaco.com todaysfamilydentalwaco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 318 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
toledofamilydentalcare.com toledofamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 161 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
baymeadowsjunctiondentalcare.com baymeadowsjunctiondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
baysidedentalcare.com baysidedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 292 days
NR NR-DD11B77600 Jun 2016 Mar 2018 1 year, 252 days
tropeadentalcare.com tropeadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 163 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
bernardrust.com bernardrust.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
bickfordfamilydentalcare.com bickfordfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
universitydrivedental.com universitydrivedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
bluebonnetdentalmillbrook.com bluebonnetdentalmillbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
bluebonnetdentalmontgomery.com bluebonnetdentalmontgomery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
boales.net boales.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
NR NR-DD11B77600 Oct 2016 Dec 2017 1 year, 72 days
brennandentalgroup.com brennandentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Apr 2018 Jun 2018 55 days
westhamptondentalcare.com westhamptondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 298 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
williamsdentistry.com williamsdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2017 Apr 2018 1 year, 71 days
NR NR-DD11B77600 Jan 2017 Mar 2018 1 year, 43 days
winghavendental.com winghavendental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
byrondentalcare.com byrondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Apr 2018 Apr 2018 One Off
carusbelton.com carusbelton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
your-smile-team.com your-smile-team.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Jul 2017 1 year, 62 days
cbctimaging.com cbctimaging.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Sep 2016 Mar 2018 1 year, 179 days
UA UA-55336258 Dec 2017 Feb 2018 38 days
cdofsebastian.com cdofsebastian.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
cedarfamilydentistry.com cedarfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 294 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
zietzdental.com zietzdental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
champaigninvisiblebraces.com champaigninvisiblebraces.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 137 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
chapelhillfamilydentistrywa.com chapelhillfamilydentistrywa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 255 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
chapelhillfcd.com chapelhillfcd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 192 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
chehalisdentalcare.com chehalisdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 293 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
colescountydental.com colescountydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Mar 2018 74 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
cosmeticdentistryforme.com cosmeticdentistryforme.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
crawfordfamilydentistry.com crawfordfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Jun 2018 1 year, 185 days
NR NR-DD11B77600 Dec 2016 Dec 2017 1 year, 10 days
crescentspringsdentist.com crescentspringsdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
croftondentalsuite.com croftondentalsuite.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
cypressdentalexcellence.com cypressdentalexcellence.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 51 days
ddsassociates.co ddsassociates.co
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2017 Mar 2018 227 days
UA UA-55336258 Aug 2017 Dec 2017 116 days
debarydenture.com debarydenture.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalartsofoliversprings.com dentalartsofoliversprings.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 198 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareataddisonplace.com dentalcareataddisonplace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
dentalcareatbelmont.com dentalcareatbelmont.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 223 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatcartwheelbay.com dentalcareatcartwheelbay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 46 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatcompasscreek.com dentalcareatcompasscreek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Aug 2024 1 year, 269 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatibis.com dentalcareatibis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatloughmancrossing.com dentalcareatloughmancrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 100 days
dentalcareatmillcreek.com dentalcareatmillcreek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
dentalcareatvillagewalk.com dentalcareatvillagewalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Aug 2024 1 year, 269 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcarelargo.com dentalcarelargo.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcareofclayton.com dentalcareofclayton.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Oct 2016 144 days
UA UA-55336258 Oct 2016 Oct 2016 One Off
dentalcareofelkhart.com dentalcareofelkhart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalcareofhamiltonoh.com dentalcareofhamiltonoh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
dentalcareoflehighvalley.com dentalcareoflehighvalley.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcareofminooka.com dentalcareofminooka.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 254 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofspringfield.com dentalcareofspringfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 304 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalcareofveteransparkway.com dentalcareofveteransparkway.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofvieraeast.com dentalcareofvieraeast.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofwaukesha.com dentalcareofwaukesha.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 198 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareonashleycircle.com dentalcareonashleycircle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentalexcellencewaterfordlakes.com dentalexcellencewaterfordlakes.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Nov 2017 Nov 2017 One Off
dentalgroupmtvernon.com dentalgroupmtvernon.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalplusmadison.com dentalplusmadison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
dentalvillageeastside.com dentalvillageeastside.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalvillagegreenvalley.com dentalvillagegreenvalley.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
dentalvillagenorthwest.com dentalvillagenorthwest.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Nov 2017 1 year, 45 days
dentisteasley.com dentisteasley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
dentistedmondoklahoma.com dentistedmondoklahoma.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistmiltonga.com dentistmiltonga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
desertdentalsolutions.com desertdentalsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
desertpointdental.com desertpointdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
desertsmilesdentistry.info desertsmilesdentistry.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
desertsmilesdentistry.net desertsmilesdentistry.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
dixonparkdentalcare.com dixonparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
drcalderone.com drcalderone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
drestwani.com drestwani.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
drneal.com drneal.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2016 Nov 2017 359 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
drstephenbuchanan.com drstephenbuchanan.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
UA UA-55336258 Dec 2017 Feb 2018 38 days
eastmaindentalpa.com eastmaindentalpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
eastmandentalassociates.com eastmandentalassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
elmoredentistry.com elmoredentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Apr 2018 1 year, 129 days
NR NR-DD11B77600 Dec 2016 Feb 2018 1 year, 48 days
fairchildoaksdentalcare.com fairchildoaksdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 290 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
fairviewsmilesbydesign.com fairviewsmilesbydesign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
fairwaterdental.com fairwaterdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
familydentalatlakesidevillage.com familydentalatlakesidevillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Mar 2018 99 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
familydentalcareofchampaign.com familydentalcareofchampaign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
familydentalcaresouthsheboygan.com familydentalcaresouthsheboygan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
familydentallancaster.com familydentallancaster.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
familydentistrypoplarbluff.com familydentistrypoplarbluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
familyoralhealth.com familyoralhealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 142 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 116 days
familyorthodonticsshawnee.com familyorthodonticsshawnee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 Dec 2016 281 days
NR NR-DD11B77600 May 2016 Oct 2016 144 days
farabeefamilydental.com farabeefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 223 days
farmingtondentalcarellc.com farmingtondentalcarellc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
fdbayshore.com fdbayshore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
fdbethesda.com fdbethesda.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 43 days
fdcolumbiaclarksville.com fdcolumbiaclarksville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 72 days
fdkenosha.com fdkenosha.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 115 days
fdmukwonago.com fdmukwonago.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 14 days
festusdentist.com festusdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
fosteringsmiles.com fosteringsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
friendlydentalcaremerrillville.com friendlydentalcaremerrillville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
gallatinfamilydental.com gallatinfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Nov 2017 One Off
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
georgiadentalcenter.com georgiadentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 170 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
getahealthysmile.mobi getahealthysmile.mobi
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Apr 2018 119 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
greenhillsdental.com greenhillsdental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
greenstreetsmiles.com greenstreetsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
happyvalleydental.com happyvalleydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
harborpointdentalcare.com harborpointdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 7 days
dorseyfamilydental.com dorseyfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 289 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
healthysmilesfamilydentistry.com healthysmilesfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Apr 2018 Apr 2018 One Off
hendersongalleriadental.com hendersongalleriadental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
hendersonvilledentalcare.com hendersonvilledentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
highlandavedentistrybc.com highlandavedentistrybc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 261 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
highlandildentist.com highlandildentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
indianlanddentalcare.com indianlanddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 221 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
jjjdds.com jjjdds.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
julingtoncreekdental.com julingtoncreekdental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
kennesawcompletedental.com kennesawcompletedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 170 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareattowncenter.com dentalcareattowncenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
mysmartdentalchoice.com mysmartdentalchoice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
kokosmile.com kokosmile.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
UA UA-55336258 Oct 2016 May 2017 201 days
lakewyliefamilydental.com lakewyliefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
legacydrivedental.com legacydrivedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Jan 2023 Sep 2024 1 year, 246 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 119 days
limelightdentalcare.com limelightdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 271 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
louisvillemetrodental.com louisvillemetrodental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 342 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 12 days
mdapplevalleycedar.com mdapplevalleycedar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 317 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdblainepheasantridge.com mdblainepheasantridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 317 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdbloomington.com mdbloomington.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 317 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdchanhassen.com mdchanhassen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 324 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdedina.com mdedina.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 317 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdlakeland.com mdlakeland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 324 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdlakevillecedar.com mdlakevillecedar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mdwoodbury.com mdwoodbury.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
dentalcareatthemark.com dentalcareatthemark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 68 days
merchantswaydentalcare.com merchantswaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 92 days
mesaridgedental.com mesaridgedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 233 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
metrodentalcareburnsville.com metrodentalcareburnsville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
GTM GTM-OPT-W4SQKXH Jul 2024 Jul 2024 One Off
fdfranklin.com fdfranklin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
cdofsuntree.com cdofsuntree.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
cdservicesedgewoodky.com cdservicesedgewoodky.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
mokenacrossingsfamilydental.com mokenacrossingsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
monocacydentalcare.com monocacydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
montgomeryplazadental.com montgomeryplazadental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 11 days
moultriedentalcare.com moultriedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 302 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mtsterlingsmiles.com mtsterlingsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 185 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
muncieplazadental.com muncieplazadental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
mydentistdenton.com mydentistdenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Mar 2018 36 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
mydentistkansascity.com mydentistkansascity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
mydentistmcalester.com mydentistmcalester.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
mydentistolathe.com mydentistolathe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
mydentistsheridan.com mydentistsheridan.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Nov 2017 1 year, 19 days
mydentistvanburen.com mydentistvanburen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
narcoosseedentalcare.com narcoosseedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 322 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
cdofindianharbourbeach.com cdofindianharbourbeach.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 53 days
danieladental.com danieladental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
highlandcitydentalcare.com highlandcitydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 317 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareonfennell.com dentalcareonfennell.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
northcolumbusdentalcare.com northcolumbusdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jun 2017 Mar 2018 256 days
UA UA-55336258 Nov 2017 Dec 2017 51 days
northranchdentalcare.com northranchdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
oakmeadowsvillagedental.com oakmeadowsvillagedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 187 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
okdsouthokc.com okdsouthokc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
oldtownkatydental.com oldtownkatydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 341 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
olytumwaterdentist.com olytumwaterdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
orthodontistinoklahomacity.com orthodontistinoklahomacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Nov 2017 1 year, 189 days
dentalcareatbabcockranch.com dentalcareatbabcockranch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 102 days
pdpwestcountyoliveblvd.com pdpwestcountyoliveblvd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 251 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pilotknobdentalcare.com pilotknobdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
plantationpointedental.com plantationpointedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 200 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
forestvilleroaddentalcare.com forestvilleroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 198 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatfoxbank.com dentalcareatfoxbank.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
rockrundental.com rockrundental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Jun 2018 1 year, 189 days
rollinghillsdentalcare.com rollinghillsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 May 2024 1 year, 168 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
areasontosmileboise.com areasontosmileboise.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 313 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
sandhilldentalcare.com sandhilldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 147 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
advancedtechnologydentistry.com advancedtechnologydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
UA UA-22814484 Feb 2012 Feb 2012 One Off
afiniadentalmason.com afiniadentalmason.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 86 days
affordabledentistryalton.com affordabledentistryalton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 299 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
affordabledentistrybelleville.com affordabledentistrybelleville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
affordabledentistryspringfield.com affordabledentistryspringfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
sdgaither.com sdgaither.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Apr 2018 1 year, 178 days
NR NR-DD11B77600 Oct 2016 Mar 2018 1 year, 133 days
secretcitydentalcare.com secretcitydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 194 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
arlingtonriverdentalcare.com arlingtonriverdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
UA UA-55336258 Apr 2018 Apr 2018 One Off
capitalavenuedentalcare.com capitalavenuedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 235 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
amberhillsfamilydental.com amberhillsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
smilejoplin.com smilejoplin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 320 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
smilesforlifeorlando.com smilesforlifeorlando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
softtouchdentistryco.com softtouchdentistryco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 283 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
southtexassmiles.com southtexassmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 301 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
springfielddentalcenter.com springfielddentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
springridgedental.com springridgedental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Mar 2018 Apr 2018 45 days
fortsmithdentist.com fortsmithdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 290 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
stcharleslifetimedental.com stcharleslifetimedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2017 Jun 2018 1 year, 136 days
NR NR-DD11B77600 Feb 2017 Mar 2018 1 year, 36 days
sterlingcreekdentalcare.com sterlingcreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 13 days
summerfielddentalcare.com summerfielddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 May 2024 1 year, 154 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
admiraldentalcare.com admiraldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 181 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
afiniadentalbridgetown.com afiniadentalbridgetown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 242 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
apalacheedentalcare.com apalacheedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Apr 2018 Jun 2018 55 days
teelparkwaydentalcare.com teelparkwaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Dec 2023 1 year, 42 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
audubondentalgroup.org audubondentalgroup.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 308 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
audubondentalgroupgermantown.com audubondentalgroupgermantown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jul 2017 Aug 2018 1 year, 36 days
NR NR-DD11B77600 Jun 2017 Mar 2018 256 days
tfdclintontownship.com tfdclintontownship.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 318 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
thedentalcentertx.com thedentalcentertx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 13 days
azimplantsedation.com azimplantsedation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Apr 2018 81 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
thomasvilleroaddental.com thomasvilleroaddental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
tillerydental.com tillerydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2017 261 days
UA UA-55336258 Feb 2017 Feb 2017 One Off
tillerydentalhattiesburg.com tillerydentalhattiesburg.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
tillerydentaltaylorsville.com tillerydentaltaylorsville.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
barracksroaddentalcare.com barracksroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 313 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
beach-dental.com beach-dental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 84 days
tramontodentistry.com tramontodentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Feb 2012 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
bellairebaydentalcare.com bellairebaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
bloomingdaledentalcarefl.com bloomingdaledentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 294 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
bluebonnetdentalhattiesburg.com bluebonnetdentalhattiesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
braseltondentist.com braseltondentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
wedgewoodsquaredental.com wedgewoodsquaredental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 219 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 24 days
briarwoodparkdentalcare.com briarwoodparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 256 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
bridgestonedentalcare.com bridgestonedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
westcolumbiafamilydentistry.com westcolumbiafamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 280 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
westgatedentalcare.com westgatedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Nov 2017 1 year, 45 days
westridgedentalcare.com westridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 193 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
broadstreetdc.com broadstreetdc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 192 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
buttermilkfamilyandcosmeticdentistry.com buttermilkfamilyandcosmeticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
calvertfamilydentalcare.com calvertfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Sep 2016 Mar 2018 1 year, 177 days
cartervilledentist.com cartervilledentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
carussouthcentral.com carussouthcentral.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 25 days
caruswestlake.com caruswestlake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
cdserviceseastgate.com cdserviceseastgate.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 25 days
cedarlakesdentalcare.com cedarlakesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
champaignsedationdentistry.com champaignsedationdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
chesapeakecompletedentistry.com chesapeakecompletedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jul 2017 Jun 2018 326 days
NR NR-DD11B77600 Jun 2017 Feb 2018 220 days
churchcreekdentalcare.com churchcreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 May 2024 1 year, 172 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
citysedgedentalcare.com citysedgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 111 days
clearlakecitydentistry.com clearlakecitydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 52 days
clearsmileday.com clearsmileday.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
clermontroyaloaksdental.com clermontroyaloaksdental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
colemandental.com colemandental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 233 days
NR NR-DD11B77600 Oct 2016 Dec 2017 1 year, 59 days
columbinedental.com columbinedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 192 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
completedentalcareatwestbird.com completedentalcareatwestbird.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 330 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
concordpointfamilydentistry.com concordpointfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 100 days
helenaroaddentalcare.com helenaroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 7 days
conwaysmilecenter.com conwaysmilecenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
copperheaddentalcare.com copperheaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
countrysidedental.com countrysidedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 238 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
crescenthilldentalcaredmd.com crescenthilldentalcaredmd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
danvillefamilydentalcare.com danvillefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Dec 2017 Dec 2017 One Off
dellagiodentalcare.com dellagiodentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcareatcaseykey.com dentalcareatcaseykey.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatcoventry.com dentalcareatcoventry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
dentalcareatfishhawkcommons.com dentalcareatfishhawkcommons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 223 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatlivingstonmarketplace.com dentalcareatlivingstonmarketplace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 311 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatoysterpoint.com dentalcareatoysterpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Apr 2018 81 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
dentalcareatpleasanthill.com dentalcareatpleasanthill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 44 days
dentalcareofcanandaigua.com dentalcareofcanandaigua.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2017 282 days
UA UA-55336258 Oct 2016 Feb 2017 108 days
dentalcareofconcordville.com dentalcareofconcordville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 294 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
dentalcareoflargo.com dentalcareoflargo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
dentalcareoflehighacres.com dentalcareoflehighacres.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
dentalcareofpowdersville.com dentalcareofpowdersville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
dentalcareonwatson.com dentalcareonwatson.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
dentalexcellencebaldwinpark.com dentalexcellencebaldwinpark.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalexcellencesandlake.com dentalexcellencesandlake.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalgroupchampaign.com dentalgroupchampaign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
dentalgroupwestside.com dentalgroupwestside.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
dentalvillage.net dentalvillage.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 May 2017 Nov 2017 183 days
dentist-in-norman.com dentist-in-norman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 May 2017 345 days
dentist-in-oklahoma-city.com dentist-in-oklahoma-city.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
dentistinfayettevillear.com dentistinfayettevillear.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
dentistinnorfolk.com dentistinnorfolk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Feb 2018 63 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
dentistrivercity.com dentistrivercity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistryatsmithvillemarketplace.com dentistryatsmithvillemarketplace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
dentistryplusburlington.com dentistryplusburlington.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
dentistwestminster.com dentistwestminster.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Dec 2017 Dec 2017 One Off
detwilerdental.com detwilerdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Feb 2018 63 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
familydentalcareofsouthsheboygan.com familydentalcareofsouthsheboygan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
familydentalcareofmaplelawn.com familydentalcareofmaplelawn.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
familydentalcareofstcharles.com familydentalcareofstcharles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Jun 2016 Feb 2018 1 year, 216 days
familydentalcareowasso.com familydentalcareowasso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
familydentallakeland.com familydentallakeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Dec 2017 One Off
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
familydentalofmaplelawn.com familydentalofmaplelawn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
distinctdentalsolutions.com distinctdentalsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
downtowndentaljax.com downtowndentaljax.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Apr 2024 Sep 2024 131 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
drakeshiredental.com drakeshiredental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
drbarrymanson.com drbarrymanson.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
drdanielswilliams.com drdanielswilliams.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
drjarvie.com drjarvie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 308 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
drjasonperio.com drjasonperio.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Nov 2017 1 year, 19 days
drnajafi.com drnajafi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
drpattondds.com drpattondds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
drrandalljones.com drrandalljones.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Dec 2017 Dec 2017 One Off
eastridgedentalcare.com eastridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 254 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
elmorefamilydentistry.com elmorefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
fairwaterdentalgroup.com fairwaterdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
fdcchampaign.com fdcchampaign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
fdreston.com fdreston.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 14 days
fdwaldorf.com fdwaldorf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 90 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
fdwestallis.com fdwestallis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
forumdentalstpeters.com forumdentalstpeters.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 43 days
fountainhillsdentistry.com fountainhillsdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 142 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
gaetaimplantdentistry.com gaetaimplantdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
UA UA-55336258 Nov 2017 Nov 2017 One Off
gatescosmeticdentistry.com gatescosmeticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
greenvillagedentalcare.com greenvillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 248 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
happyvalleyfamilydentistry.com happyvalleyfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
UA UA-55336258 Dec 2017 Dec 2017 One Off
hazelwoodfamilydentistry.com hazelwoodfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Nov 2017 1 year, 189 days
itsasmallworlddentistry.com itsasmallworlddentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
raytowndentalcaremo.com raytowndentalcaremo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
NR NR-DD11B77600 Jul 2017 Feb 2018 191 days
fultonfamilydentalcare.com fultonfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Apr 2024 1 year, 155 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
laurelviewdentistry.com laurelviewdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
UA UA-55336258 Jun 2018 Aug 2018 52 days
dentalcareatestrellacrossroads.com dentalcareatestrellacrossroads.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareonyellowbluff.com dentalcareonyellowbluff.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Mar 2023 Sep 2024 1 year, 163 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
sangredecristodentalcare.com sangredecristodentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 237 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
advanceddentalconcept.com advanceddentalconcept.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 315 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
sandalwooddentalcarefl.com sandalwooddentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 284 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
adcstreetsboro.com adcstreetsboro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 139 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
savannahquartersdentalcare.com savannahquartersdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 161 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
afiniadentalwestchester.com afiniadentalwestchester.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 40 days
affordabledentistrytoday.com affordabledentistrytoday.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2017 Mar 2018 74 days
affordabledentistrywestmain.com affordabledentistrywestmain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Apr 2018 One Off
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
affordabledentistrytampa.com affordabledentistrytampa.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Dec 2017 Dec 2017 One Off
fdeldersburgsykesville.com fdeldersburgsykesville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 14 days
altamontespringsfamilydentistry.com altamontespringsfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
sheramdentistry.com sheramdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
smokyhilldental.com smokyhilldental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 249 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
mayrivercrossingdental.com mayrivercrossingdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 12 days
mdrichfield.com mdrichfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 119 days
southwoodsdental.com southwoodsdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Feb 2012 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
southfarmdental.com southfarmdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Jun 2016 Jun 2016 One Off
southleesburgdentalcare.com southleesburgdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 236 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
southwesternfamilydental.com southwesternfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jun 2017 Sep 2017 67 days
UA UA-55336258 Sep 2017 Sep 2017 One Off
springfieldcompletedentistry.com springfieldcompletedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Mar 2018 1 year, 144 days
springfielddental.com springfielddental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Jun 2018 1 year, 193 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 93 days
adamsdairyfamilydental.com adamsdairyfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Apr 2018 Apr 2018 One Off
summerlinfamilydental.com summerlinfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Oct 2016 Feb 2018 1 year, 97 days
UA UA-55336258 Oct 2016 Oct 2016 One Off
atlantagentledental.com atlantagentledental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
terracinadentalcare.com terracinadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 337 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
tfdbinghamfarms.com tfdbinghamfarms.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 One Off
tfdwarren.com tfdwarren.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 318 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
thedentistplaceorlando.com thedentistplaceorlando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
theranchdentalcare.com theranchdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 338 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
todaysdentistryjax.com todaysdentistryjax.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 233 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
mdosseo.com mdosseo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 105 days
beachsidefamilydentalcare.com beachsidefamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 84 days
towncenterfamilydentist.com towncenterfamilydentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Feb 2017 Aug 2018 1 year, 211 days
beautifulsmilesjacksonville.com beautifulsmilesjacksonville.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
beckcommonsdentalcare.com beckcommonsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Dec 2016 55 days
trailridgedentalcare.com trailridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Apr 2024 Jul 2024 106 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
trailwindsdentalcare.com trailwindsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 318 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
berrygooddental.com berrygooddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 3 days
tumwaterfamilydentistry.com tumwaterfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 299 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
bigbenddentalcare.com bigbenddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 111 days
bluebonnetdentalcare.com bluebonnetdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
bluebonnetdentalgretna.com bluebonnetdentalgretna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 302 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
bluebonnetdentallafayette.com bluebonnetdentallafayette.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
bluebonnetdentalnatchez.com bluebonnetdentalnatchez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
waldorforthodontics.com waldorforthodontics.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
waterfordcenterfamilydentistry.com waterfordcenterfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
waterviewtowndentalcare.com waterviewtowndentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 244 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 24 days
bourbonnaisdentist.com bourbonnaisdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Apr 2018 144 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
bowlinggreendentist.com bowlinggreendentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Apr 2018 Apr 2018 One Off
braseltondentalcare.com braseltondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
brazosfamilydentistry.com brazosfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 124 days
westalamodentalcare.com westalamodentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Dec 2023 1 year, 86 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
westsidedentalcareokc.com westsidedentalcareokc.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
westvillagesdentalcare.com westvillagesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Dec 2023 1 year, 86 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
whispercreekdentalcare.com whispercreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Jun 2024 1 year, 219 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
wildernessdentalcare.com wildernessdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 297 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
windermerevillagedentalcare.com windermerevillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 15 days
buttermilkdentistry.com buttermilkdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 293 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
cambydentist.com cambydentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
cantonsedationdentistry.com cantonsedationdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Apr 2018 119 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
carnesdental.com carnesdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
caruskingwood.com caruskingwood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
carussalado.com carussalado.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
cdocalasouthwest.com cdocalasouthwest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 53 days
cdservicesmilford.com cdservicesmilford.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 293 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
centerforcosmeticandfamilydentistry.com centerforcosmeticandfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 294 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
centerplacedentalcare.com centerplacedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 192 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
centralavenuedentalcare.com centralavenuedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
GTM GTM-OPT-W4SQKXH May 2024 Aug 2024 98 days
cherrycreekdentalcare.com cherrycreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 293 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
colonialdrivefamilydentistry.com colonialdrivefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Jun 2018 1 year, 189 days
coltoncompletedental.com coltoncompletedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 293 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
comfortablecare.com comfortablecare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
completedentalcareeasley.com completedentalcareeasley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
completedentalcareofeasley.com completedentalcareofeasley.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
completedentalofcountryside.com completedentalofcountryside.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 225 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
cornerlakedentalcare.com cornerlakedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
crescentparkdentalcare.com crescentparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 224 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
crosswaterfamilydental.com crosswaterfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
debarydentalstudio.com debarydentalstudio.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcareatbarrowcrossing.com dentalcareatbarrowcrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatberewick.com dentalcareatberewick.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Jul 2024 1 year, 234 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatbrushprairie.com dentalcareatbrushprairie.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Apr 2024 1 year, 156 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatchampionscrossing.com dentalcareatchampionscrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 311 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareateaglelanding.com dentalcareateaglelanding.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatharriscrossing.com dentalcareatharriscrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 117 days
dentalcareatlakemoorcommons.com dentalcareatlakemoorcommons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 254 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatmonumentridge.com dentalcareatmonumentridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 198 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatnapleslakes.com dentalcareatnapleslakes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 117 days
dentalcareatprestonlegacy.com dentalcareatprestonlegacy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
dentalcareatrosecreek.com dentalcareatrosecreek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Feb 2024 1 year, 82 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatsouthcommons.com dentalcareatsouthcommons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Jun 2023 Sep 2024 1 year, 74 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 102 days
dentalcareatverona.com dentalcareatverona.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatwhiteeaglefl.com dentalcareatwhiteeaglefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofcanby.com dentalcareofcanby.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofeaglevalley.com dentalcareofeaglevalley.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 44 days
dentalcareofhoover.com dentalcareofhoover.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentalcareofminneola.com dentalcareofminneola.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 May 2024 1 year, 181 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofraymore.com dentalcareofraymore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentalcareofsanford.com dentalcareofsanford.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 223 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareoncookingham.com dentalcareoncookingham.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
dentalcareonnorthavenue.com dentalcareonnorthavenue.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 311 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareonmacon.com dentalcareonmacon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareonparkside.com dentalcareonparkside.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 198 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentaldesignsoflasvegas.com dentaldesignsoflasvegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Apr 2018 119 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
dentaldownloads.com dentaldownloads.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Feb 2018 Feb 2018 One Off
dentalvillageorovalley.com dentalvillageorovalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
dentalvillagesouthwest.com dentalvillagesouthwest.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
dentistcanton.com dentistcanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
dentistmanassas.com dentistmanassas.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistoswego.com dentistoswego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Apr 2018 144 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
dentistrybydesignchampaign.com dentistrybydesignchampaign.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistwiregrass.com dentistwiregrass.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
durbincreekdentalcare.com durbincreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 141 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
eagleslandingdentalcare.com eagleslandingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
eaststatedental.com eaststatedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
evansvillefamilydentistry.com evansvillefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
falconpointdental.com falconpointdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jan 2017 Mar 2018 1 year, 50 days
NR NR-DD11B77600 Jan 2017 Mar 2018 1 year, 50 days
familydentalatwildlight.com familydentalatwildlight.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 90 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalcanton.com familydentalcanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
familydentalcaremaplelawn.com familydentalcaremaplelawn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
familydentallakesidevillage.com familydentallakesidevillage.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Mar 2018 Mar 2018 One Off
familydentalofpowell.com familydentalofpowell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
familydentalofshawnee.com familydentalofshawnee.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Mar 2018 Mar 2018 One Off
familydentistryforme.com familydentistryforme.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
familydentistryonfreedom.com familydentistryonfreedom.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 82 days
familyorthodonticsofolathe.com familyorthodonticsofolathe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
farmingtondentalcentre.com farmingtondentalcentre.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Oct 2016 Nov 2017 1 year, 19 days
fcdentalcare.com fcdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Nov 2017 1 year, 19 days
fdhalescorners.com fdhalescorners.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 287 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
flowerscrossroadsdental.com flowerscrossroadsdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
floydsknobsdentist.com floydsknobsdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
fortworthsmilestudio.com fortworthsmilestudio.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 114 days
foxwooddentalcare.com foxwooddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 77 days
gahannadentalcare.com gahannadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
garyefinchdds.com garyefinchdds.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Apr 2018 Jun 2018 56 days
garynsteen.com garynsteen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Dec 2017 One Off
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
genejacobsdds.com genejacobsdds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 200 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
germantowndentalcare.com germantowndentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 170 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
getstraighterteeth.com getstraighterteeth.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Sep 2017 320 days
gildercreekdentalcare.com gildercreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 53 days
glencarbondental.com glencarbondental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
glencarbondentist.com glencarbondentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Feb 2018 63 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
greatsouthernsmiles.net greatsouthernsmiles.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 175 days
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
greatsouthernsmiles.org greatsouthernsmiles.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
greenmountdentalcare.com greenmountdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 200 days
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
mirrorterracedentalcare.com mirrorterracedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 303 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hallscrossroadsdentalcare.com hallscrossroadsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 172 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hamptonlakedentalcare.com hamptonlakedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 262 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hanfieldvillagedentalcare.com hanfieldvillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 225 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
happyvalleydentistry.net happyvalleydentistry.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 49 days
NR NR-DD11B77600 May 2016 May 2016 One Off
healthysmilecare.com healthysmilecare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
heartlandfamilydental.com heartlandfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
hickorycommonsdentalcare.com hickorycommonsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 172 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
highpointedentalcare.com highpointedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 121 days
huesdentalgroup.com huesdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 297 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
jeffreysorensendds.com jeffreysorensendds.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 349 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 13 days
kathleendentalcare.com kathleendentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 311 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
kingsoakdentalcare.com kingsoakdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakesidedentalcenter.com lakesidedentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 169 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
laketexomasmiles.com laketexomasmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Feb 2023 Apr 2024 1 year, 72 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakewyliedentalcare.com lakewyliedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Apr 2018 Jun 2018 56 days
laneanderiksdental.com laneanderiksdental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
UA UA-55336258 Feb 2018 Feb 2018 One Off
ledgestonedentalcare.com ledgestonedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 106 days
lemontreedentalcanyongolf.com lemontreedentalcanyongolf.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
marinervillagedentalcare.com marinervillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 315 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdeaganwest.com mdeaganwest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mdlakevilleidealic.com mdlakevilleidealic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 132 days
mdmaplegrovegrovecircle.com mdmaplegrovegrovecircle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mdwayzata.com mdwayzata.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
montgomeryfamilydentalcare.com montgomeryfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
morrisildentist.com morrisildentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
morrisonfamilydental.com morrisonfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
mosaicdentalmn.com mosaicdentalmn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 52 days
mydentistmustang.com mydentistmustang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Oct 2016 144 days
mydentistnorthmay.com mydentistnorthmay.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
mydentistokc.com mydentistokc.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
UA UA-55336258 Oct 2016 Jul 2017 283 days
mydentiststillwater.com mydentiststillwater.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Feb 2018 Feb 2018 One Off
mydentistweatherfordok.com mydentistweatherfordok.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
neibauerdental.com neibauerdental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-22814484 Oct 2014 Oct 2014 One Off
neibauerdentalcentreville.com neibauerdentalcentreville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
northhilldentistry.com northhilldentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
okddelcity.com okddelcity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 303 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
okdyukon.com okdyukon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 285 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
pdpofallon.com pdpofallon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 304 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pdpstcharles.com pdpstcharles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 239 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pdpwentzville.com pdpwentzville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 251 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
poplartreedentalcare.com poplartreedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 342 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
quiviradentalcare.com quiviradentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
NR NR-DD11B77600 Oct 2016 Mar 2018 1 year, 144 days
riverbendvillagedentalcare.com riverbendvillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 226 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
rivercrossingdentalcare.com rivercrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 322 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
rothdentistry.com rothdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
rousseaufd.com rousseaufd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Feb 2018 64 days
sardisdentalcare.com sardisdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
affordabledentistrynorthhershey.com affordabledentistrynorthhershey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
affordabledentistrypeoria.com affordabledentistrypeoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
affordabledentistrystcharles.com affordabledentistrystcharles.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
sdgaither.info sdgaither.info
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Feb 2018 Feb 2018 One Off
seahavendentalcare.com seahavendentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 225 days
GTM GTM-5MGLNPZ Sep 2024 Sep 2024 6 days
altamontdentist.com altamontdentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Apr 2018 Apr 2018 One Off
altamontedentistry.com altamontedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
UA UA-55336258 Apr 2018 Apr 2018 One Off
allaspectsdental.com allaspectsdental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Aug 2018 1 year, 264 days
alexandriadental.com alexandriadental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
UA UA-55336258 Apr 2018 Apr 2018 One Off
sierrafamilydentistry.com sierrafamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Oct 2016 Mar 2018 1 year, 133 days
UA UA-55336258 Oct 2016 Feb 2017 106 days
ashtonfamilydentistry.com ashtonfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
UA UA-55336258 Dec 2017 Dec 2017 One Off
smilesplusburlington.com smilesplusburlington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
somerdentalcare.com somerdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Dec 2016 Jun 2018 1 year, 189 days
southernwoodsdentalcare.com southernwoodsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
aspenviewdental.com aspenviewdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 186 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
awinningsmileflorida.com awinningsmileflorida.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jan 2017 Feb 2018 1 year, 14 days
UA UA-55336258 Dec 2017 Apr 2018 119 days
springwoodsmarketdentalcare.com springwoodsmarketdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 249 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
carusgeorgetownwildwood.com carusgeorgetownwildwood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 25 days
stewartcreekdentalcare.com stewartcreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 249 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
stowepointdentalcare.com stowepointdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 224 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
sundomecrossingdentalcare.com sundomecrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 349 days
UA UA-117912474 Nov 2020 Jul 2021 264 days
afdcollierville.com afdcollierville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 55 days
afdkingstonpike.com afdkingstonpike.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 58 days
afdmountaingrove.com afdmountaingrove.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 16 days
applevalleyfamilydentistrymn.com applevalleyfamilydentistrymn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 97 days
tampabaydentist.com tampabaydentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Sep 2017 1 year, 99 days
UA UA-55336258 Oct 2016 Jun 2017 255 days
archdentalofmanhattan.com archdentalofmanhattan.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 30 days
taylorsvilledentalcarems.com taylorsvilledentalcarems.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2017 Jun 2018 1 year, 136 days
NR NR-DD11B77600 Feb 2017 Feb 2018 1 year
tfdtemperance.com tfdtemperance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2024 1 year, 158 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
thdentistry.com thdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
avilesdentalcare.com avilesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 229 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
thedentistofcolorado.com thedentistofcolorado.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 193 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 11 days
bakerroaddentalcare.com bakerroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 188 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
toddleikerdds.com toddleikerdds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Oct 2016 Mar 2018 1 year, 144 days
bayarbordental.com bayarbordental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
towncenterdentistry.com towncenterdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 318 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
townecentredentalcare.com townecentredentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Dec 2017 1 year, 70 days
beaconhillfamilydentistry.com beaconhillfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
bearcanyonfamilydentistry.com bearcanyonfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
beavercreekcommonsdental.com beavercreekcommonsdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 96 days
bedfordavenuedentistry.com bedfordavenuedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
bernwoodparkdentalcare.com bernwoodparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 125 days
bigbendsquaredentalcenter.com bigbendsquaredentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 292 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
bluebonnetdentalcarecoursey.com bluebonnetdentalcarecoursey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Jul 2016 Dec 2017 1 year, 164 days
bluebonnetdentalmandeville.com bluebonnetdentalmandeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
bluebonnetdentalslidell.com bluebonnetdentalslidell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 302 days
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
washingtonfamilydental.com washingtonfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Jun 2018 1 year, 184 days
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 84 days
breakfastpointdentalcare.com breakfastpointdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 3 days
westbeachesdentalcare.com westbeachesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 4 days
wildrosedentalcare.com wildrosedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 260 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
brookercreekdentalgroup.com brookercreekdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
brownstowndentalcare.com brownstowndentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 318 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
wolfcreekdental.com wolfcreekdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
UA UA-55336258 Jun 2018 Aug 2018 75 days
calderonedental.com calderonedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
cannoncrossroadsdentalcare.com cannoncrossroadsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
canoecreekdentalcare.com canoecreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
capegirardeaudentalcare.com capegirardeaudentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 111 days
cdservicesflorenceky.com cdservicesflorenceky.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
centerstreetdental.com centerstreetdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
fdracine.com fdracine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
citrusfallsdentalcare.com citrusfallsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 293 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
coalmountaindentalcare.com coalmountaindentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 89 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
coddlecreekdentalcare.com coddlecreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 118 days
columbuspikedentalcare.com columbuspikedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
comfortablecarebradenton.com comfortablecarebradenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Feb 2012 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
completedentalofeducationhill.com completedentalofeducationhill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Jul 2024 1 year, 231 days
GTM GTM-5MGLNPZ Sep 2024 Nov 2024 57 days
comprehensivedentalcarefl.com comprehensivedentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 52 days
concoursedentalcare.com concoursedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 224 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
connertondentalcare.com connertondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
coolidgecourtdentalcare.com coolidgecourtdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
coolspringscosmeticdentalcare.com coolspringscosmeticdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
coolspringsdentalcare.com coolspringsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
creekwooddentalbradenton.com creekwooddentalbradenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jan 2017 Jun 2018 1 year, 152 days
NR NR-DD11B77600 Jan 2017 Mar 2018 1 year, 52 days
crosswaterparkwaydental.com crosswaterparkwaydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
crosswindsdentalcare.com crosswindsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
debarydentalcares.com debarydentalcares.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jun 2017 Feb 2018 220 days
UA UA-55336258 Feb 2018 Feb 2018 One Off
debarysmiles.com debarysmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Feb 2018 One Off
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
dellagiodental.com dellagiodental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
UA UA-55336258 Dec 2017 Feb 2018 38 days
denhamspringsdentalcarela.com denhamspringsdentalcarela.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
dentalartsofaurora.com dentalartsofaurora.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 140 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalartsofminneapolis.com dentalartsofminneapolis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
dentalassociateplantcity.com dentalassociateplantcity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
UA UA-55336258 Apr 2018 Jun 2018 55 days
dentalcareatcollegestation.com dentalcareatcollegestation.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatcrosspointe.com dentalcareatcrosspointe.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatgatewaycommons.com dentalcareatgatewaycommons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 311 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatgrandeoak.com dentalcareatgrandeoak.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-55336258 Aug 2018 Aug 2018 One Off
dentalcareatlandstarcommons.com dentalcareatlandstarcommons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentalcareatmagnoliaplaza.com dentalcareatmagnoliaplaza.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 223 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatmarleysquare.com dentalcareatmarleysquare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 311 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatmullinscolony.com dentalcareatmullinscolony.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 44 days
dentalcareatpalladium.com dentalcareatpalladium.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatprettypond.com dentalcareatprettypond.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatquailhollow.com dentalcareatquailhollow.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatsummerfieldcrossing.com dentalcareatsummerfieldcrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareattecheridge.com dentalcareattecheridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 83 days
dentalcareattumbleweedpass.com dentalcareattumbleweedpass.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
UA UA-117912474 Nov 2020 Jul 2021 248 days
dentalcareatverandah.com dentalcareatverandah.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 68 days
dentalcaregroup.com dentalcaregroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
dentalcareofbrooklynpark.com dentalcareofbrooklynpark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 15 days
dentalcareoffayetteville.com dentalcareoffayetteville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2017 Aug 2018 1 year, 186 days
NR NR-DD11B77600 Feb 2017 Mar 2018 1 year, 36 days
dentalcareofpalmcoast.com dentalcareofpalmcoast.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
dentalcareofpatchogue.com dentalcareofpatchogue.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 102 days
dentalcareofsherrillsford.com dentalcareofsherrillsford.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 211 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofwendellfalls.com dentalcareofwendellfalls.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 117 days
dentalcareofwinchester.com dentalcareofwinchester.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
dentalcareonparkview.com dentalcareonparkview.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentaldesignsofglenburnie.com dentaldesignsofglenburnie.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 95 days
dentalplusclarksville.com dentalplusclarksville.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
UA UA-55336258 Dec 2017 Feb 2018 38 days
dentalpluslexington.com dentalpluslexington.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
UA UA-55336258 Nov 2017 Nov 2017 One Off
dentalvillagecentral.com dentalvillagecentral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Mar 2017 282 days
dentalvillagemarana.com dentalvillagemarana.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Nov 2017 Jun 2018 199 days
dentist-in-kansas-city.com dentist-in-kansas-city.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
dentistbraselton.com dentistbraselton.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
UA UA-55336258 Feb 2018 Feb 2018 One Off
dentistdebary.com dentistdebary.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
dentistenidok.com dentistenidok.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Apr 2018 Apr 2018 One Off
dentistinmerrillville.com dentistinmerrillville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
dentistofmaryland.com dentistofmaryland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Mar 2018 One Off
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
dentistparkland.com dentistparkland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Apr 2018 144 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
dentistryplusfranklin.com dentistryplusfranklin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Jun 2018 100 days
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
dentistsclearwater.com dentistsclearwater.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Dec 2017 Dec 2017 One Off
drycreekdentalcare.com drycreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 272 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
durrdentistry.com durrdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
UA UA-55336258 Apr 2018 Apr 2018 One Off
eastaltondentist.com eastaltondentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
UA UA-55336258 Dec 2017 Feb 2018 38 days
elandentallasvegas.com elandentallasvegas.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Jul 2017 283 days
ellisvilledentist.com ellisvilledentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
exquisitedentalcareoh.com exquisitedentalcareoh.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 141 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalatdublinheights.com familydentalatdublinheights.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 253 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalcarefitchburg.com familydentalcarefitchburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Apr 2018 144 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
familydentalspringhill.com familydentalspringhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
familydentistryyukon.com familydentistryyukon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
fdashburn.com fdashburn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 72 days
fdoakcreek.com fdoakcreek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 14 days
ivycreekdentalcare.com ivycreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Dec 2023 1 year, 91 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
gaetadental.com gaetadental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
gattisschoolroaddental.com gattisschoolroaddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 290 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
greatoaksdentalcare.com greatoaksdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 317 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
grovelanddentalcare.com grovelanddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 248 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
gumspringsdentalcare.com gumspringsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 318 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hammockgardensdentalcare.com hammockgardensdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 318 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hartlanddental.com hartlanddental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
healthybrightsmiles.com healthybrightsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
heathbrookdentalcare.com heathbrookdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
heritagedental.com heritagedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2023 1 year, 60 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
herowaydentalcare.com herowaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 233 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hershellgenesteeledds.com hershellgenesteeledds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 233 days
NR NR-DD11B77600 Oct 2016 Mar 2018 1 year, 133 days
howardshapirodds.com howardshapirodds.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
hunterscreekdentalcare.com hunterscreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Mar 2018 74 days
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
imperiallakesdentalcare.com imperiallakesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 315 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
inoralsurgery.com inoralsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Dec 2016 199 days
UA UA-55336258 Oct 2016 Dec 2016 55 days
mcalesterlifetimedentistry.com mcalesterlifetimedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 105 days
jesekseminars.com jesekseminars.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
UA UA-55336258 Mar 2018 Mar 2018 One Off
joplinmigraineheadacheandfacialpain.com joplinmigraineheadacheandfacialpain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Jun 2018 174 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
juelsdentalgroup.com juelsdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Jul 2016 Jul 2016 One Off
lakeavenueco.com lakeavenueco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 239 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakehancockdentalcare.com lakehancockdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 328 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakejesupdentalcare.com lakejesupdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 133 days
lakeridgedc.com lakeridgedc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2023 Sep 2024 334 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
lakeviewpointedentistry.com lakeviewpointedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 238 days
UA UA-55336258 Mar 2017 Aug 2018 1 year, 158 days
miramarparkwaydentalcare.com miramarparkwaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2024 1 year, 189 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
logmanndental.com logmanndental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
UA UA-55336258 Jun 2018 Jun 2018 One Off
longcreekdentalcareil.com longcreekdentalcareil.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2017 Mar 2018 1 year, 36 days
UA UA-55336258 Feb 2017 Nov 2017 302 days
loxahatcheedentalcare.com loxahatcheedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Apr 2024 1 year, 188 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mainstreetdentalnh.com mainstreetdentalnh.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Sep 2016 Mar 2018 1 year, 179 days
UA UA-55336258 Jan 2017 Jan 2017 One Off
mansfield-dentalcare.com mansfield-dentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 292 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 92 days
mdalbertville.com mdalbertville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 317 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdapplevalleyflorencetrail.com mdapplevalleyflorencetrail.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mdbrooklyncenter.com mdbrooklyncenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 132 days
mdchaska.com mdchaska.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 286 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdcoonrapids.com mdcoonrapids.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mdedenprairie.com mdedenprairie.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 324 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mdmaplegrovebasslake.com mdmaplegrovebasslake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 98 days
mdsouthminneapolis.com mdsouthminneapolis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
GTM GTM-5MGLNPZ Oct 2024 Oct 2024 21 days
michaelmannddsandassociates.com michaelmannddsandassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Jun 2018 199 days
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
midtowndentaltn.com midtowndentaltn.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Feb 2018 Apr 2018 81 days
mountainlaureldentalcare.com mountainlaureldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 69 days
mountainridgedentalcare.com mountainridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 250 days
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mydentistcasady.com mydentistcasady.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Oct 2016 144 days
mydentistharvard.com mydentistharvard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 Sep 2016 Sep 2017 353 days
mydentistquivira.com mydentistquivira.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Oct 2016 144 days
mydentistraytown.com mydentistraytown.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
mydentistrogers.com mydentistrogers.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
mydentisttexarkana.com mydentisttexarkana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
mymaplelawndentist.com mymaplelawndentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
northauroradentistaespanol.com northauroradentistaespanol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
NR NR-DD11B77600 Nov 2017 Mar 2018 125 days
northwashingtondental.com northwashingtondental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 187 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
northwestkentuckydentalcentre.com northwestkentuckydentalcentre.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
UA UA-55336258 Oct 2016 Apr 2018 1 year, 189 days
ofallonmodentistry.com ofallonmodentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Nov 2017 1 year, 189 days
palmharbordentists.com palmharbordentists.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Feb 2018 63 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
palmvalleydentistry.com palmvalleydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 312 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
pdpdowntown.com pdpdowntown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 251 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pdpnorthcounty.com pdpnorthcounty.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2024 1 year, 286 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pdpwestcountyoldballas.com pdpwestcountyoldballas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 239 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pecangrovefamilydentist.com pecangrovefamilydentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 319 days
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
pointhopedentalcaresc.com pointhopedentalcaresc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2024 1 year, 252 days
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
pontevedradental.com pontevedradental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
UA UA-55336258 Nov 2017 Nov 2017 One Off
prairiecrossingfamilydental.com prairiecrossingfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Feb 2018 Jun 2018 136 days
NR NR-DD11B77600 Nov 2017 Feb 2018 63 days
radiance-dental.com radiance-dental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2018 1 year, 244 days
NR NR-DD11B77600 May 2016 Dec 2017 1 year, 214 days
ranaorthodontics.com ranaorthodontics.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
UA UA-55336258 Oct 2016 Nov 2017 1 year, 19 days
raytbollindds.com raytbollindds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
reflectiondentallorton.com reflectiondentallorton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Aug 2018 1 year, 312 days
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 253 days
regalvalleydental.com regalvalleydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
UA UA-55336258 Jun 2018 Jun 2018 One Off
lakestlouisdentalcare.com lakestlouisdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 71 days
largodental.com largodental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
hickorytreedentalcare.com hickorytreedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
forumdentallaurie.com forumdentallaurie.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
libertytownshipdentist.com libertytownshipdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
yodlesecure.com littleriverfamilydental-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jun 2016 Dec 2016 197 days
mdburnsvilleridges.com mdburnsvilleridges.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 May 2024 1 year, 234 days
mdramseysunwood.com mdramseysunwood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
mdscmaplegroveendodontics.com mdscmaplegroveendodontics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 286 days
mdscmaplegroveoralsurgery.com mdscmaplegroveoralsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 286 days
mdscrichfieldperiodontics.com mdscrichfieldperiodontics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 305 days
mdstpaulmidway.com mdstpaulmidway.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
milansedationdentist.com milansedationdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
mustangorthodontics.com mustangorthodontics.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Feb 2018 1 year, 252 days
mvcannon-dds.net mvcannon-dds.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mydentistincmidtown.com mydentistincmidtown.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mydentistincweatherford.com mydentistincweatherford.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mydentistincwichitafalls.com mydentistincwichitafalls.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mywhiteflintdentist.com mywhiteflintdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
neibauerdentalcare.net neibauerdentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
neibauerdentalgainesville.com neibauerdentalgainesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
neibauerdentalgreatmills.com neibauerdentalgreatmills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
neibauerdentalwarrenton.com neibauerdentalwarrenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
neshannockdental.com neshannockdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
newvalleydental.com newvalleydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
nineeaglesdentalcare.com nineeaglesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
lakeridgedentalcareva.com lakeridgedentalcareva.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
dentalcareatlelandtowncenter.com dentalcareatlelandtowncenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
nokomisdentalcare.com nokomisdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
mdscburnsvilleperiodontics.com mdscburnsvilleperiodontics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
northcreekvillagedental.com northcreekvillagedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
oakcreekfamilydental.com oakcreekfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
orlandohotsmiles.com orlandohotsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
orlandoleevsitadental.com orlandoleevsitadental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
osceoladentist.com osceoladentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
oswickdds.com oswickdds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
owendrivefamilydental.com owendrivefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
palmettodentalpcb.com palmettodentalpcb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
parkstonedentalcare.com parkstonedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
foleydentaloffice.com foleydentaloffice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 97 days
pdpellisville.com pdpellisville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2023 162 days
pdpwestcountyoldballasoralsurgery.com pdpwestcountyoldballasoralsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Feb 2023 Sep 2024 1 year, 193 days
pelicanparkdentalcare.com pelicanparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
pelicanpreservedentalcare.com pelicanpreservedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
pinerockdentalcare.com pinerockdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
preservedentalcare.com preservedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
prestigedentaldds.com prestigedentaldds.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2023 Sep 2024 302 days
pustaka.io pustaka.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
quailspringsdentist.com quailspringsdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
riverwooddentalcare.com riverwooddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
rljdentalwestallis.com rljdentalwestallis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 322 days
rockrunfamilydentistry.com rockrunfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
rockinghamdentalgroup.com rockinghamdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jun 2016 Mar 2018 1 year, 252 days
grandlelydentalcare.com grandlelydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
dentalcareoffranklintownship.com dentalcareoffranklintownship.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
afdctn.com afdctn.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
affordabledentistrygahanna.com affordabledentistrygahanna.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
scottsburgdentalcare.com scottsburgdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
sed8u.com sed8u.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
adcsuncity.com adcsuncity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
sierrafamilydentistry.co sierrafamilydentistry.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
smilemagic.org smilemagic.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
smilenlr.com smilenlr.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
smilesofkaty.com smilesofkaty.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
smilesoneastbay.com smilesoneastbay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 269 days
smithcrossingdentalcare.com smithcrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
sonrisasandsmiles.com sonrisasandsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
southbrowarddentistryandprosthodontics.com southbrowarddentistryandprosthodontics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
southstonedentalcare.com southstonedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jun 2023 278 days
southstreetdental.com southstreetdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
southwestvegassmiles.com southwestvegassmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH May 2023 Sep 2024 1 year, 101 days
starrsmilldentalcare.com starrsmilldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
stjosephmodentistry.com stjosephmodentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
sugarloaffamilydental.net sugarloaffamilydental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
adctucsonsouthmission.com adctucsonsouthmission.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 298 days
suncreekfamilydentistry.net suncreekfamilydentistry.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
supreetnagi.net supreetnagi.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Aug 2018 271 days
suwaneedental.com suwaneedental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2016 Dec 2017 1 year, 19 days
suwaneedentalcare.com suwaneedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
suwaneegadentist.com suwaneegadentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
tannencosmeticdentistry.com tannencosmeticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
autumndentalnc.com autumndentalnc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 39 days
tfdcrystallake.com tfdcrystallake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdelmwoodpark.com tfdelmwoodpark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdlivonia.com tfdlivonia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdsouthfield.com tfdsouthfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
thebaldwinparkdentist.com thebaldwinparkdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
themilldentalcare.com themilldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
thundermountaindentistry.net thundermountaindentistry.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 49 days
timberspringsdentalcare.com timberspringsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 346 days
bayareadentalcaretx.com bayareadentalcaretx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 55 days
yodlesecure.com baysidedentalcareal-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Jul 2016 One Off
towncenterdentalcaremn.com towncenterdentalcaremn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 346 days
tracyorcharddentalcare.net tracyorcharddentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
bluemountaindentalcare.com bluemountaindentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 3 days
bocaparkdental.com bocaparkdental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
waldorfdentist.com waldorfdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
walkerdentalcaremi.com walkerdentalcaremi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 24 days
bonitaesterodentalgroup.com bonitaesterodentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Apr 2018 One Off
wearegentledentistry.net wearegentledentistry.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Jul 2016 One Off
wdentalgroup.com wdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
weekiwacheedentalcare.com weekiwacheedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
brennandentistry.info brennandentistry.info
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
westlakesdentalcare.com westlakesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
wesed8u.com wesed8u.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
westtowndentalcaresc.net westtowndentalcaresc.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
buffalovalleydentalcare.com buffalovalleydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
canyoncreekfamily.com canyoncreekfamily.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
completedentalatgovernmentcenterclinic.com completedentalatgovernmentcenterclinic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 43 days
completedentistryofyork.com completedentistryofyork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
carushutto.com carushutto.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 294 days
carussurgicalcenterwestlake.com carussurgicalcenterwestlake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2023 289 days
yourraleighdentist.com yourraleighdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
youngsvilledentalcare.com youngsvilledentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
casonlanedentalcare.com casonlanedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
ypsilantisedationdentistry.com ypsilantisedationdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
cdatpaddockpark.com cdatpaddockpark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
cdofmeadowcrest.com cdofmeadowcrest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
cdserviceswhiteoak.com cdserviceswhiteoak.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 81 days
chdnhuntingdon.com chdnhuntingdon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2023 290 days
completesmilestx.com completesmilestx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 123 days
citrusgrovefamilydental.com citrusgrovefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
comfortablecareclearwater.com comfortablecareclearwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
comfortablecareicot.com comfortablecareicot.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
cosmeticdentistryglendale.com cosmeticdentistryglendale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
cosmeticdentistryofflorida.com cosmeticdentistryofflorida.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
cosmeticdentistryofnaples.com cosmeticdentistryofnaples.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
crescenthilldental.net crescenthilldental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
crystalcitysmileforlife.com crystalcitysmileforlife.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
deerwoodorthofranklin.com deerwoodorthofranklin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 273 days
deerwoodorthoracine.com deerwoodorthoracine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2024 1 year, 240 days
dentalcareatcrosscreekranch.com dentalcareatcrosscreekranch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 80 days
dentalcareatnorthpoint.com dentalcareatnorthpoint.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 80 days
dentalcareato-townwest.com dentalcareato-townwest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 108 days
dentalcareatroyalcreek.com dentalcareatroyalcreek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentalcareerfair.com dentalcareerfair.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
dentalcareofaloma.com dentalcareofaloma.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcareofbryan.com dentalcareofbryan.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 80 days
dentalcareofcitrusgroves.com dentalcareofcitrusgroves.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcareoflakewoodranch.com dentalcareoflakewoodranch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcareofnorthfortmyers.com dentalcareofnorthfortmyers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcareofwhisperingpines.com dentalcareofwhisperingpines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 80 days
dentaldesignsofplantation.net dentaldesignsofplantation.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
dentalplusburlington.com dentalplusburlington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistinmidwestcity.com dentistinmidwestcity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
dentistinmwc.com dentistinmwc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistryplusmadison.com dentistryplusmadison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
lwssredmill.com lwssredmill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 70 days
downtowndentalassociatesfl.com downtowndentalassociatesfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2024 1 year, 141 days
dradentist.com dradentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
eastbroadfamilydentistry.net eastbroadfamilydentistry.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
familydentalcareofspringvalley.com familydentalcareofspringvalley.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
familydentalcaresiouxcity.net familydentalcaresiouxcity.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
familydentalwilmington.com familydentalwilmington.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 11 days
familydentistryaustin.net familydentistryaustin.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
fcdentalcarechambersburg.net fcdentalcarechambersburg.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
fdglendale.com fdglendale.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
fdmuskego.com fdmuskego.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
fdsunprairie.com fdsunprairie.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
friendlydentalmerrillville.com friendlydentalmerrillville.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
galbreathdds.com galbreathdds.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
greaterpittsburghdentalgroup.com greaterpittsburghdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 327 days
greensdental.com greensdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
griffithdentist.com griffithdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
grmetrodental.com grmetrodental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
hammondinfamilydentistry.com hammondinfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
heartlandfamilydentalcare.net heartlandfamilydentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 46 days
independencedentalcare.net independencedentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
indianriverdentistry.info indianriverdentistry.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcarecamden.com dentalcarecamden.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
killeendentalhealthcenter.com killeendentalhealthcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 346 days
mdminnetonka.com mdminnetonka.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
familydentalabq.com familydentalabq.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
advanceddentistryatwindhaven.com advanceddentistryatwindhaven.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
dentalcareatvenicegardens.com dentalcareatvenicegardens.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
hernandosmiles.com hernandosmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
caneycrossingdentalcare.com caneycrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
bedfordpasmiles.com bedfordpasmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
lwssfirstcolonial.com lwssfirstcolonial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 70 days
carusgeorgetownuniversity.com carusgeorgetownuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
caruswoodlands.com caruswoodlands.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
dentalcareatpolarispointe.com dentalcareatpolarispointe.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
cdofviera.com cdofviera.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
dentalcareatwardlake.com dentalcareatwardlake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
cdsebastianhighway.com cdsebastianhighway.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
dentalcareonquebec.com dentalcareonquebec.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
chdpittsburghsqhill.com chdpittsburghsqhill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
dentalcareofelkton.com dentalcareofelkton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
completedentalcaresouthflorida.com completedentalcaresouthflorida.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
completedentalatlakeside.com completedentalatlakeside.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
fdmequon.com fdmequon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
lorraineroaddentalcare.com lorraineroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 342 days
dentalcareofcrossville.com dentalcareofcrossville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
holmestowncommonsdentalcare.com holmestowncommonsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 One Off
aviddentallindenhurst.com aviddentallindenhurst.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
forumdentalstlouis.com forumdentalstlouis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
hiddencreekpremierdentistry.com hiddencreekpremierdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
dentaldesignsonpoplar.com dentaldesignsonpoplar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcarebeyondsmiles.com dentalcarebeyondsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentistgainesvilletx.com dentistgainesvilletx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
kokopellifamilydentistry.com kokopellifamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2017 Dec 2017 One Off
kokosmiles.com kokosmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Sep 2017 Dec 2017 115 days
kruyerdental.com kruyerdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Apr 2023 169 days
lakemionadentistry.com lakemionadentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
lansingelitedentist.com lansingelitedentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
fdbrowndeer.com fdbrowndeer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
legacydentalcareofplano.com legacydentalcareofplano.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Nov 2022 64 days
lexingtondentists.com lexingtondentists.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
lochridgedentalcare.net lochridgedentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mdblaine.com mdblaine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Oct 2022 21 days
mdroseville.com mdroseville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
mdstpauloralsurgery.com mdstpauloralsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 61 days
dentalcareatstarkeyranch.com dentalcareatstarkeyranch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
mosaicdentalridges.com mosaicdentalridges.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
mousecreekdentalcare.com mousecreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
mydentistinckansascity.com mydentistinckansascity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mydentistincmustangorthodontics.com mydentistincmustangorthodontics.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mydentistshawnee.com mydentistshawnee.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
mydesertdental.com mydesertdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 116 days
nagi.me nagi.me
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Dec 2017 51 days
ndcdental.com ndcdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
neibauerdentaloxonhill.net neibauerdentaloxonhill.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
newtowndentalarts.net newtowndentalarts.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
fddelafield.com fddelafield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
afdsouthaven.com afdsouthaven.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
northbullittfamilydental.com northbullittfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
northhillsfamilydental.com northhillsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
northloopfd.com northloopfd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
northportoralsurgeryanddentalcare.com northportoralsurgeryanddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
northspringsdentalcare.com northspringsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
oakvalleydentalcare.com oakvalleydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Apr 2024 Sep 2024 128 days
eastsandidgedental.com eastsandidgedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mountainstatedentalcare.com mountainstatedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
carussurgicalcenterwoodlands.com carussurgicalcenterwoodlands.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 281 days
olatheorthodontics.net olatheorthodontics.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
deerwoodorthomenomoneefalls.com deerwoodorthomenomoneefalls.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
morgantonparkdentalcare.com morgantonparkdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 118 days
pacedentalcare.com pacedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
paddockdentist.com paddockdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
palmroyaldentalcare.com palmroyaldentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 274 days
redwingdentalcare.com redwingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
panorafamilydentistry.com panorafamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
parkwayvillagedentalcare.com parkwayvillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
parsi-osorio.com parsi-osorio.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
dentalcareofmilford.com dentalcareofmilford.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
pennpremierdental.net pennpremierdental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
peoriasmiledesign.com peoriasmiledesign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
relaxdentistrichmond.com relaxdentistrichmond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
pinehavendentalcare.com pinehavendentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Jul 2024 Sep 2024 51 days
plazahealthdentistry.com plazahealthdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
pointerfamilydental.com pointerfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
prairiecrossingdentalcare.com prairiecrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
prestondentalcenter.com prestondentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
prestwoodcompletedentalcare.com prestwoodcompletedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcareofsouthernpalm.com dentalcareofsouthernpalm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
rahndentalgroup.com rahndentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 354 days
richardwallacedds.com richardwallacedds.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
ridgefieldvillagedentalcare.com ridgefieldvillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
ridgeviewfamilydental.com ridgeviewfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
gavilanpeakdentalcare.com gavilanpeakdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
360dentaltulsa.com 360dentaltulsa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 29 days
dentalcareatelliscrossing.com dentalcareatelliscrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
rljdentalappleton.com rljdentalappleton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
rljdentalneenah.com rljdentalneenah.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
rljdentaloshkosh.com rljdentaloshkosh.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
saintandrewsdentalcare.com saintandrewsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
salemdentalcareva.com salemdentalcareva.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
sanantonio-dentistry.com sanantonio-dentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
sandoakdentalcare.com sandoakdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 320 days
santanvalleydentalcare.com santanvalleydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
sayebrookdentalcare.com sayebrookdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2023 249 days
afdeastmemphiskirby.com afdeastmemphiskirby.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
seamsporu.online seamsporu.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2023 Nov 2023 One Off
adcchandler.com adcchandler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
smilecenterofcoralgables.com smilecenterofcoralgables.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
smiledesignpeoria.com smiledesignpeoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
smilescience.net smilescience.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
smilesthatimpress.com smilesthatimpress.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
southcarolinadentalcenter.com southcarolinadentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
southsheboygandentist.com southsheboygandentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
southwestdentalcaremn.com southwestdentalcaremn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2023 163 days
springfieldmodentist.com springfieldmodentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
springfieldsedationdentistry.com springfieldsedationdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
stevenscrossingdentalcare.com stevenscrossingdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
stratforddental.com stratforddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 20 days
adctucsonnorthcampbell.com adctucsonnorthcampbell.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
sunstonedentalcare.com sunstonedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
enclavedentalcare.com enclavedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
supreetnagi.com supreetnagi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Nov 2017 Aug 2018 297 days
swanlakedentalcare.com swanlakedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Oct 2023 338 days
afdcordova.com afdcordova.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
tampabaydentistarmenia.com tampabaydentistarmenia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
tenderdentalcare.com tenderdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
texasbluebonnetdental.com texasbluebonnetdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
tfdbeecher.com tfdbeecher.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdfenton.com tfdfenton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 118 days
tfdflossmoor.com tfdflossmoor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2023 138 days
tfdnaperville.com tfdnaperville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2023 138 days
tfdpaloshills.com tfdpaloshills.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
thedentistplacelakelandkids.com thedentistplacelakelandkids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
babineausmiles.net babineausmiles.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Mar 2018 Mar 2018 One Off
toddstooth.com toddstooth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
totalhealthdentistry.net totalhealthdentistry.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
tramontofamilydentistry.com tramontofamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
treasurecoastfamilydental.com treasurecoastfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
vermillionfamilydental.com vermillionfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
veronadentalcare.net veronadentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
veronapadentalcare.net veronapadentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
boggycreekdentalcare.com boggycreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
wakeforestdentalarts.com wakeforestdentalarts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
yodlesecure.com wearegentledentistry-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Jul 2016 One Off
albertvillefamilydental.com albertvillefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 85 days
westenddentalcarewi.com westenddentalcarewi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
westminsterfamilydentalcare.com westminsterfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
broadmoordental.com broadmoordental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
wildernesscanyondentalcare.com wildernesscanyondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
willowbenddental.com willowbenddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 302 days
wimaumadentalcare.com wimaumadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
williamsburgcosmeticdentistry.com williamsburgcosmeticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
wiregrassfamilydentalcare.net wiregrassfamilydentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
winghavensmiles.com winghavensmiles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
caneridgedentist.net caneridgedentist.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
carusorthosanmarcos.com carusorthosanmarcos.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 42 days
carussurgicalcenterkilleen.com carussurgicalcenterkilleen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 43 days
carussurgicalcentersanmarcos.com carussurgicalcentersanmarcos.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Nov 2022 One Off
cdbelleview.com cdbelleview.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
chaddsforddentist.com chaddsforddentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
champaignsedationdentist.com champaignsedationdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
chdcranberrycommons.com chdcranberrycommons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
chdmonroeville.com chdmonroeville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
completedentalcareofnaples.com completedentalcareofnaples.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 118 days
completedentalcareofrichmond.com completedentalcareofrichmond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
completedentaloffrankfort.com completedentaloffrankfort.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 80 days
completefamilydental.com completefamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
mdscrichfieldendodontics.com mdscrichfieldendodontics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
coolspringscosmeticdentistry.com coolspringscosmeticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
countryclubdentalcareil.com countryclubdentalcareil.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
creativesmileschampaign.net creativesmileschampaign.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 49 days
creativesmilesdentalwinghaven.com creativesmilesdentalwinghaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
creeksidedentalcaretx.com creeksidedentalcaretx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
crowfielddental.com crowfielddental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
cypresscreekdentalcarefl.com cypresscreekdentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
lwsssuffolk.com lwsssuffolk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 133 days
daltongadentist.com daltongadentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jun 2016 Mar 2018 1 year, 252 days
deerwoodorthojanesville.com deerwoodorthojanesville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2023 169 days
deerwoodorthosunprairie.com deerwoodorthosunprairie.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Mar 2023 127 days
dentalcareatavalonpark.com dentalcareatavalonpark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcareatmillscrossing.com dentalcareatmillscrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 80 days
dentalcareatthelanding.com dentalcareatthelanding.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentalcarenorman.com dentalcarenorman.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
dentalcareofboilingsprings.net dentalcareofboilingsprings.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
dentalcareofleevillage.com dentalcareofleevillage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Dec 2022 22 days
dentalcareofsouthpuyallup.com dentalcareofsouthpuyallup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalsolutions.online dentalsolutions.online
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistaiken.com dentistaiken.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
dentistryetcmi.com dentistryetcmi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Aug 2018 75 days
dentistslargo.com dentistslargo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dfwdentalcare.com dfwdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
familydentalcareofbelton.com familydentalcareofbelton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
familydentalofcedarpark.net familydentalofcedarpark.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
drgregjohnson.com drgregjohnson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
drhershellgenesteele.com drhershellgenesteele.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
drklemma.net drklemma.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
eaststatedentalcare.com eaststatedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
eastviewfamilydentalne.com eastviewfamilydentalne.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 101 days
follyroaddentalcare.com follyroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
exceldentalaustin.com exceldentalaustin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
fdpewaukee.com fdpewaukee.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2023 290 days
lwsskempsvilleortho.com lwsskempsvilleortho.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 92 days
forumdentalrolla.com forumdentalrolla.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
gatescosmeticdentistry.net gatescosmeticdentistry.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
gatewayfd.com gatewayfd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Dec 2023 356 days
yodlesecure.com getahealthysmile-nh-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Jul 2016 One Off
getahealthysmile-nh.net getahealthysmile-nh.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Sep 2016 61 days
yodlesecure.com happyvalleydentistry-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jun 2016 Oct 2016 134 days
happyvalleyfamilydental.com happyvalleyfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
fdgreenbay.com fdgreenbay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
heartoftexasperioandimplantology.com heartoftexasperioandimplantology.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
hershellgenesteeleddspa.com hershellgenesteeleddspa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
highwinddentalcare.com highwinddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 One Off
indianlandscdentist.com indianlandscdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
innovativedentalcareofshorewood.com innovativedentalcareofshorewood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
jesek.com jesek.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2017 Mar 2018 1 year, 36 days
creatingsmilescfd.com creatingsmilescfd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatalamancecrossing.com dentalcareatalamancecrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
forthamerdentalcare.com forthamerdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
macedoniadentalarts.com macedoniadentalarts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
capstonedentalnc.com capstonedentalnc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Dec 2024 Jan 2025 54 days
caruskilleen.com caruskilleen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
carusorthowestlake.com carusorthowestlake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 281 days
carusnorthaustinmedicalcenter.com carusnorthaustinmedicalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
idealdentistryfl.com idealdentistryfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 352 days
cdserviceswestchester.com cdserviceswestchester.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
certusdentalcare.com certusdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
dentalcareofpewaukee.com dentalcareofpewaukee.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2023 Sep 2024 348 days
churchvillefamilydentistry.com churchvillefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
citysmilesdc.com citysmilesdc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
fdjanesville.com fdjanesville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
fdwaukeshastoneridge.com fdwaukeshastoneridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
dentalcareatmidpoint.com dentalcareatmidpoint.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
lifetimedentalcareoffrostburg.com lifetimedentalcareoffrostburg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
mdweststpaul.com mdweststpaul.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
deerwoodorthoappleton.com deerwoodorthoappleton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 274 days
innovativedentalcareofmuncie.com innovativedentalcareofmuncie.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 351 days
mosaicdentalnicollet.com mosaicdentalnicollet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
dentalcareatgastonday.com dentalcareatgastonday.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
ducktowndentalcare.com ducktowndentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
rayviewdentalgroup.com rayviewdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
reinitzdental.com reinitzdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
renaissanceaestheticdentistry.com renaissanceaestheticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
archdental.com archdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Dec 2016 Jun 2018 1 year, 193 days
1stadvantagedentalqueensbury.com 1stadvantagedentalqueensbury.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 4 days
rljdentalmenasha.com rljdentalmenasha.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
roanokerapidsdentalcare.com roanokerapidsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
rockymountsmilemakers.com rockymountsmilemakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 193 days
royalpalmdentist.com royalpalmdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
russellvilledentalgroup.com russellvilledentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Feb 2023 Sep 2024 1 year, 190 days
saladocreekfamilydental.com saladocreekfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
adcglendalewestbell.com adcglendalewestbell.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2023 168 days
sdshouston.com sdshouston.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
shadybrookfamilydental.com shadybrookfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 351 days
alfaindentistry.com alfaindentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 30 days
adctucsoneastcarondelet.com adctucsoneastcarondelet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
signaturesmilesbrighton.com signaturesmilesbrighton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
signaturesmilesmi.com signaturesmilesmi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 19 days
americanfamilydental.com americanfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
sixmilecypressdentalcare.com sixmilecypressdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 351 days
anderson-dental.com anderson-dental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
mdinvergroveheights.com mdinvergroveheights.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
advanceddentistrylecanto.com advanceddentistrylecanto.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
ssdgsmiles.com ssdgsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2023 1 year, 9 days
ascotaesthetics.com ascotaesthetics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Nov 2024 38 days
staugustinedentistry.net staugustinedentistry.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
stauntondentalcare.com stauntondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
stonebridgeranchsmiles.com stonebridgeranchsmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
summerlindentalcare.com summerlindentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 313 days
swordsfamilydentalcare.com swordsfamilydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
afdolivebranch.com afdolivebranch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
afdmemphispoplar.com afdmemphispoplar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
afdgermantown.com afdgermantown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
tamiamitraildentalcare.com tamiamitraildentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 May 2023 220 days
austellfamilydentistry.com austellfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
tennysonlakedental.com tennysonlakedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdjoliet.com tfdjoliet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdtrenton.com tfdtrenton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 118 days
thedentistplacelakeland.com thedentistplacelakeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
threeriversdental.com threeriversdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Feb 2012 One Off
tmjexperts.com tmjexperts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
yodlesecure.com tomokafamilydentistry-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jun 2016 Nov 2016 162 days
berkshiredentalgroup.com berkshiredentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Oct 2016 Jun 2017 255 days
tulsahillsdentistry.com tulsahillsdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
universityparkwaydentalcare.com universityparkwaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
waldorforthodonticsmd.com waldorforthodonticsmd.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
watertowerdentalcareco.com watertowerdentalcareco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 24 days
bowlinggreenfamilydentistry.com bowlinggreenfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Feb 2018 38 days
bradfordvilledentalcare.com bradfordvilledentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
westpascodental.com westpascodental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
whiteoakdentalcaretx.com whiteoakdentalcaretx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
whiteoakdentistry.com whiteoakdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
williamsonroaddentalcare.com williamsonroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
woodlanddentalcarefl.com woodlanddentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
cambyfamilydentistry.net cambyfamilydentistry.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
carpenterdentist.com carpenterdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
cartydmd.com cartydmd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jul 2018 Aug 2018 9 days
caruskidskilleendentistry.com caruskidskilleendentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Nov 2023 353 days
carusroundrock.com carusroundrock.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
carussanmarcos.com carussanmarcos.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
your-smile-team.net your-smile-team.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
ypsilantitownshipdentist.com ypsilantitownshipdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
reservoircommonsdental.com reservoircommonsdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
chdhomercity.com chdhomercity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 293 days
chdindiana.com chdindiana.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
chdjohnstownrichland.com chdjohnstownrichland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
chdmccandlesscovenant.com chdmccandlesscovenant.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
chdmtpleasant.com chdmtpleasant.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
chdmurrysville.com chdmurrysville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
chdpittsburghshadyside.com chdpittsburghshadyside.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
choosemoderndentistry.com choosemoderndentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
clairmontcosmeticdentistry.com clairmontcosmeticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
coastalcarolinadentalcare.com coastalcarolinadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 278 days
coastaldentalcareofmilford.com coastaldentalcareofmilford.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
coconutcreekwinningsmiles.net coconutcreekwinningsmiles.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
colonialdrivefamilydentistry.net colonialdrivefamilydentistry.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
comfortablecareoaks.com comfortablecareoaks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Feb 2012 Oct 2013 1 year, 236 days
yodlesecure.com creativesmileschampaign-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jul 2016 Dec 2016 179 days
deerwoodorthostoneridge.com deerwoodorthostoneridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 292 days
delanydentalimplants.com delanydentalimplants.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Nov 2023 1 year, 46 days
dentalcareatbentslanding.com dentalcareatbentslanding.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Mar 2024 Sep 2024 174 days
dentalcareathuntersgreen.com dentalcareathuntersgreen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcareatlakeshores.com dentalcareatlakeshores.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentalcareatwinnowingway.com dentalcareatwinnowingway.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 58 days
dentalcaregreencastle.com dentalcaregreencastle.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
dentalcareofcarypark.com dentalcareofcarypark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 80 days
dentalcareofedmonds.com dentalcareofedmonds.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2023 169 days
dentalcareofsantanvalley.com dentalcareofsantanvalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcareonbryant.com dentalcareonbryant.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 56 days
dentalcosmeticcenterbayarea.com dentalcosmeticcenterbayarea.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 290 days
dentaldesignsofplantation.com dentaldesignsofplantation.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Sep 2016 111 days
dentalemergencynh.com dentalemergencynh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalimplantnorthernkentucky.com dentalimplantnorthernkentucky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistingainesvillega.mobi dentistingainesvillega.mobi
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentistinlasvegasnv.com dentistinlasvegasnv.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
dentistlasvegastowncenter.com dentistlasvegastowncenter.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Mar 2018 36 days
dentistspringdalear.com dentistspringdalear.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Sep 2016 111 days
dentisttulsaoklahoma.com dentisttulsaoklahoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 Mar 2016 One Off
drmasondmd.com drmasondmd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
econriverdentalcare.com econriverdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
energysquaredental.com energysquaredental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2023 169 days
falconpointdentalcare.com falconpointdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
familydentalmaplelawn.com familydentalmaplelawn.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Dec 2017 One Off
familydentalofspringhill.com familydentalofspringhill.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
familydentistlakeland.com familydentistlakeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
familydentistrymesa.com familydentistrymesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
fdgreenbaydevelopmentdrive.com fdgreenbaydevelopmentdrive.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Dec 2023 1 year, 10 days
haynesbridgedentalcare.com haynesbridgedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 125 days
greenvilledentistsc.com greenvilledentistsc.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
gwinnettdentist.com gwinnettdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 71 days
harpethdentalcare.net harpethdentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
heightsdc.com heightsdc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
hersheycosmeticdentist.com hersheycosmeticdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
myvicksburgdentist.com myvicksburgdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
adcorthoglendale.com adcorthoglendale.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
hoptowndental.com hoptowndental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 326 days
horizondentalcenter.net horizondentalcenter.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
johnsdentistry.com johnsdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 348 days
indianrivercountyfloridadentist.biz indianrivercountyfloridadentist.biz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
indianrivercountyfloridadentist.info indianrivercountyfloridadentist.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
longstonplacedental.com longstonplacedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 342 days
islandbayfamilydentistry.com islandbayfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Jun 2016 36 days
jollyvilledental.com jollyvilledental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Feb 2023 145 days
dentalcareattheplex.com dentalcareattheplex.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 68 days
katyfamilydentists.com katyfamilydentists.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
klintdds.com klintdds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
lakesidedentaltuscaloosa.com lakesidedentaltuscaloosa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 345 days
fdbrookfield.com fdbrookfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 266 days
lasvegasbocaparkdental.com lasvegasbocaparkdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
laureldentists.com laureldentists.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Aug 2018 74 days
lifetimesmilesdental.com lifetimesmilesdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
livoniadentalcare.com livoniadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 92 days
loganavenuedental.com loganavenuedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
marketplace-dental.net marketplace-dental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
marketplacedental.com marketplacedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
mdegansavage.com mdegansavage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2023 352 days
mdscburnsvilleendodontics.com mdscburnsvilleendodontics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2023 311 days
mdscburnsvilleoralsurgery.com mdscburnsvilleoralsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
allsmilesnw.com allsmilesnw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
metromndental.com metromndental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 338 days
millbrookdentalcare.com millbrookdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Aug 2018 75 days
mtvernondentist.com mtvernondentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
mydentistinc.com mydentistinc.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2016 Mar 2018 1 year, 93 days
yodlesecure.com mydentistincmuskogee-com.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Sep 2016 61 days
mydentistincnorman.com mydentistincnorman.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mydentistincspringfield.com mydentistincspringfield.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Oct 2016 144 days
mydentistmeridian.com mydentistmeridian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
mydentistsapulpa.com mydentistsapulpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
nashborovillagedental.com nashborovillagedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
nexusdental.com nexusdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2023 137 days
northatlantadentistry.com northatlantadentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
northbrowarddentalcare.com northbrowarddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
northpointedentalcarein.net northpointedentalcarein.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
northtarrantdentalcare.com northtarrantdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 350 days
oakopeningsdental.com oakopeningsdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
ofallonfamilydental.net ofallonfamilydental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
afdbartlett.com afdbartlett.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
carustemple.com carustemple.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
oldetownlaureldental.com oldetownlaureldental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
oldkingsdentalcare.com oldkingsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
deerwoodorthogreenbay.com deerwoodorthogreenbay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
kenmoredentistry.com kenmoredentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
orchardvalleydentalaurora.com orchardvalleydentalaurora.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
orlandodentistleevista.com orlandodentistleevista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
oswegocommonsfamilydental.net oswegocommonsfamilydental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
panamacitysmiles.com panamacitysmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
panolafamilydental.com panolafamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
parkridgedentalcarefl.com parkridgedentalcarefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Apr 2024 Sep 2024 128 days
pdpchesterfield.com pdpchesterfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jul 2024 1 year, 304 days
dentalcareatgordencrossing.com dentalcareatgordencrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
perfectsmilesdental.net perfectsmilesdental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
lakewestdental.com lakewestdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 99 days
pinearbordentalcare.com pinearbordentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 314 days
pleasentdentistry.com pleasentdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
plesantdentistry.com plesantdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
pmfdentist.com pmfdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
riverbreezedentalcare.com riverbreezedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 312 days
premierdentalcareatwesttown.com premierdentalcareatwesttown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
allisonparkdentistry.com allisonparkdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
quarrysmiles.com quarrysmiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Jun 2024 Sep 2024 88 days
queensroaddentistry.com queensroaddentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 18 days
quirtdentistry.com quirtdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Mar 2018 1 year, 288 days
quirtfamilydentistry-edgar.com quirtfamilydentistry-edgar.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
quirtfamilydentistry.com quirtfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
raintreefamilydentistry.com raintreefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
baysidesmilesdentalcare.com baysidesmilesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 One Off
middlesexdentalcarect.com middlesexdentalcarect.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 337 days
meadowcreekdentalcare.com meadowcreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalartsofpalmharbor.com dentalartsofpalmharbor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 102 days
boulevardplacedentalcare.com boulevardplacedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
jacarandadentalcare.com jacarandadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 120 days
fdoconomowoc.com fdoconomowoc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
junctiondentalcareil.com junctiondentalcareil.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentistnapervilleil.com dentistnapervilleil.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
hunterdentistry.com hunterdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
carusorthoroundrock.com carusorthoroundrock.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 281 days
caruscedarpark.com caruscedarpark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
carussmithville.com carussmithville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
jandadentistry.com jandadentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
chdwarrenstreet.com chdwarrenstreet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
lwsschesapeake.com lwsschesapeake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 119 days
chiquitadentalcare.com chiquitadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
mosaicdentalapplevalley.com mosaicdentalapplevalley.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 336 days
dentalcareonhollywood.com dentalcareonhollywood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
farrowparkwaydentalcare.com farrowparkwaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
gatewayofnaplesdental.com gatewayofnaplesdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 328 days
deerwoodorthobayshore.com deerwoodorthobayshore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
hightidesdentalcare.com hightidesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 One Off
fortmyersimplantdentist.com fortmyersimplantdentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 69 days
forumdentallebanon.com forumdentallebanon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
dentalcareofmenomoneefalls.com dentalcareofmenomoneefalls.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcareatbartramcrossings.com dentalcareatbartramcrossings.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 102 days
dentalcareoflightfoot.com dentalcareoflightfoot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
familydentistryoforangegroves.com familydentistryoforangegroves.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
farmingtonvillagedentalcare.com farmingtonvillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 101 days
forumdentalstrobert.com forumdentalstrobert.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
afiniadentalorchardhill.com afiniadentalorchardhill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
rivergatedentalcarenc.com rivergatedentalcarenc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
riversdentalcare.net riversdentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
riversidevalleydentalcare.com riversidevalleydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
83rdmarketplacedentalcare.com 83rdmarketplacedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 23 days
fdappleton.com fdappleton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
rljdentalgreenbay.com rljdentalgreenbay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
rousseaufamilydentistry.com rousseaufamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 64 days
rtdental.com rtdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 353 days
dentalcareatmiramesa.com dentalcareatmiramesa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
advanceddentalhealthcenter.com advanceddentalhealthcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 298 days
aestheticdesignsofcherrycreek.com aestheticdesignsofcherrycreek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2023 118 days
afdcoolsprings.com afdcoolsprings.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2023 288 days
afdsouthwind.com afdsouthwind.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Oct 2023 1 year, 7 days
affordabledentistrycolumbia.net affordabledentistrycolumbia.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
affordabledentistryarmenia.com affordabledentistryarmenia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
alegredentalnm.com alegredentalnm.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2017 Mar 2018 308 days
albertosmilecenter.com albertosmilecenter.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Mar 2018 99 days
yodlesecure.com smiledesigndental-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Oct 2016 Dec 2016 63 days
smiledesigndental.net smiledesigndental.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 49 days
smilesonnorthern.net smilesonnorthern.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
smilecentrevenice.com smilecentrevenice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 350 days
southlakedentalcarefl.net southlakedentalcarefl.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
andersondentallw.com andersondentallw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Apr 2024 1 year, 151 days
andersongentledentalcare.com andersongentledentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
southaikendentalcare.com southaikendentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
goldenparkvillagedental.com goldenparkvillagedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
stationsidedentalcare.com stationsidedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 315 days
stevensonaldentist.com stevensonaldentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
sullivandentist.com sullivandentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
adctucsonwestina.com adctucsonwestina.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
afdraleigh.com afdraleigh.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
alliancedentalcenter.org alliancedentalcenter.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
tanyardspringsfamilydental.com tanyardspringsfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
tanglewoodfamilydental.com tanglewoodfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
tannendentalcare.com tannendentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
tfdlapeer.com tfdlapeer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdlitchfield.com tfdlitchfield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdportland.com tfdportland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdsterlingheights.com tfdsterlingheights.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
tfdwestchester.com tfdwestchester.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 347 days
avenuedentalpa.com avenuedentalpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 9 days
yodlesecure.com thundermountaindentistry-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jun 2016 Oct 2016 134 days
tilleryfamilydental.com tilleryfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 346 days
tomokafamilydentistry.net tomokafamilydentistry.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 49 days
baylessdentalgroup.com baylessdentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2023 118 days
baysidedentalcareal.net baysidedentalcareal.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 Jul 2016 50 days
totalhealthdentistryfl.com totalhealthdentistryfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 346 days
tpdental.com tpdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 21 days
tyronefamilydentistry.com tyronefamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 307 days
vanderbiltestates.dental vanderbiltestates.dental
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
wallawalladentalcare.com wallawalladentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
waterparkdentalcareco.com waterparkdentalcareco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Mar 2024 1 year, 168 days
wecare4smiles.com wecare4smiles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 24 days
westcanyondentalcare.com westcanyondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
westfielddentalcare.com westfielddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
westhighlanddentalcare.com westhighlanddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 344 days
westportdentalcare.com westportdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 25 days
westtownedental.com westtownedental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
wholelifedental.com wholelifedental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
yourorlandparkfamilydentist.com yourorlandparkfamilydentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
carusorthoatascocita.com carusorthoatascocita.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 281 days
zangstreetdentalcare.com zangstreetdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 22 days
cdofwilliston.com cdofwilliston.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
cedarcitydentalcare.com cedarcitydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
clermontendo.com clermontendo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
coconutpointdentalcare.com coconutpointdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
colliervilledentist.com colliervilledentist.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Dec 2017 Mar 2018 74 days
completefamilydentistryelkhart.com completefamilydentistryelkhart.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 333 days
comprehensivedentalnc.com comprehensivedentalnc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 123 days
conversedentist.com conversedentist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
crawfordfamilydental.com crawfordfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalprofessionalsplc.com dentalprofessionalsplc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
crosspointdental.com crosspointdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
cumberlandriverdentalcare.com cumberlandriverdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2022 Sep 2024 1 year, 275 days
deerwoodorthocudahy.com deerwoodorthocudahy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2023 344 days
definitiondental.com definitiondental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Dec 2022 80 days
dellagiodentistfl.com dellagiodentistfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Aug 2018 Aug 2018 25 days
dentalartsofgettysburg.com dentalartsofgettysburg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcareatlakewoodwalk.com dentalcareatlakewoodwalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcareatpalmerranch.com dentalcareatpalmerranch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareatnorthcreek.com dentalcareatnorthcreek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentalcareattreatyoaks.com dentalcareattreatyoaks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
dentalcareofhamilton.com dentalcareofhamilton.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Feb 2018 Feb 2018 One Off
dentalcareofrolesville.com dentalcareofrolesville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 1 day
dentaldesignslasvegas.net dentaldesignslasvegas.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
dentalplusgreentree.com dentalplusgreentree.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Dec 2017 25 days
dentistryforhealthomaha.com dentistryforhealthomaha.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentistryplushickoryhollow.com dentistryplushickoryhollow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
denturesonlyny.com denturesonlyny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Mar 2018 Mar 2018 One Off
drklemma.com drklemma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
drpeeler.net drpeeler.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
drpinsky.com drpinsky.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jun 2017 Jun 2017 One Off
drswedenburg.com drswedenburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
eastcreekdentalcare.com eastcreekdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
eastlakesdentalcare.com eastlakesdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 101 days
fdmadisoneast.com fdmadisoneast.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
ensodentistry.com ensodentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 291 days
fcdentalcarewaynesboro.net fcdentalcarewaynesboro.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
fdbayview.com fdbayview.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Mar 2024 1 year, 142 days
fdmadisonwest.com fdmadisonwest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
fdmenomoneefalls.com fdmenomoneefalls.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
fdrivercenter.com fdrivercenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Feb 2023 121 days
feathertouchdentistry.com feathertouchdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
grandcypressdentalcare.com grandcypressdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 7 days
grandridgedental.net grandridgedental.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 123 days
griffithsmilecenter.com griffithsmilecenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
harnechset.online harnechset.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Dec 2023 Dec 2023 One Off
hawkesbaydentalcare.com hawkesbaydentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
yodlesecure.com heartlandfamilydentalcare-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jun 2016 Dec 2016 197 days
heronspringsdentalcare.com heronspringsdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Oct 2024 Jan 2025 121 days
hesselpark.com hesselpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
hgenesteeledds.com hgenesteeledds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
highwaykdental.com highwaykdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
illinidentalcare.com illinidentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
irabergerdds.com irabergerdds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
kinddentistry.com kinddentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
lakelanddentistryfl.com lakelanddentistryfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
lakemionafamilydental.com lakemionafamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
libraryparkdental.com libraryparkdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
lifetimesmilesoakpark.com lifetimesmilesoakpark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 343 days
littleriverfamilydental.net littleriverfamilydental.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 49 days
lortondentist.com lortondentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
macedoniadentalcare.com macedoniadentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Jan 2023 100 days
maplelawndentalgroup.com maplelawndentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
markandbartholomewdental.com markandbartholomewdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
mdblainebaltimore.com mdblainebaltimore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jan 2024 1 year, 114 days
mdchildrensdentistryburnsville.com mdchildrensdentistryburnsville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
mdscmaplegroveperiodontics.com mdscmaplegroveperiodontics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jul 2024 1 year, 286 days
mdscrichfieldoralsurgery.com mdscrichfieldoralsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Aug 2024 1 year, 305 days
mdstlouispark.com mdstlouispark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 339 days
mdstlouisparkwest.com mdstlouisparkwest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2023 253 days
mdstpaulmidwayoralsurgery.com mdstpaulmidwayoralsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Jun 2023 253 days
meadowranchdentalcare.com meadowranchdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
yodlesecure.com merrillvilledental-net.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jun 2016 Dec 2016 197 days
merrillvilledental.net merrillvilledental.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 49 days
middelcompletedentalcare.com middelcompletedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
missouriveneers.com missouriveneers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
grandovervillagedentalcare.com grandovervillagedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
muddybranchdentalgroupmd.com muddybranchdentalgroupmd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
mydentistchickasha.com mydentistchickasha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
mydentistincindependence.com mydentistincindependence.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
yodlesecure.com mydentistincshawneeok-com.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Jun 2016 Dec 2016 197 days
mydentistincshawneeok.com mydentistincshawneeok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-22814484 Mar 2016 May 2016 49 days
yodlesecure.com mydentistincspringfield-com.yodlesecure.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Aug 2016 27 days
mydentistincstillwater.com mydentistincstillwater.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
mydentistinctexarkana.com mydentistinctexarkana.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
neibauerdentalcare.com neibauerdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Jul 2016 Mar 2018 1 year, 251 days
legacydentalcarepa.com legacydentalcarepa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2023 Sep 2024 356 days
dentalcareofgrandview.com dentalcareofgrandview.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Jul 2023 Sep 2024 1 year, 42 days
accuradentalcare.com accuradentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
norfolkfamilydental.com norfolkfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Apr 2018 Jun 2018 55 days
northarlingtondentalcare.com northarlingtondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Aug 2024 1 year, 350 days
northauroralifetimedentistry.com northauroralifetimedentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Aug 2023 Sep 2024 1 year, 25 days
northcharlestondentalcare.com northcharlestondentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Nov 2017 One Off
northeastdentistry.com northeastdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
adcscottsdale.com adcscottsdale.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 340 days
oakleaffamilydental.net oakleaffamilydental.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
oakriverdentalcare.com oakriverdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Oct 2024 17 days
carusatascocita.com carusatascocita.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
carusbrodielane.com carusbrodielane.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
carussurgicalatascocita.com carussurgicalatascocita.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 281 days
carussurgicalcenterroundrock.com carussurgicalcenterroundrock.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
oldmillfamilydental.com oldmillfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
onepillsedation.com onepillsedation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
orangetreedentalcare.com orangetreedentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
oswegosedationdentist.com oswegosedationdentist.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcareatavamarcrossing.com dentalcareatavamarcrossing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
papilliondentalcare.net papilliondentalcare.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 May 2016 May 2016 One Off
fdforesthome.com fdforesthome.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
phoenixdentist.co phoenixdentist.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
pineislandroaddentalcare.com pineislandroaddentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024 1 year, 355 days
planolaserdentistry.com planolaserdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
premierdentalcarewesttown.com premierdentalcarewesttown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
dentalcares.com dentalcares.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
dentalcarescordova.com dentalcarescordova.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
rcdcdental.com rcdcdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-55336258 Jun 2018 Jun 2018 One Off
regalvalleyfamilydental.com regalvalleyfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-DD11B77600 Nov 2017 Feb 2018 64 days
cherrywaydental.com cherrywaydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
msmainstreetdental.com msmainstreetdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Nov 2024 Jan 2025 74 days
baycreekdentalcarega.com baycreekdentalcarega.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 3 days
greenvalleydentalcaretx.com greenvalleydentalcaretx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
bristolheightsdental.com bristolheightsdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 283 days
fdwestbend.com fdwestbend.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
glendaleaestheticdentistry.com glendaleaestheticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
carolinadentalgroup.com carolinadentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
carusorthokilleen.com carusorthokilleen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
carusspringkuykendahl.com carusspringkuykendahl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
dentistsinwinchester.com dentistsinwinchester.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
cdofmerrittisland.com cdofmerrittisland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
cdoftitusville.com cdoftitusville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 335 days
charlestoncosmeticdentistry.com charlestoncosmeticdentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 334 days
florencefamilydentistryky.com florencefamilydentistryky.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
advanceddentistryhomosassa.com advanceddentistryhomosassa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Nov 2022 Sep 2024 1 year, 298 days
dentalcareatsouthcrest.com dentalcareatsouthcrest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
fivepointsdentalal.com fivepointsdentalal.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 329 days
dentalcareofhampstead.com dentalcareofhampstead.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
dentalcareatmeadowridge.com dentalcareatmeadowridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
dentalcareonballentrae.com dentalcareonballentrae.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Jan 2025 Jan 2025 2 days
dentistryathagerstown.com dentistryathagerstown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 332 days
distinctivedmd.com distinctivedmd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-OPT-W4SQKXH Oct 2022 Sep 2024 1 year, 331 days
foxgardendentalcare.com foxgardendentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5MGLNPZ Sep 2024 Jan 2025 135 days
HAPPYVALLEYDENTISTRY.COM
Non IP Attributes
Attribute First Last
UA UA-22814484 Nov 2011 Oct 2017
GTM GTM-OPT-W4SQKXH Sep 2022 Sep 2024
UA UA-55336258 Oct 2016 Aug 2018
NR NR-DD11B77600 May 2016 Mar 2018
UA UA-117912474 Nov 2020 Jul 2021
GTM GTM-5MGLNPZ Sep 2024 Jan 2025
HAPPYVALLEYDENTISTRY.COM
Overlap Attribute Domains
thundermountaindentistry.com thundermountaindentistry.com
fountainhillsdentalcare.com fountainhillsdentalcare.com
happyvalleydentistry.com happyvalleydentistry.com
lakeviewfamilydental.com lakeviewfamilydental.com
lifetimedentistryofsouthtulsa.com lifetimedentistryofsouthtulsa.com
myportorangedentist.com myportorangedentist.com
oakwoodfamilydentalcare.com oakwoodfamilydentalcare.com
dfdentistry.com dfdentistry.com
smilesdentistryofmitchellville.com smilesdentistryofmitchellville.com
thedentistplaceorangepark.com thedentistplaceorangepark.com
tomokafamilydentistry.com tomokafamilydentistry.com
dentistinftmyers.com dentistinftmyers.com
duggapfamilydentistry.com duggapfamilydentistry.com
familydentalshawnee.com familydentalshawnee.com
melbournefamilydental.com melbournefamilydental.com
houghtonfamilydentalcare.com houghtonfamilydentalcare.com
arrowheadcreeksidedental.com arrowheadcreeksidedental.com
comfortablecaresouthtrail.com comfortablecaresouthtrail.com
familydentistryarnold.com familydentistryarnold.com
reflectiondentallittleriver.com reflectiondentallittleriver.com
santanmountaindental.com santanmountaindental.com
bowlinggreenfamilydental.com bowlinggreenfamilydental.com
bullheadcitydentist.com bullheadcitydentist.com
moderndentaleastvalley.com moderndentaleastvalley.com
creativesmilesgreenfield.com creativesmilesgreenfield.com
crossroadsfamilydentalcare.com crossroadsfamilydentalcare.com
deervalleyfamilydentistry.com deervalleyfamilydentistry.com
desertsmilesdentistry.com desertsmilesdentistry.com
mydentistada.com mydentistada.com
mydentistardmore.com mydentistardmore.com
heartlandfamilydentalcare.com heartlandfamilydentalcare.com
littleriverfamilydental.com littleriverfamilydental.com
truesmilesonline.com truesmilesonline.com
chandlersmiles.com chandlersmiles.com
creativesmileschampaign.com creativesmileschampaign.com
dekalbdentalgroup.com dekalbdentalgroup.com
dentaldesignslakesidevillage.com dentaldesignslakesidevillage.com
dentalvillagesierravista.com dentalvillagesierravista.com
dentistquincy.com dentistquincy.com
lakesidevillagedentist.com lakesidevillagedentist.com
landmarkdentalcare.com landmarkdentalcare.com
mountaincrestdental.com mountaincrestdental.com
puschpeakfamilydental.com puschpeakfamilydental.com
lakemionadentalcare.com lakemionadentalcare.com
lakewalesdentistry.com lakewalesdentistry.com
lexingtondentist.com lexingtondentist.com
lifetimedentistryofchickasha.com lifetimedentistryofchickasha.com
linderhofdental.com linderhofdental.com
machesneyparkfamilydental.com machesneyparkfamilydental.com
marionfamilydental.com marionfamilydental.com
marketplacedentalcare.com marketplacedentalcare.com
marklandfamilydental.com marklandfamilydental.com
millcreekdentalcarefl.com millcreekdentalcarefl.com
moorecompletedental.com moorecompletedental.com
mydentistweatherfordtx.com mydentistweatherfordtx.com
neibauerdentalmanassas.com neibauerdentalmanassas.com
neibauerdentalwaldorf.com neibauerdentalwaldorf.com
broadlandscompletedental.com broadlandscompletedental.com
northcharlestonfamilydental.com northcharlestonfamilydental.com
dentalcareofbraselton.com dentalcareofbraselton.com
dentalcareofsapulpa.com dentalcareofsapulpa.com
okeechobeedentalcare.com okeechobeedentalcare.com
dentalcareofsolon.com dentalcareofsolon.com
dentalgroupcarbondale.com dentalgroupcarbondale.com
eastbroadfamilydentistry.com eastbroadfamilydentistry.com
capesmilesdentistry.com capesmilesdentistry.com
plazaboulevarddental.com plazaboulevarddental.com
pleasantgrovedentaltn.com pleasantgrovedentaltn.com
premierdentistryofblythewood.com premierdentistryofblythewood.com
reflectiondentalmanassas.com reflectiondentalmanassas.com
rockinghamdentalgroupepping.com rockinghamdentalgroupepping.com
adamsdairyfamilydentalcare.com adamsdairyfamilydentalcare.com
affordabledentistrycolumbia.com affordabledentistrycolumbia.com
shadowbrookdentist.com shadowbrookdentist.com
armedforcesdentalcenter.com armedforcesdentalcenter.com
arnolddentalcenter.com arnolddentalcenter.com
smileforlifedentalcare.com smileforlifedentalcare.com
smileokc.com smileokc.com
smilesatheathbrook.com smilesatheathbrook.com
smilesonsouthern.com smilesonsouthern.com
smiletodaydentistry.com smiletodaydentistry.com
springstreetfamilydentistry.com springstreetfamilydentistry.com
sullivanfamilydentistry.com sullivanfamilydentistry.com
sunnysidedentist.com sunnysidedentist.com
audubondentalcenter.com audubondentalcenter.com
terracedentalassociates.com terracedentalassociates.com
titusvillesmilesdentistry.com titusvillesmilesdentistry.com
bartramfamilydental.com bartramfamilydental.com
baytreefamilydental.com baytreefamilydental.com
towncenterdentallasvegas.com towncenterdentallasvegas.com
turtlecreekdentalcare.com turtlecreekdentalcare.com
vanburenfamilydentistry.com vanburenfamilydentistry.com
virginiaparkwaydental.com virginiaparkwaydental.com
bonitadentalarts.com bonitadentalarts.com
bretonbaydentistry.com bretonbaydentistry.com
wyliedental.com wyliedental.com
canoecreekfamilydental.com canoecreekfamilydental.com
completedentalofokc.com completedentalofokc.com
chesterfieldparkdental.com chesterfieldparkdental.com
citrustowerfamilydental.com citrustowerfamilydental.com
coralridgedentalarts.com coralridgedentalarts.com
cosmeticdentistrytampabay.com cosmeticdentistrytampabay.com
dentalassociatesofgrovetown.com dentalassociatesofgrovetown.com
dentalcareatwestsideshoppes.com dentalcareatwestsideshoppes.com
dentalcareofmtvernon.com dentalcareofmtvernon.com
dentalcareofroundlakebeach.com dentalcareofroundlakebeach.com
dentalsolutionsonline.com dentalsolutionsonline.com
dentistingainesvillega.com dentistingainesvillega.com
dentistinjoplin.com dentistinjoplin.com
devinedentalcare.com devinedentalcare.com
dixonparkdental.com dixonparkdental.com
edgewaterfamilydental.com edgewaterfamilydental.com
familydentalatalafayacrossings.com familydentalatalafayacrossings.com
familydentalcareoffitchburg.com familydentalcareoffitchburg.com
familydentalcareofwarrenton.com familydentalcareofwarrenton.com
familydentalcaresycamore.com familydentalcaresycamore.com
familydentalfortmyers.com familydentalfortmyers.com
familydentalofcanton.com familydentalofcanton.com
familydentalofseabrook.com familydentalofseabrook.com
familydentistryofpoplarbluff.com familydentistryofpoplarbluff.com
franklindentalcare.com franklindentalcare.com
gatewaydentalcarewi.com gatewaydentalcarewi.com
heritagedentalgroup.com heritagedentalgroup.com
hickorycreekfamilydentistry.com hickorycreekfamilydentistry.com
indianriverdentistry.com indianriverdentistry.com
innovativedentistryofrockville.com innovativedentistryofrockville.com
jungermanndentalcare.com jungermanndentalcare.com
keywestcrossingdental.com keywestcrossingdental.com
kingsleyfamilydentalcare.com kingsleyfamilydentalcare.com
lakejoydentalcare.com lakejoydentalcare.com
lakenonafamilydentistry.com lakenonafamilydentistry.com
familydentalcareofmedina.com familydentalcareofmedina.com
libertycommonsfamilydental.com libertycommonsfamilydental.com
littlebullrundental.com littlebullrundental.com
norfolkdentalcare.com norfolkdentalcare.com
macombdentalcenter.com macombdentalcenter.com
magnoliafamilydentistryla.com magnoliafamilydentistryla.com
mechanicsburgfamilydentistry.com mechanicsburgfamilydentistry.com
missionlakesdentalcare.com missionlakesdentalcare.com
modernsmilesdentistry.com modernsmilesdentistry.com
molinefamilydental.com molinefamilydental.com
mycharlestondentist.com mycharlestondentist.com
mydentistbartlesville.com mydentistbartlesville.com
mydentistduncan.com mydentistduncan.com
mydentistparis.com mydentistparis.com
mystonebridgedentist.com mystonebridgedentist.com
neibauerdentalcentralpark.com neibauerdentalcentralpark.com
neibauerdentaldumfries.com neibauerdentaldumfries.com
neibauerdentalgarrisonville.com neibauerdentalgarrisonville.com
neibauerdentalsouthriding.com neibauerdentalsouthriding.com
fourlakesfamilydental.com fourlakesfamilydental.com
janesvillefamilydentalcare.com janesvillefamilydentalcare.com
oakleaffamilydental.com oakleaffamilydental.com
oakleaffamilydentistry.com oakleaffamilydentistry.com
crosswaterdentalcare.com crosswaterdentalcare.com
buckcreekfamilydental.com buckcreekfamilydental.com
firstimpressionssmilecenter.com firstimpressionssmilecenter.com
palmettocoastdental.com palmettocoastdental.com
reedybranchfamilydentistry.com reedybranchfamilydentistry.com
parklandfamilydentistry.com parklandfamilydentistry.com
parksidegriffith.com parksidegriffith.com
penfielddentistry.com penfielddentistry.com
picayunedentalclinic.com picayunedentalclinic.com
poolerparkwaydentalcare.com poolerparkwaydentalcare.com
princecreekdentalcare.com princecreekdentalcare.com
quailspringsdentalcare.com quailspringsdentalcare.com
ridgepikedentalcare.com ridgepikedentalcare.com
rockinghamdentalgroupexeter.com rockinghamdentalgroupexeter.com
broadwaydentalarts.com broadwaydentalarts.com
dublindentalcenterpa.com dublindentalcenterpa.com
sawgrasscompletedentistry.com sawgrasscompletedentistry.com
smilesathunterscreek.com smilesathunterscreek.com
smilesoncypresspoint.com smilesoncypresspoint.com
smilesonnorthern.com smilesonnorthern.com
staugustinedentistry.com staugustinedentistry.com
104thfamilydental.com 104thfamilydental.com
sumterdentalcare.com sumterdentalcare.com
sunsethillsdental.com sunsethillsdental.com
thedentistplaceocala.com thedentistplaceocala.com
tracyorcharddentalcare.com tracyorcharddentalcare.com
traditionparkwaydentalcare.com traditionparkwaydentalcare.com
valleysmilesdentalcare.com valleysmilesdentalcare.com
villagecrestfamilydental.com villagecrestfamilydental.com
blossomparkdentalcare.com blossomparkdentalcare.com
bluebonnetdentalcaretx.com bluebonnetdentalcaretx.com
warnerrobinsfamilydentistry.com warnerrobinsfamilydentistry.com
wheatfamilydental.com wheatfamilydental.com
whiteriverdental.com whiteriverdental.com
willistonfamilydental.com willistonfamilydental.com
wintergardenvillagedental.com wintergardenvillagedental.com
woodmontfamilydentistry.com woodmontfamilydentistry.com
collegeavedental.com collegeavedental.com
crescenthilldentalcare.com crescenthilldentalcare.com
crossroadsdentistrytn.com crossroadsdentistrytn.com
davenportvillagedental.com davenportvillagedental.com
dellagiodentist.com dellagiodentist.com
dentalcareatcolumbuscrossing.com dentalcareatcolumbuscrossing.com
dentalcareofcolumbia.com dentalcareofcolumbia.com
dentalcareofdavenport.com dentalcareofdavenport.com
dentalcareofpflugerville.com dentalcareofpflugerville.com
dentalcareofpowell.com dentalcareofpowell.com
dentalcareonsanantonio.com dentalcareonsanantonio.com
dentaldesignslakeland.com dentaldesignslakeland.com
dentaldesignslasvegas.com dentaldesignslasvegas.com
dentalgrouprockford.com dentalgrouprockford.com
dentistinnaples.com dentistinnaples.com
dentistplymouthnh.com dentistplymouthnh.com
dicksondentalcare.com dicksondentalcare.com
familydentalcareofsmyrna.com familydentalcareofsmyrna.com
familydentalcareofowasso.com familydentalcareofowasso.com
familydentalcareofrogers.com familydentalcareofrogers.com
familydentistryofshortpump.com familydentistryofshortpump.com
familydentistryofyukon.com familydentistryofyukon.com
eaglecreekdental.com eaglecreekdental.com
edgewoodfamilydental.com edgewoodfamilydental.com
eventidefamilydentistry.com eventidefamilydentistry.com
fairfieldfamilydentaloh.com fairfieldfamilydentaloh.com
glenburniedentalcare.com glenburniedentalcare.com
glencarbonfamilydentistry.com glencarbonfamilydentistry.com
greenmountfamilydentistry.com greenmountfamilydentistry.com
greenwoodfamilydental.com greenwoodfamilydental.com
hollywoodparkdental.com hollywoodparkdental.com
islandwalkdentalcare.com islandwalkdentalcare.com
lifetimedentistryatshortpump.com lifetimedentistryatshortpump.com
limestonesmiles.com limestonesmiles.com
rockycreekdentalcare.com rockycreekdentalcare.com
burtonsvilledentalcare.com burtonsvilledentalcare.com
seasidelifetimedentistry.com seasidelifetimedentistry.com
settlerswalkdentalcare.com settlerswalkdentalcare.com
alegredentalbosque.com alegredentalbosque.com
skymarksfamilydentalcare.com skymarksfamilydentalcare.com
smilesatjulingtoncreek.com smilesatjulingtoncreek.com
smilesforliferichmond.com smilesforliferichmond.com
smilesonbeachboulevard.com smilesonbeachboulevard.com
smilestudioonline.com smilestudioonline.com
smilewright.com smilewright.com
apalacheefamilydental.com apalacheefamilydental.com
southernhillsdentalcare.com southernhillsdentalcare.com
carolinagentledental.com carolinagentledental.com
springvalleydentist.com springvalleydentist.com
stluciefamilydental.com stluciefamilydental.com
catoctincornerdentistry.com catoctincornerdentistry.com
atlanticfamilydentalfl.com atlanticfamilydentalfl.com
austellfamilydentalcare.com austellfamilydentalcare.com
baytownedentalcenter.com baytownedentalcenter.com
bearbranchdental.com bearbranchdental.com
bearcanyondental.com bearcanyondental.com
tulsahillsdentalcare.com tulsahillsdentalcare.com
vermilionfamilydental.com vermilionfamilydental.com
vieradental.com vieradental.com
villageplazadentaldesigns.com villageplazadentaldesigns.com
bocaparkdentallasvegas.com bocaparkdentallasvegas.com
bradentonsmilesdentistry.com bradentonsmilesdentistry.com
westtowndentalcaresc.com westtowndentalcaresc.com
westyorkdentalcare.com westyorkdentalcare.com
whisperingoaksfamilydental.com whisperingoaksfamilydental.com
whitehousefamilydentalcare.com whitehousefamilydentalcare.com
whiteoakdentist.com whiteoakdentist.com
whitewatervalleydental.com whitewatervalleydental.com
wiregrassfamilydentalcare.com wiregrassfamilydentalcare.com
woodlandheightsfamilydental.com woodlandheightsfamilydental.com
cartervilledental.com cartervilledental.com
cedarcreekdentalcare.com cedarcreekdentalcare.com
championsgatedentistry.com championsgatedentistry.com
comfortablecarebeeridge.com comfortablecarebeeridge.com
completedentalofeaston.com completedentalofeaston.com
cornerlakefamilydental.com cornerlakefamilydental.com
creativesmilesdentalcare.com creativesmilesdentalcare.com
creativesmilesmurfreesboro.com creativesmilesmurfreesboro.com
crestwooddentalcare.com crestwooddentalcare.com
mynorthatlantadentist.com mynorthatlantadentist.com
debarydentalcare.com debarydentalcare.com
defiancecenterfordentistry.com defiancecenterfordentistry.com
dentalartsofsayville.com dentalartsofsayville.com
dentalcareatcrystalpark.com dentalcareatcrystalpark.com
dentalcareatplainfieldcrossing.com dentalcareatplainfieldcrossing.com
dentalcareattrinitylakes.com dentalcareattrinitylakes.com
dentalcareofbellevue.com dentalcareofbellevue.com
dentalcareofdeltona.com dentalcareofdeltona.com
dentalcareoffairfield.com dentalcareoffairfield.com
dentalcareofhuntsville.com dentalcareofhuntsville.com
dentalcareoflakewylie.com dentalcareoflakewylie.com
dentalcareofnorman.com dentalcareofnorman.com
dentalcareofpearland.com dentalcareofpearland.com
dentalcareofwestmelbourne.com dentalcareofwestmelbourne.com
dentistinclearwater.com dentistinclearwater.com
dentistrypluslexington.com dentistrypluslexington.com
eastbrewsterdental.com eastbrewsterdental.com
familydentalcareofmuskego.com familydentalcareofmuskego.com
familydentalcareofpowdersville.com familydentalcareofpowdersville.com
familydentalcaresouthlakeland.com familydentalcaresouthlakeland.com
familydentalofcedarpark.com familydentalofcedarpark.com
flsmiles.com flsmiles.com
fortworthtxdentist.com fortworthtxdentist.com
gainesvillefamilydentalcare.com gainesvillefamilydentalcare.com
gainesvillesmilesdentalcare.com gainesvillesmilesdentalcare.com
gallatindentalcare.com gallatindentalcare.com
galleriadentalhenderson.com galleriadentalhenderson.com
gatewaysmilesdentistry.com gatewaysmilesdentistry.com
mycrossroadsdentist.com mycrossroadsdentist.com
mydentistftsmith.com mydentistftsmith.com
mydentistbrokenarrow.com mydentistbrokenarrow.com
greatplainsfamilydentistryenid.com greatplainsfamilydentistryenid.com
greatsouthernsmiles.com greatsouthernsmiles.com
greenhillsfamilydentistry.com greenhillsfamilydentistry.com
myontariodentist.com myontariodentist.com
hartlandfamilydentalcare.com hartlandfamilydentalcare.com
hersheydentalgroup.com hersheydentalgroup.com
hesselparkdentistry.com hesselparkdentistry.com
longwoodfamilydentistry.com longwoodfamilydentistry.com
howellbranchdentalcare.com howellbranchdentalcare.com
lakelandfldentistry.com lakelandfldentistry.com
lakepointedentistrytx.com lakepointedentistrytx.com
leevistadental.com leevistadental.com
lifetimedentalofflowermound.com lifetimedentalofflowermound.com
lifetimedentalofnorman.com lifetimedentalofnorman.com
lifetimedentistrybradenton.com lifetimedentistrybradenton.com
lifetimedentistryladylake.com lifetimedentistryladylake.com
lifetimedentistryofroyalpalm.com lifetimedentistryofroyalpalm.com
lifetimefamilydentalcare.com lifetimefamilydentalcare.com
lifetimesmilesdentalcare.com lifetimesmilesdentalcare.com
lochridgedentalcare.com lochridgedentalcare.com
mortonfamilydental.com mortonfamilydental.com
neibauerdentalharrisoncrossing.com neibauerdentalharrisoncrossing.com
oldemillfamilydental.com oldemillfamilydental.com
pebblecreekdental.com pebblecreekdental.com
rioranchodentistnm.com rioranchodentistnm.com
pompanobeachfamilydental.com pompanobeachfamilydental.com
riverviewsmilesdental.com riverviewsmilesdental.com
prestwickpointedental.com prestwickpointedental.com
reservoirdentalgroup.com reservoirdentalgroup.com
ricecreekfamilydentistry.com ricecreekfamilydentistry.com
rivercrestcommonsfamilydental.com rivercrestcommonsfamilydental.com
riversdentalcare.com riversdentalcare.com
hammondfamilydental.com hammondfamilydental.com
royaloaksdental.com royaloaksdental.com
lifetimefamilydentalva.com lifetimefamilydentalva.com
byronfamilydentalcare.com byronfamilydentalcare.com
cambridgefamilydentistry.com cambridgefamilydentistry.com
camphilldentist.com camphilldentist.com
affordabledentistryrockford.com affordabledentistryrockford.com
hamlingrovesdentalcare.com hamlingrovesdentalcare.com
alegredentalpetroglyphs.com alegredentalpetroglyphs.com
caminorealdentaltx.com caminorealdentaltx.com
siennadental.com siennadental.com
smiledesigndental.com smiledesigndental.com
smileforlifedental.com smileforlifedental.com
smilesatcarolinaforest.com smilesatcarolinaforest.com
smilesatgoosecreek.com smilesatgoosecreek.com
southlakedentalcarefl.com southlakedentalcarefl.com
southeastdentist.com southeastdentist.com
southerndentalcenter.com southerndentalcenter.com
springfielddc.com springfielddc.com
stadiumfamilydentistry.com stadiumfamilydentistry.com
casadydentalcare.com casadydentalcare.com
stluciewestdentalcare.com stluciewestdentalcare.com
stonecreekfamilydentistry.com stonecreekfamilydentistry.com
aberdeendentalcare.com aberdeendentalcare.com
sunstonedental.com sunstonedental.com
middleburgfamilydentalcare.com middleburgfamilydentalcare.com
miltonfamilydentalcare.com miltonfamilydentalcare.com
thedentistplacespringhill.com thedentistplacespringhill.com
thedentistplacespringhillkids.com thedentistplacespringhillkids.com
bayberrydental.com bayberrydental.com
beautifulsmilesbydesign.com beautifulsmilesbydesign.com
bellepointdental.com bellepointdental.com
universityfamilydentistry.com universityfamilydentistry.com
waterfordlakesdentistry.com waterfordlakesdentistry.com
yourdanvilledentist.com yourdanvilledentist.com
citrusgrovedentalcare.com citrusgrovedentalcare.com
clarksvillefamilydental.com clarksvillefamilydental.com
festusdental.com festusdental.com
coconutcreekwinningsmiles.com coconutcreekwinningsmiles.com
completedentalcaremansfield.com completedentalcaremansfield.com
completedentallakecity.com completedentallakecity.com
completedentistryestero.com completedentistryestero.com
crossroadsdentaldallas.com crossroadsdentaldallas.com
crosstimbersfamilydental.com crosstimbersfamilydental.com
ddsassociates.com ddsassociates.com
dentalcareofbixby.com dentalcareofbixby.com
dentalcareofhampton.com dentalcareofhampton.com
dentalcareofsouthaiken.com dentalcareofsouthaiken.com
dentalcareofwestminster.com dentalcareofwestminster.com
dentalcareofwestoverhills.com dentalcareofwestoverhills.com
dentistarkadelphia.com dentistarkadelphia.com
diamondvalleydental.com diamondvalleydental.com
dunedindentalcare.com dunedindentalcare.com
eastrochesterfamilydentistry.com eastrochesterfamilydentistry.com
evansvillefamilydental.com evansvillefamilydental.com
familydentalofbelair.com familydentalofbelair.com
familydentaloflexington.com familydentaloflexington.com
familydentalorlandpark.com familydentalorlandpark.com
familydentistryaustin.com familydentistryaustin.com
frontstreetfamilydentistry.com frontstreetfamilydentistry.com
harbisonhilldentistry.com harbisonhilldentistry.com
getahealthysmile.com getahealthysmile.com
granddentistryfl.com granddentistryfl.com
grandtraversedentalcare.com grandtraversedentalcare.com
greenwaycenterdentistry.com greenwaycenterdentistry.com
hanburydentalcare.com hanburydentalcare.com
hartsvilledentistsc.com hartsvilledentistsc.com
hersheyplazadental.com hersheyplazadental.com
highwaykdentalcare.com highwaykdentalcare.com
hillviewfamilydental.com hillviewfamilydental.com
honeygrovefamilydentistry.com honeygrovefamilydentistry.com
indianapolisdentaldesigns.com indianapolisdentaldesigns.com
innerharbordental.com innerharbordental.com
killianroaddentalcare.com killianroaddentalcare.com
lakegibsondental.com lakegibsondental.com
landstowndentalcare.com landstowndentalcare.com
lebanondentalcare.com lebanondentalcare.com
lifetimedentistryofportorange.com lifetimedentistryofportorange.com
lifetimestpeters.com lifetimestpeters.com
litchfieldfamilydentistry.com litchfieldfamilydentistry.com
littleroaddentalcare.com littleroaddentalcare.com
mastershanddental.com mastershanddental.com
midtowndentalcare.com midtowndentalcare.com
missionhillsdentistry.com missionhillsdentistry.com
mytotalcaredental.com mytotalcaredental.com
naturecoastdentalcare.com naturecoastdentalcare.com
neibauerdentalbowie.com neibauerdentalbowie.com
neibauerdentalcosnerscorner.com neibauerdentalcosnerscorner.com
neibauerdentalcrofton.com neibauerdentalcrofton.com
neibauerdentalhyattsville.com neibauerdentalhyattsville.com
northwestokcdentalcare.com northwestokcdentalcare.com
oakridgedentalcare.com oakridgedentalcare.com
palmcoastdentalcare.com palmcoastdentalcare.com
palmettodentalhealth.com palmettodentalhealth.com
pennpremierdental.com pennpremierdental.com
peppertreedental.com peppertreedental.com
perfectsmilesdental.com perfectsmilesdental.com
pickeringtonfamilydental.com pickeringtonfamilydental.com
quirtfamilydentistry-plover.com quirtfamilydentistry-plover.com
lakesaintlouisdentist.com lakesaintlouisdentist.com
lakesidedentalcareaz.com lakesidedentalcareaz.com
dentalcareofprincefrederick.com dentalcareofprincefrederick.com
longbowdentalcare.com longbowdentalcare.com
mahanvillagedentalcare.com mahanvillagedentalcare.com
morningsidefamilydentalil.com morningsidefamilydentalil.com
mydentistrussellville.com mydentistrussellville.com
naplespremierdentistry.com naplespremierdentistry.com
nashborovillagefamilydental.com nashborovillagefamilydental.com
neibauerdentalfalmouth.com neibauerdentalfalmouth.com
neibauerdentalfortbelvoir.com neibauerdentalfortbelvoir.com
neibauerdentalherndon.com neibauerdentalherndon.com
dentalcareatmaderavista.com dentalcareatmaderavista.com
ofallondental.com ofallondental.com
okaloosafamilydentistry.com okaloosafamilydentistry.com
oswegocommonsfamilydental.com oswegocommonsfamilydental.com
paddockplacedental.com paddockplacedental.com
dentaldesignoffortwayne.com dentaldesignoffortwayne.com
bonitaesterodental.com bonitaesterodental.com
peoriafamilydental.com peoriafamilydental.com
pickettsmilldentalcare.com pickettsmilldentalcare.com
portofinobaydentalcare.com portofinobaydentalcare.com
poughkeepsiedentalny.com poughkeepsiedentalny.com
prairielakesdentalcare.com prairielakesdentalcare.com
prairieridgedentalcare.com prairieridgedentalcare.com
prairieviewfamilydental.com prairieviewfamilydental.com
prattvilledentalcare.com prattvilledentalcare.com
pricecreekdentistry.com pricecreekdentistry.com
dentalcareofsouthelgin.com dentalcareofsouthelgin.com
richmondfamilydental.com richmondfamilydental.com
easleydentist.com easleydentist.com
dentalcareofedmond.com dentalcareofedmond.com
acworthstationdentalcare.com acworthstationdentalcare.com
sandbridgefamilydentalcare.com sandbridgefamilydentalcare.com
severnaparkdentalcare.com severnaparkdentalcare.com
southlakefamilydentalsc.com southlakefamilydentalsc.com
springridgedentalcare.com springridgedentalcare.com
stauntondentist.com stauntondentist.com
stevensonfamilydental.com stevensonfamilydental.com
sugarloaffamilydental.com sugarloaffamilydental.com
summitfairdentalcare.com summitfairdentalcare.com
audubondentalgroupmemphis.com audubondentalgroupmemphis.com
thomasvilleroaddentalcare.com thomasvilleroaddentalcare.com
tillerydentallaurel.com tillerydentallaurel.com
universityplacedental.com universityplacedental.com
washingtonfamilydentalcare.com washingtonfamilydentalcare.com
westfallschurchdental.com westfallschurchdental.com
westuniversityfamilydentistry.com westuniversityfamilydentistry.com
willowknollsdental.com willowknollsdental.com
casadysquareorthodontics.com casadysquareorthodontics.com
completedentalcarefl.com completedentalcarefl.com
completedentalcarerichmond.com completedentalcarerichmond.com
coalcreekfamilydental.com coalcreekfamilydental.com
creativesmileswinghaven.com creativesmileswinghaven.com
crowvalleydental.com crowvalleydental.com
dentalcareofgreencastle.com dentalcareofgreencastle.com
dentalcareofspringhill.com dentalcareofspringhill.com
dentalcareofstjoseph.com dentalcareofstjoseph.com
dentist-in-tulsa.com dentist-in-tulsa.com
dentistinlawton.com dentistinlawton.com
dentistryonwalnutgrove.com dentistryonwalnutgrove.com
distinctivedentalsolutions.com distinctivedentalsolutions.com
familydentalcareeastpeoria.com familydentalcareeastpeoria.com
familydentalofthornton.com familydentalofthornton.com
familydentistryofnorthlake.com familydentistryofnorthlake.com
farmingtondentalcare.com farmingtondentalcare.com
harrisonbridgedentalcare.com harrisonbridgedentalcare.com
independencefdc.com independencefdc.com
indianlakefamilydental.com indianlakefamilydental.com
lakesidedentalne.com lakesidedentalne.com
familydentalcareofolathe.com familydentalcareofolathe.com
leblancdds.com leblancdds.com
meridiandentalcentre.com meridiandentalcentre.com
meridiandentalfalcon.com meridiandentalfalcon.com
murrellsinletdentistry.com murrellsinletdentistry.com
mydentistgrandview.com mydentistgrandview.com
mydentistmuskogee.com mydentistmuskogee.com
myhighlandvillagedentist.com myhighlandvillagedentist.com
mystpetersdentist.com mystpetersdentist.com
neibauerdentaldalecity.com neibauerdentaldalecity.com
neibauerdentallaplata.com neibauerdentallaplata.com
neibauerdentalleesburg.com neibauerdentalleesburg.com
neibauerdentaloxonhill.com neibauerdentaloxonhill.com
foxlakedentalcare.com foxlakedentalcare.com
northmyrtlebeachdentistry.com northmyrtlebeachdentistry.com
northpointedentalcarein.com northpointedentalcarein.com
effinghamdentalgroup.com effinghamdentalgroup.com
oakhillsdentalcarebr.com oakhillsdentalcarebr.com
fcdentalcarewaynesboro.com fcdentalcarewaynesboro.com
papilliondentalcare.com papilliondentalcare.com
parkplacedentalin.com parkplacedentalin.com
parkwaydentalcare.com parkwaydentalcare.com
regalvalleydentalcare.com regalvalleydentalcare.com
plymouthmeetingfamilydental.com plymouthmeetingfamilydental.com
quirtfamilydentistry-merrill.com quirtfamilydentistry-merrill.com
quirtfamilydentistry-schofield.com quirtfamilydentistry-schofield.com
rayviewdentalhealth.com rayviewdentalhealth.com
highlandilfamilydentistry.com highlandilfamilydentistry.com
rollingridgedentalcare.com rollingridgedentalcare.com
affordabledentistrybloomington.com affordabledentistrybloomington.com
alliancedentalgroup.com alliancedentalgroup.com
smilesondelaware.com smilesondelaware.com
ashbyparkrestorative.com ashbyparkrestorative.com
fcdentalcarechambersburg.com fcdentalcarechambersburg.com
stmatthewsdental.com stmatthewsdental.com
adamsdentalcenter.com adamsdentalcenter.com
sunsetavenuedental.com sunsetavenuedental.com
terrehautedental.com terrehautedental.com
fortsmithsmiles.com fortsmithsmiles.com
baldwinparkfamilydental.com baldwinparkfamilydental.com
twinsburgdental.com twinsburgdental.com
unforgettablesmiles.com unforgettablesmiles.com
blackmountaindentalcare.com blackmountaindentalcare.com
villagegrovedentalcare.com villagegrovedentalcare.com
warfielddentalcenter.com warfielddentalcenter.com
waterfordfamilydentistry.com waterfordfamilydentistry.com
weatherfordcompletedental.com weatherfordcompletedental.com
westfielddentalcenter.com westfielddentalcenter.com
wheatlandfamilydental.com wheatlandfamilydental.com
brookschooldentalcare.com brookschooldentalcare.com
woodlandfamilydentalcare.com woodlandfamilydentalcare.com
champaigndentalgroup.com champaigndentalgroup.com
clairmontdentalassociates.com clairmontdentalassociates.com
creekwooddental.com creekwooddental.com
denarodentalcare.com denarodentalcare.com
dentalcareofhendersonville.com dentalcareofhendersonville.com
dentalcareofshelbyville.com dentalcareofshelbyville.com
dentalgroupspringfield.com dentalgroupspringfield.com
dentalpluslogansport.com dentalpluslogansport.com
familydentalonlouetta.com familydentalonlouetta.com
familydentistryoflargo.com familydentistryoflargo.com
edisonfamilydentalcare.com edisonfamilydentalcare.com
essingtondental.com essingtondental.com
foresidefamilydental.com foresidefamilydental.com
greatmillsfamilydental.com greatmillsfamilydental.com
greensburgdentalcare.com greensburgdentalcare.com
independencedentalcare.com independencedentalcare.com
redbirddental.com redbirddental.com
reflectiondentalwestend.com reflectiondentalwestend.com
dentalcareateldersburgcommons.com dentalcareateldersburgcommons.com
romeovillesmilesdentistry.com romeovillesmilesdentistry.com
eastsidegeneraldentistry.com eastsidegeneraldentistry.com
lortondental.com lortondental.com
advanceddentistryschaumburg.com advanceddentistryschaumburg.com
arlingtonriverfamilydental.com arlingtonriverfamilydental.com
schertzfamilydental.com schertzfamilydental.com
marketsquaredentalcare.com marketsquaredentalcare.com
signaturesmilesbroadway.com signaturesmilesbroadway.com
smilesatlakewoodranch.com smilesatlakewoodranch.com
andersonsmiles.com andersonsmiles.com
springhousefamilydentistry.com springhousefamilydentistry.com
steelyarddentalcare.com steelyarddentalcare.com
streetsofstcharlesdental.com streetsofstcharlesdental.com
suffolkcompletedentalcare.com suffolkcompletedentalcare.com
summitplazadentalcare.com summitplazadentalcare.com
beardstownfamilydental.com beardstownfamilydental.com
belltowerdentalcare.com belltowerdentalcare.com
universityparkwaydental.com universityparkwaydental.com
valleyparkdentalcare.com valleyparkdentalcare.com
valparaisodental.com valparaisodental.com
bloomingtonindentist.com bloomingtonindentist.com
wearegentledentistry.com wearegentledentistry.com
weatherfordorthodontist.net weatherfordorthodontist.net
westcapefamilydental.com westcapefamilydental.com
cambyfamilydentistry.com cambyfamilydentistry.com
caneridgedentist.com caneridgedentist.com
clermontendodontics.com clermontendodontics.com
columbiaprodental.com columbiaprodental.com
comfortablecarevenice.com comfortablecarevenice.com
cookcrossingdentalcare.com cookcrossingdentalcare.com
cottonridgedentalcare.com cottonridgedentalcare.com
crystallakedentalassociates.com crystallakedentalassociates.com
deercreekdental.com deercreekdental.com
dentalassociateswaldenwoods.com dentalassociateswaldenwoods.com
dentalcareofboilingsprings.com dentalcareofboilingsprings.com
dentalcareofgrafton.com dentalcareofgrafton.com
dentalcareofmanassas.com dentalcareofmanassas.com
dentalcareoneastmain.com dentalcareoneastmain.com
dentalgroupbloomington.com dentalgroupbloomington.com
dentalgroupbourbonnais.com dentalgroupbourbonnais.com
econriverfamilydental.com econriverfamilydental.com
familydentalcareonwashington.com familydentalcareonwashington.com
familydentistryatriversidecrossing.com familydentistryatriversidecrossing.com
familydentistryatsouthwood.com familydentistryatsouthwood.com
farabeefamilydentalcare.com farabeefamilydentalcare.com
fountainsquarefamilydental.com fountainsquarefamilydental.com
mydentistspringfield.com mydentistspringfield.com
harpethdentalcare.com harpethdentalcare.com
landmarkfamilydentalcare.com landmarkfamilydentalcare.com
londondentalcenter.com londondentalcenter.com
longcreekdentalcare.com longcreekdentalcare.com
manordentalny.com manordentalny.com
marshfielddental.com marshfielddental.com
merrillvilledental.com merrillvilledental.com
mulberrycreekdentalcare.com mulberrycreekdentalcare.com
neibauerdentalbrandywine.com neibauerdentalbrandywine.com
neibauerdentalwoodbridge.com neibauerdentalwoodbridge.com
newmarkdentalcare.com newmarkdentalcare.com
northauroradental.com northauroradental.com
northgatefamilydental.com northgatefamilydental.com
northgeorgiasmiles.com northgeorgiasmiles.com
northmayfamilydental.com northmayfamilydental.com
oakmontdentalcare.com oakmontdentalcare.com
pavilioncrossingdentalcare.com pavilioncrossingdentalcare.com
plantcitydentistry.com plantcitydentistry.com
porterdentalcenter.com porterdentalcenter.com
prairieplacefamilydental.com prairieplacefamilydental.com
raintreefamilydentalcare.com raintreefamilydentalcare.com
lincolndentalcenteril.com lincolndentalcenteril.com
sarasotacompletedental.com sarasotacompletedental.com
aestheticdentalinnovationstx.com aestheticdentalinnovationstx.com
seasonsfamilydentalcare.com seasonsfamilydentalcare.com
smiledesigndentalcenter.com smiledesigndentalcenter.com
smilesoncalumet.com smilesoncalumet.com
lifetimedentalwoodlands.com lifetimedentalwoodlands.com
andersonscdentists.com andersonscdentists.com
southbenddental.com southbenddental.com
springviewdentalcare.com springviewdentalcare.com
stonelakefamilydentistry.com stonelakefamilydentistry.com
abilenedental.com abilenedental.com
suncreekfamilydentistry.com suncreekfamilydentistry.com
tanyardspringsfamilydentistry.com tanyardspringsfamilydentistry.com
thelakesdentalcare.com thelakesdentalcare.com
bartlettdentalassociates.com bartlettdentalassociates.com
bayarbordentalcare.com bayarbordentalcare.com
beltonfamilydentalcare.com beltonfamilydentalcare.com
veronadentalcare.com veronadentalcare.com
blackmanfamilydental.com blackmanfamilydental.com
bloomingtonsmilecenter.com bloomingtonsmilecenter.com
whittakerroaddental.com whittakerroaddental.com
calcasieudentalcare.com calcasieudentalcare.com
canyonspringsfamilydental.com canyonspringsfamilydental.com
centerstreetfamilydentistry.com centerstreetfamilydentistry.com
clairmontsmiles.com clairmontsmiles.com
comfortdentistsofplantation.com comfortdentistsofplantation.com
completedentalofyork.com completedentalofyork.com
courseyfamilydental.com courseyfamilydental.com
crosspointfamilydental.com crosspointfamilydental.com
deercreekfamilydentalcare.com deercreekfamilydentalcare.com
dentalcareatprairiecrossing.com dentalcareatprairiecrossing.com
dentalcareofanthemcrossroads.com dentalcareofanthemcrossroads.com
dentalcareofharrisburg.com dentalcareofharrisburg.com
dentalcareofhuntley.com dentalcareofhuntley.com
dentalcareoysterpoint.com dentalcareoysterpoint.com
dentistryplusclarksville.com dentistryplusclarksville.com
dogwooddentalcarecarbondale.com dogwooddentalcarecarbondale.com
duckcreekfamilydental.com duckcreekfamilydental.com
electriccitydentalcare.com electriccitydentalcare.com
fairviewdentalcolumbia.com fairviewdentalcolumbia.com
familydentalcarechampaign.com familydentalcarechampaign.com
familydentalcaresiouxcity.com familydentalcaresiouxcity.com
familydentalcaresouthbradenton.com familydentalcaresouthbradenton.com
familydentistryofellisville.com familydentistryofellisville.com
geistdentalcare.com geistdentalcare.com
gibsoniadentalcare.com gibsoniadentalcare.com
greenstreetdentalcare.com greenstreetdentalcare.com
greerfamilydentalcare.com greerfamilydentalcare.com
harrisonburgsmilemakers.com harrisonburgsmilemakers.com
heartlandcrossingdentalcare.com heartlandcrossingdentalcare.com
horizondentalcenter.com horizondentalcenter.com
lakesidefamilydentistry.com lakesidefamilydentistry.com
libertydentalcaremo.com libertydentalcaremo.com
lifetimedentalatsanpedro.com lifetimedentalatsanpedro.com
mapleridgedentalcare.com mapleridgedentalcare.com
metroparkdentalarts.com metroparkdentalarts.com
monocacyriverdentalcare.com monocacyriverdentalcare.com
mydentistdurant.com mydentistdurant.com
mywildwooddentist.com mywildwooddentist.com
neibauerdentalculpeper.com neibauerdentalculpeper.com
nhdcsmiles.com nhdcsmiles.com
oakhillsfamilydental.com oakhillsfamilydental.com
oceanbaydentalcare.com oceanbaydentalcare.com
osceoladentalcare.com osceoladentalcare.com
parkwoodranchdentalcare.com parkwoodranchdentalcare.com
planosmiledesign.com planosmiledesign.com
plumdrivedental.com plumdrivedental.com
quailhollowfamilydentistry.com quailhollowfamilydentistry.com
quirtfamilydentistry-wausau.com quirtfamilydentistry-wausau.com
redrosefamilydental.com redrosefamilydental.com
littlerockdentalcare.com littlerockdentalcare.com
logmandental.com logmandental.com
logmanndental.info logmanndental.info
mdcottagegrove.com mdcottagegrove.com
mddowntownminneapolis.com mddowntownminneapolis.com
mdelkriver.com mdelkriver.com
mdmaplewood.com mdmaplewood.com
mdshakopee.com mdshakopee.com
meadowsspringdentalcare.com meadowsspringdentalcare.com
mid-delcompletedentalcare.com mid-delcompletedentalcare.com
midlothiandentist.com midlothiandentist.com
miradamarketdentalcare.com miradamarketdentalcare.com
cdserviceslanden.com cdserviceslanden.com
cdservicesfairfield.com cdservicesfairfield.com
monroegadentist.com monroegadentist.com
montvaledentalcenter.com montvaledentalcenter.com
mountainpassdentalcare.com mountainpassdentalcare.com
mountainrangedentistry.com mountainrangedentistry.com
mulberrycreekfamilydental.com mulberrycreekfamilydental.com
mvcannondds.com mvcannondds.com
mydentistclaremore.com mydentistclaremore.com
mydentistincmuskogee.com mydentistincmuskogee.com
mydentistsouthwestern.com mydentistsouthwestern.com
mydentistwichitafalls.com mydentistwichitafalls.com
neibauerdentalfairfax.com neibauerdentalfairfax.com
centennialcompletedental.com centennialcompletedental.com
dentalcareofriverbend.com dentalcareofriverbend.com
dentalcareoffuquayvarina.com dentalcareoffuquayvarina.com
dentalcareatlittleriver.com dentalcareatlittleriver.com
nonaplacedentalcare.com nonaplacedentalcare.com
dentalcareofbonaire.com dentalcareofbonaire.com
darwinfamilydentalcare.com darwinfamilydentalcare.com
pdpcentralwestend.com pdpcentralwestend.com
pdpsouthcountyfenton.com pdpsouthcountyfenton.com
fdnewberlin.com fdnewberlin.com
quirtfamilydentistry-wittenberg.com quirtfamilydentistry-wittenberg.com
redhawkdentalcare.com redhawkdentalcare.com
afiniadentaleastgate.com afiniadentaleastgate.com
abilenedental.net abilenedental.net
ruppelorthodontics.com ruppelorthodontics.com
eastavenuedentalcare.com eastavenuedentalcare.com
santacruzriverdental.com santacruzriverdental.com
afreshnewsmile.com afreshnewsmile.com
affordabledentistrychampaign.com affordabledentistrychampaign.com
armeniafamilydentalcare.com armeniafamilydentalcare.com
devinedentistrysc.com devinedentistrysc.com
embreymilldentalcare.com embreymilldentalcare.com
arnolddentist.com arnolddentist.com
smilecda.com smilecda.com
antiochdentalcare.com antiochdentalcare.com
southkiplingdentalcare.com southkiplingdentalcare.com
southpointecompletedental.com southpointecompletedental.com
statecollegedentistry.com statecollegedentistry.com
summerparkdentalcare.com summerparkdentalcare.com
sunridgedentalcareoregon.com sunridgedentalcareoregon.com
tamayadentalcare.com tamayadentalcare.com
thedeerfieldbeachdentist.com thedeerfieldbeachdentist.com
themurfreesborodentist.com themurfreesborodentist.com
badgerhillsdentalcare.com badgerhillsdentalcare.com
bakerfamilyaz.com bakerfamilyaz.com
baldwinparkfamilydentistry.com baldwinparkfamilydentistry.com
thomasrogersdds.com thomasrogersdds.com
thomastondental.com thomastondental.com
tigerdentistry.com tigerdentistry.com
banyandentalcarenaples.com banyandentalcarenaples.com
timothyroaddentalcare.com timothyroaddentalcare.com
todaysfamilydentalwaco.com todaysfamilydentalwaco.com
toledofamilydentalcare.com toledofamilydentalcare.com
baymeadowsjunctiondentalcare.com baymeadowsjunctiondentalcare.com
baysidedentalcare.com baysidedentalcare.com
tropeadentalcare.com tropeadentalcare.com
bernardrust.com bernardrust.com
bickfordfamilydentalcare.com bickfordfamilydentalcare.com
universitydrivedental.com universitydrivedental.com
bluebonnetdentalmillbrook.com bluebonnetdentalmillbrook.com
bluebonnetdentalmontgomery.com bluebonnetdentalmontgomery.com
boales.net boales.net
brennandentalgroup.com brennandentalgroup.com
westhamptondentalcare.com westhamptondentalcare.com
williamsdentistry.com williamsdentistry.com
winghavendental.com winghavendental.com
byrondentalcare.com byrondentalcare.com
carusbelton.com carusbelton.com
your-smile-team.com your-smile-team.com
cbctimaging.com cbctimaging.com
cdofsebastian.com cdofsebastian.com
cedarfamilydentistry.com cedarfamilydentistry.com
zietzdental.com zietzdental.com
champaigninvisiblebraces.com champaigninvisiblebraces.com
chapelhillfamilydentistrywa.com chapelhillfamilydentistrywa.com
chapelhillfcd.com chapelhillfcd.com
chehalisdentalcare.com chehalisdentalcare.com
colescountydental.com colescountydental.com
cosmeticdentistryforme.com cosmeticdentistryforme.com
crawfordfamilydentistry.com crawfordfamilydentistry.com
crescentspringsdentist.com crescentspringsdentist.com
croftondentalsuite.com croftondentalsuite.com
cypressdentalexcellence.com cypressdentalexcellence.com
ddsassociates.co ddsassociates.co
debarydenture.com debarydenture.com
dentalartsofoliversprings.com dentalartsofoliversprings.com
dentalcareataddisonplace.com dentalcareataddisonplace.com
dentalcareatbelmont.com dentalcareatbelmont.com
dentalcareatcartwheelbay.com dentalcareatcartwheelbay.com
dentalcareatcompasscreek.com dentalcareatcompasscreek.com
dentalcareatibis.com dentalcareatibis.com
dentalcareatloughmancrossing.com dentalcareatloughmancrossing.com
dentalcareatmillcreek.com dentalcareatmillcreek.com
dentalcareatvillagewalk.com dentalcareatvillagewalk.com
dentalcarelargo.com dentalcarelargo.com
dentalcareofclayton.com dentalcareofclayton.com
dentalcareofelkhart.com dentalcareofelkhart.com
dentalcareofhamiltonoh.com dentalcareofhamiltonoh.com
dentalcareoflehighvalley.com dentalcareoflehighvalley.com
dentalcareofminooka.com dentalcareofminooka.com
dentalcareofspringfield.com dentalcareofspringfield.com
dentalcareofveteransparkway.com dentalcareofveteransparkway.com
dentalcareofvieraeast.com dentalcareofvieraeast.com
dentalcareofwaukesha.com dentalcareofwaukesha.com
dentalcareonashleycircle.com dentalcareonashleycircle.com
dentalexcellencewaterfordlakes.com dentalexcellencewaterfordlakes.com
dentalgroupmtvernon.com dentalgroupmtvernon.com
dentalplusmadison.com dentalplusmadison.com
dentalvillageeastside.com dentalvillageeastside.com
dentalvillagegreenvalley.com dentalvillagegreenvalley.com
dentalvillagenorthwest.com dentalvillagenorthwest.com
dentisteasley.com dentisteasley.com
dentistedmondoklahoma.com dentistedmondoklahoma.com
dentistmiltonga.com dentistmiltonga.com
desertdentalsolutions.com desertdentalsolutions.com
desertpointdental.com desertpointdental.com
desertsmilesdentistry.info desertsmilesdentistry.info
desertsmilesdentistry.net desertsmilesdentistry.net
dixonparkdentalcare.com dixonparkdentalcare.com
drcalderone.com drcalderone.com
drestwani.com drestwani.com
drneal.com drneal.com
drstephenbuchanan.com drstephenbuchanan.com
eastmaindentalpa.com eastmaindentalpa.com
eastmandentalassociates.com eastmandentalassociates.com
elmoredentistry.com elmoredentistry.com
fairchildoaksdentalcare.com fairchildoaksdentalcare.com
fairviewsmilesbydesign.com fairviewsmilesbydesign.com
fairwaterdental.com fairwaterdental.com
familydentalatlakesidevillage.com familydentalatlakesidevillage.com
familydentalcareofchampaign.com familydentalcareofchampaign.com
familydentalcaresouthsheboygan.com familydentalcaresouthsheboygan.com
familydentallancaster.com familydentallancaster.com
familydentistrypoplarbluff.com familydentistrypoplarbluff.com
familyoralhealth.com familyoralhealth.com
familyorthodonticsshawnee.com familyorthodonticsshawnee.com
farabeefamilydental.com farabeefamilydental.com
farmingtondentalcarellc.com farmingtondentalcarellc.com
fdbayshore.com fdbayshore.com
fdbethesda.com fdbethesda.com
fdcolumbiaclarksville.com fdcolumbiaclarksville.com
fdkenosha.com fdkenosha.com
fdmukwonago.com fdmukwonago.com
festusdentist.com festusdentist.com
fosteringsmiles.com fosteringsmiles.com
friendlydentalcaremerrillville.com friendlydentalcaremerrillville.com
gallatinfamilydental.com gallatinfamilydental.com
georgiadentalcenter.com georgiadentalcenter.com
getahealthysmile.mobi getahealthysmile.mobi
greenhillsdental.com greenhillsdental.com
greenstreetsmiles.com greenstreetsmiles.com
happyvalleydental.com happyvalleydental.com
harborpointdentalcare.com harborpointdentalcare.com
dorseyfamilydental.com dorseyfamilydental.com
healthysmilesfamilydentistry.com healthysmilesfamilydentistry.com
hendersongalleriadental.com hendersongalleriadental.com
hendersonvilledentalcare.com hendersonvilledentalcare.com
highlandavedentistrybc.com highlandavedentistrybc.com
highlandildentist.com highlandildentist.com
indianlanddentalcare.com indianlanddentalcare.com
jjjdds.com jjjdds.com
julingtoncreekdental.com julingtoncreekdental.com
kennesawcompletedental.com kennesawcompletedental.com
dentalcareattowncenter.com dentalcareattowncenter.com
mysmartdentalchoice.com mysmartdentalchoice.com
kokosmile.com kokosmile.com
lakewyliefamilydental.com lakewyliefamilydental.com
legacydrivedental.com legacydrivedental.com
limelightdentalcare.com limelightdentalcare.com
louisvillemetrodental.com louisvillemetrodental.com
mdapplevalleycedar.com mdapplevalleycedar.com
mdblainepheasantridge.com mdblainepheasantridge.com
mdbloomington.com mdbloomington.com
mdchanhassen.com mdchanhassen.com
mdedina.com mdedina.com
mdlakeland.com mdlakeland.com
mdlakevillecedar.com mdlakevillecedar.com
mdwoodbury.com mdwoodbury.com
dentalcareatthemark.com dentalcareatthemark.com
merchantswaydentalcare.com merchantswaydentalcare.com
mesaridgedental.com mesaridgedental.com
metrodentalcareburnsville.com metrodentalcareburnsville.com
fdfranklin.com fdfranklin.com
cdofsuntree.com cdofsuntree.com
cdservicesedgewoodky.com cdservicesedgewoodky.com
mokenacrossingsfamilydental.com mokenacrossingsfamilydental.com
monocacydentalcare.com monocacydentalcare.com
montgomeryplazadental.com montgomeryplazadental.com
moultriedentalcare.com moultriedentalcare.com
mtsterlingsmiles.com mtsterlingsmiles.com
muncieplazadental.com muncieplazadental.com
mydentistdenton.com mydentistdenton.com
mydentistkansascity.com mydentistkansascity.com
mydentistmcalester.com mydentistmcalester.com
mydentistolathe.com mydentistolathe.com
mydentistsheridan.com mydentistsheridan.com
mydentistvanburen.com mydentistvanburen.com
narcoosseedentalcare.com narcoosseedentalcare.com
cdofindianharbourbeach.com cdofindianharbourbeach.com
danieladental.com danieladental.com
highlandcitydentalcare.com highlandcitydentalcare.com
dentalcareonfennell.com dentalcareonfennell.com
northcolumbusdentalcare.com northcolumbusdentalcare.com
northranchdentalcare.com northranchdentalcare.com
oakmeadowsvillagedental.com oakmeadowsvillagedental.com
okdsouthokc.com okdsouthokc.com
oldtownkatydental.com oldtownkatydental.com
olytumwaterdentist.com olytumwaterdentist.com
orthodontistinoklahomacity.com orthodontistinoklahomacity.com
dentalcareatbabcockranch.com dentalcareatbabcockranch.com
pdpwestcountyoliveblvd.com pdpwestcountyoliveblvd.com
pilotknobdentalcare.com pilotknobdentalcare.com
plantationpointedental.com plantationpointedental.com
forestvilleroaddentalcare.com forestvilleroaddentalcare.com
dentalcareatfoxbank.com dentalcareatfoxbank.com
rockrundental.com rockrundental.com
rollinghillsdentalcare.com rollinghillsdentalcare.com
areasontosmileboise.com areasontosmileboise.com
sandhilldentalcare.com sandhilldentalcare.com
advancedtechnologydentistry.com advancedtechnologydentistry.com
afiniadentalmason.com afiniadentalmason.com
affordabledentistryalton.com affordabledentistryalton.com
affordabledentistrybelleville.com affordabledentistrybelleville.com
affordabledentistryspringfield.com affordabledentistryspringfield.com
sdgaither.com sdgaither.com
secretcitydentalcare.com secretcitydentalcare.com
arlingtonriverdentalcare.com arlingtonriverdentalcare.com
capitalavenuedentalcare.com capitalavenuedentalcare.com
amberhillsfamilydental.com amberhillsfamilydental.com
smilejoplin.com smilejoplin.com
smilesforlifeorlando.com smilesforlifeorlando.com
softtouchdentistryco.com softtouchdentistryco.com
southtexassmiles.com southtexassmiles.com
springfielddentalcenter.com springfielddentalcenter.com
springridgedental.com springridgedental.com
fortsmithdentist.com fortsmithdentist.com
stcharleslifetimedental.com stcharleslifetimedental.com
sterlingcreekdentalcare.com sterlingcreekdentalcare.com
summerfielddentalcare.com summerfielddentalcare.com
admiraldentalcare.com admiraldentalcare.com
afiniadentalbridgetown.com afiniadentalbridgetown.com
apalacheedentalcare.com apalacheedentalcare.com
teelparkwaydentalcare.com teelparkwaydentalcare.com
audubondentalgroup.org audubondentalgroup.org
audubondentalgroupgermantown.com audubondentalgroupgermantown.com
tfdclintontownship.com tfdclintontownship.com
thedentalcentertx.com thedentalcentertx.com
azimplantsedation.com azimplantsedation.com
thomasvilleroaddental.com thomasvilleroaddental.com
tillerydental.com tillerydental.com
tillerydentalhattiesburg.com tillerydentalhattiesburg.com
tillerydentaltaylorsville.com tillerydentaltaylorsville.com
barracksroaddentalcare.com barracksroaddentalcare.com
beach-dental.com beach-dental.com
tramontodentistry.com tramontodentistry.com
bellairebaydentalcare.com bellairebaydentalcare.com
bloomingdaledentalcarefl.com bloomingdaledentalcarefl.com
bluebonnetdentalhattiesburg.com bluebonnetdentalhattiesburg.com
braseltondentist.com braseltondentist.com
wedgewoodsquaredental.com wedgewoodsquaredental.com
briarwoodparkdentalcare.com briarwoodparkdentalcare.com
bridgestonedentalcare.com bridgestonedentalcare.com
westcolumbiafamilydentistry.com westcolumbiafamilydentistry.com
westgatedentalcare.com westgatedentalcare.com
westridgedentalcare.com westridgedentalcare.com
broadstreetdc.com broadstreetdc.com
buttermilkfamilyandcosmeticdentistry.com buttermilkfamilyandcosmeticdentistry.com
calvertfamilydentalcare.com calvertfamilydentalcare.com
cartervilledentist.com cartervilledentist.com
carussouthcentral.com carussouthcentral.com
caruswestlake.com caruswestlake.com
cdserviceseastgate.com cdserviceseastgate.com
cedarlakesdentalcare.com cedarlakesdentalcare.com
champaignsedationdentistry.com champaignsedationdentistry.com
chesapeakecompletedentistry.com chesapeakecompletedentistry.com
churchcreekdentalcare.com churchcreekdentalcare.com
citysedgedentalcare.com citysedgedentalcare.com
clearlakecitydentistry.com clearlakecitydentistry.com
clearsmileday.com clearsmileday.com
clermontroyaloaksdental.com clermontroyaloaksdental.com
colemandental.com colemandental.com
columbinedental.com columbinedental.com
completedentalcareatwestbird.com completedentalcareatwestbird.com
concordpointfamilydentistry.com concordpointfamilydentistry.com
helenaroaddentalcare.com helenaroaddentalcare.com
conwaysmilecenter.com conwaysmilecenter.com
copperheaddentalcare.com copperheaddentalcare.com
countrysidedental.com countrysidedental.com
crescenthilldentalcaredmd.com crescenthilldentalcaredmd.com
danvillefamilydentalcare.com danvillefamilydentalcare.com
dellagiodentalcare.com dellagiodentalcare.com
dentalcareatcaseykey.com dentalcareatcaseykey.com
dentalcareatcoventry.com dentalcareatcoventry.com
dentalcareatfishhawkcommons.com dentalcareatfishhawkcommons.com
dentalcareatlivingstonmarketplace.com dentalcareatlivingstonmarketplace.com
dentalcareatoysterpoint.com dentalcareatoysterpoint.com
dentalcareatpleasanthill.com dentalcareatpleasanthill.com
dentalcareofcanandaigua.com dentalcareofcanandaigua.com
dentalcareofconcordville.com dentalcareofconcordville.com
dentalcareoflargo.com dentalcareoflargo.com
dentalcareoflehighacres.com dentalcareoflehighacres.com
dentalcareofpowdersville.com dentalcareofpowdersville.com
dentalcareonwatson.com dentalcareonwatson.com
dentalexcellencebaldwinpark.com dentalexcellencebaldwinpark.com
dentalexcellencesandlake.com dentalexcellencesandlake.com
dentalgroupchampaign.com dentalgroupchampaign.com
dentalgroupwestside.com dentalgroupwestside.com
dentalvillage.net dentalvillage.net
dentist-in-norman.com dentist-in-norman.com
dentist-in-oklahoma-city.com dentist-in-oklahoma-city.com
dentistinfayettevillear.com dentistinfayettevillear.com
dentistinnorfolk.com dentistinnorfolk.com
dentistrivercity.com dentistrivercity.com
dentistryatsmithvillemarketplace.com dentistryatsmithvillemarketplace.com
dentistryplusburlington.com dentistryplusburlington.com
dentistwestminster.com dentistwestminster.com
detwilerdental.com detwilerdental.com
familydentalcareofsouthsheboygan.com familydentalcareofsouthsheboygan.com
familydentalcareofmaplelawn.com familydentalcareofmaplelawn.com
familydentalcareofstcharles.com familydentalcareofstcharles.com
familydentalcareowasso.com familydentalcareowasso.com
familydentallakeland.com familydentallakeland.com
familydentalofmaplelawn.com familydentalofmaplelawn.com
distinctdentalsolutions.com distinctdentalsolutions.com
downtowndentaljax.com downtowndentaljax.com
drakeshiredental.com drakeshiredental.com
drbarrymanson.com drbarrymanson.com
drdanielswilliams.com drdanielswilliams.com
drjarvie.com drjarvie.com
drjasonperio.com drjasonperio.com
drnajafi.com drnajafi.com
drpattondds.com drpattondds.com
drrandalljones.com drrandalljones.com
eastridgedentalcare.com eastridgedentalcare.com
elmorefamilydentistry.com elmorefamilydentistry.com
fairwaterdentalgroup.com fairwaterdentalgroup.com
fdcchampaign.com fdcchampaign.com
fdreston.com fdreston.com
fdwaldorf.com fdwaldorf.com
fdwestallis.com fdwestallis.com
forumdentalstpeters.com forumdentalstpeters.com
fountainhillsdentistry.com fountainhillsdentistry.com
gaetaimplantdentistry.com gaetaimplantdentistry.com
gatescosmeticdentistry.com gatescosmeticdentistry.com
greenvillagedentalcare.com greenvillagedentalcare.com
happyvalleyfamilydentistry.com happyvalleyfamilydentistry.com
hazelwoodfamilydentistry.com hazelwoodfamilydentistry.com
itsasmallworlddentistry.com itsasmallworlddentistry.com
raytowndentalcaremo.com raytowndentalcaremo.com
fultonfamilydentalcare.com fultonfamilydentalcare.com
laurelviewdentistry.com laurelviewdentistry.com
dentalcareatestrellacrossroads.com dentalcareatestrellacrossroads.com
dentalcareonyellowbluff.com dentalcareonyellowbluff.com
sangredecristodentalcare.com sangredecristodentalcare.com
advanceddentalconcept.com advanceddentalconcept.com
sandalwooddentalcarefl.com sandalwooddentalcarefl.com
adcstreetsboro.com adcstreetsboro.com
savannahquartersdentalcare.com savannahquartersdentalcare.com
afiniadentalwestchester.com afiniadentalwestchester.com
affordabledentistrytoday.com affordabledentistrytoday.com
affordabledentistrywestmain.com affordabledentistrywestmain.com
affordabledentistrytampa.com affordabledentistrytampa.com
fdeldersburgsykesville.com fdeldersburgsykesville.com
altamontespringsfamilydentistry.com altamontespringsfamilydentistry.com
sheramdentistry.com sheramdentistry.com
smokyhilldental.com smokyhilldental.com
mayrivercrossingdental.com mayrivercrossingdental.com
mdrichfield.com mdrichfield.com
southwoodsdental.com southwoodsdental.com
southfarmdental.com southfarmdental.com
southleesburgdentalcare.com southleesburgdentalcare.com
southwesternfamilydental.com southwesternfamilydental.com
springfieldcompletedentistry.com springfieldcompletedentistry.com
springfielddental.com springfielddental.com
adamsdairyfamilydental.com adamsdairyfamilydental.com
summerlinfamilydental.com summerlinfamilydental.com
atlantagentledental.com atlantagentledental.com
terracinadentalcare.com terracinadentalcare.com
tfdbinghamfarms.com tfdbinghamfarms.com
tfdwarren.com tfdwarren.com
thedentistplaceorlando.com thedentistplaceorlando.com
theranchdentalcare.com theranchdentalcare.com
todaysdentistryjax.com todaysdentistryjax.com
mdosseo.com mdosseo.com
beachsidefamilydentalcare.com beachsidefamilydentalcare.com
towncenterfamilydentist.com towncenterfamilydentist.com
beautifulsmilesjacksonville.com beautifulsmilesjacksonville.com
beckcommonsdentalcare.com beckcommonsdentalcare.com
trailridgedentalcare.com trailridgedentalcare.com
trailwindsdentalcare.com trailwindsdentalcare.com
berrygooddental.com berrygooddental.com
tumwaterfamilydentistry.com tumwaterfamilydentistry.com
bigbenddentalcare.com bigbenddentalcare.com
bluebonnetdentalcare.com bluebonnetdentalcare.com
bluebonnetdentalgretna.com bluebonnetdentalgretna.com
bluebonnetdentallafayette.com bluebonnetdentallafayette.com
bluebonnetdentalnatchez.com bluebonnetdentalnatchez.com
waldorforthodontics.com waldorforthodontics.com
waterfordcenterfamilydentistry.com waterfordcenterfamilydentistry.com
waterviewtowndentalcare.com waterviewtowndentalcare.com
bourbonnaisdentist.com bourbonnaisdentist.com
bowlinggreendentist.com bowlinggreendentist.com
braseltondentalcare.com braseltondentalcare.com
brazosfamilydentistry.com brazosfamilydentistry.com
westalamodentalcare.com westalamodentalcare.com
westsidedentalcareokc.com westsidedentalcareokc.com
westvillagesdentalcare.com westvillagesdentalcare.com
whispercreekdentalcare.com whispercreekdentalcare.com
wildernessdentalcare.com wildernessdentalcare.com
windermerevillagedentalcare.com windermerevillagedentalcare.com
buttermilkdentistry.com buttermilkdentistry.com
cambydentist.com cambydentist.com
cantonsedationdentistry.com cantonsedationdentistry.com
carnesdental.com carnesdental.com
caruskingwood.com caruskingwood.com
carussalado.com carussalado.com
cdocalasouthwest.com cdocalasouthwest.com
cdservicesmilford.com cdservicesmilford.com
centerforcosmeticandfamilydentistry.com centerforcosmeticandfamilydentistry.com
centerplacedentalcare.com centerplacedentalcare.com
centralavenuedentalcare.com centralavenuedentalcare.com
cherrycreekdentalcare.com cherrycreekdentalcare.com
colonialdrivefamilydentistry.com colonialdrivefamilydentistry.com
coltoncompletedental.com coltoncompletedental.com
comfortablecare.com comfortablecare.com
completedentalcareeasley.com completedentalcareeasley.com
completedentalcareofeasley.com completedentalcareofeasley.com
completedentalofcountryside.com completedentalofcountryside.com
cornerlakedentalcare.com cornerlakedentalcare.com
crescentparkdentalcare.com crescentparkdentalcare.com
crosswaterfamilydental.com crosswaterfamilydental.com
debarydentalstudio.com debarydentalstudio.com
dentalcareatbarrowcrossing.com dentalcareatbarrowcrossing.com
dentalcareatberewick.com dentalcareatberewick.com
dentalcareatbrushprairie.com dentalcareatbrushprairie.com
dentalcareatchampionscrossing.com dentalcareatchampionscrossing.com
dentalcareateaglelanding.com dentalcareateaglelanding.com
dentalcareatharriscrossing.com dentalcareatharriscrossing.com
dentalcareatlakemoorcommons.com dentalcareatlakemoorcommons.com
dentalcareatmonumentridge.com dentalcareatmonumentridge.com
dentalcareatnapleslakes.com dentalcareatnapleslakes.com
dentalcareatprestonlegacy.com dentalcareatprestonlegacy.com
dentalcareatrosecreek.com dentalcareatrosecreek.com
dentalcareatsouthcommons.com dentalcareatsouthcommons.com
dentalcareatverona.com dentalcareatverona.com
dentalcareatwhiteeaglefl.com dentalcareatwhiteeaglefl.com
dentalcareofcanby.com dentalcareofcanby.com
dentalcareofeaglevalley.com dentalcareofeaglevalley.com
dentalcareofhoover.com dentalcareofhoover.com
dentalcareofminneola.com dentalcareofminneola.com
dentalcareofraymore.com dentalcareofraymore.com
dentalcareofsanford.com dentalcareofsanford.com
dentalcareoncookingham.com dentalcareoncookingham.com
dentalcareonnorthavenue.com dentalcareonnorthavenue.com
dentalcareonmacon.com dentalcareonmacon.com
dentalcareonparkside.com dentalcareonparkside.com
dentaldesignsoflasvegas.com dentaldesignsoflasvegas.com
dentaldownloads.com dentaldownloads.com
dentalvillageorovalley.com dentalvillageorovalley.com
dentalvillagesouthwest.com dentalvillagesouthwest.com
dentistcanton.com dentistcanton.com
dentistmanassas.com dentistmanassas.com
dentistoswego.com dentistoswego.com
dentistrybydesignchampaign.com dentistrybydesignchampaign.com
dentistwiregrass.com dentistwiregrass.com
durbincreekdentalcare.com durbincreekdentalcare.com
eagleslandingdentalcare.com eagleslandingdentalcare.com
eaststatedental.com eaststatedental.com
evansvillefamilydentistry.com evansvillefamilydentistry.com
falconpointdental.com falconpointdental.com
familydentalatwildlight.com familydentalatwildlight.com
familydentalcanton.com familydentalcanton.com
familydentalcaremaplelawn.com familydentalcaremaplelawn.com
familydentallakesidevillage.com familydentallakesidevillage.com
familydentalofpowell.com familydentalofpowell.com
familydentalofshawnee.com familydentalofshawnee.com
familydentistryforme.com familydentistryforme.com
familydentistryonfreedom.com familydentistryonfreedom.com
familyorthodonticsofolathe.com familyorthodonticsofolathe.com
farmingtondentalcentre.com farmingtondentalcentre.com
fcdentalcare.com fcdentalcare.com
fdhalescorners.com fdhalescorners.com
flowerscrossroadsdental.com flowerscrossroadsdental.com
floydsknobsdentist.com floydsknobsdentist.com
fortworthsmilestudio.com fortworthsmilestudio.com
foxwooddentalcare.com foxwooddentalcare.com
gahannadentalcare.com gahannadentalcare.com
garyefinchdds.com garyefinchdds.com
garynsteen.com garynsteen.com
genejacobsdds.com genejacobsdds.com
germantowndentalcare.com germantowndentalcare.com
getstraighterteeth.com getstraighterteeth.com
gildercreekdentalcare.com gildercreekdentalcare.com
glencarbondental.com glencarbondental.com
glencarbondentist.com glencarbondentist.com
greatsouthernsmiles.net greatsouthernsmiles.net
greatsouthernsmiles.org greatsouthernsmiles.org
greenmountdentalcare.com greenmountdentalcare.com
mirrorterracedentalcare.com mirrorterracedentalcare.com
hallscrossroadsdentalcare.com hallscrossroadsdentalcare.com
hamptonlakedentalcare.com hamptonlakedentalcare.com
hanfieldvillagedentalcare.com hanfieldvillagedentalcare.com
happyvalleydentistry.net happyvalleydentistry.net
healthysmilecare.com healthysmilecare.com
heartlandfamilydental.com heartlandfamilydental.com
hickorycommonsdentalcare.com hickorycommonsdentalcare.com
highpointedentalcare.com highpointedentalcare.com
huesdentalgroup.com huesdentalgroup.com
jeffreysorensendds.com jeffreysorensendds.com
kathleendentalcare.com kathleendentalcare.com
kingsoakdentalcare.com kingsoakdentalcare.com
lakesidedentalcenter.com lakesidedentalcenter.com
laketexomasmiles.com laketexomasmiles.com
lakewyliedentalcare.com lakewyliedentalcare.com
laneanderiksdental.com laneanderiksdental.com
ledgestonedentalcare.com ledgestonedentalcare.com
lemontreedentalcanyongolf.com lemontreedentalcanyongolf.com
marinervillagedentalcare.com marinervillagedentalcare.com
mdeaganwest.com mdeaganwest.com
mdlakevilleidealic.com mdlakevilleidealic.com
mdmaplegrovegrovecircle.com mdmaplegrovegrovecircle.com
mdwayzata.com mdwayzata.com
montgomeryfamilydentalcare.com montgomeryfamilydentalcare.com
morrisildentist.com morrisildentist.com
morrisonfamilydental.com morrisonfamilydental.com
mosaicdentalmn.com mosaicdentalmn.com
mydentistmustang.com mydentistmustang.com
mydentistnorthmay.com mydentistnorthmay.com
mydentistokc.com mydentistokc.com
mydentiststillwater.com mydentiststillwater.com
mydentistweatherfordok.com mydentistweatherfordok.com
neibauerdental.com neibauerdental.com
neibauerdentalcentreville.com neibauerdentalcentreville.com
northhilldentistry.com northhilldentistry.com
okddelcity.com okddelcity.com
okdyukon.com okdyukon.com
pdpofallon.com pdpofallon.com
pdpstcharles.com pdpstcharles.com
pdpwentzville.com pdpwentzville.com
poplartreedentalcare.com poplartreedentalcare.com
quiviradentalcare.com quiviradentalcare.com
riverbendvillagedentalcare.com riverbendvillagedentalcare.com
rivercrossingdentalcare.com rivercrossingdentalcare.com
rothdentistry.com rothdentistry.com
rousseaufd.com rousseaufd.com
sardisdentalcare.com sardisdentalcare.com
affordabledentistrynorthhershey.com affordabledentistrynorthhershey.com
affordabledentistrypeoria.com affordabledentistrypeoria.com
affordabledentistrystcharles.com affordabledentistrystcharles.com
sdgaither.info sdgaither.info
seahavendentalcare.com seahavendentalcare.com
altamontdentist.com altamontdentist.com
altamontedentistry.com altamontedentistry.com
allaspectsdental.com allaspectsdental.com
alexandriadental.com alexandriadental.com
sierrafamilydentistry.com sierrafamilydentistry.com
ashtonfamilydentistry.com ashtonfamilydentistry.com
smilesplusburlington.com smilesplusburlington.com
somerdentalcare.com somerdentalcare.com
southernwoodsdentalcare.com southernwoodsdentalcare.com
aspenviewdental.com aspenviewdental.com
awinningsmileflorida.com awinningsmileflorida.com
springwoodsmarketdentalcare.com springwoodsmarketdentalcare.com
carusgeorgetownwildwood.com carusgeorgetownwildwood.com
stewartcreekdentalcare.com stewartcreekdentalcare.com
stowepointdentalcare.com stowepointdentalcare.com
sundomecrossingdentalcare.com sundomecrossingdentalcare.com
afdcollierville.com afdcollierville.com
afdkingstonpike.com afdkingstonpike.com
afdmountaingrove.com afdmountaingrove.com
applevalleyfamilydentistrymn.com applevalleyfamilydentistrymn.com
tampabaydentist.com tampabaydentist.com
archdentalofmanhattan.com archdentalofmanhattan.com
taylorsvilledentalcarems.com taylorsvilledentalcarems.com
tfdtemperance.com tfdtemperance.com
thdentistry.com thdentistry.com
avilesdentalcare.com avilesdentalcare.com
thedentistofcolorado.com thedentistofcolorado.com
bakerroaddentalcare.com bakerroaddentalcare.com
toddleikerdds.com toddleikerdds.com
bayarbordental.com bayarbordental.com
towncenterdentistry.com towncenterdentistry.com
townecentredentalcare.com townecentredentalcare.com
beaconhillfamilydentistry.com beaconhillfamilydentistry.com
bearcanyonfamilydentistry.com bearcanyonfamilydentistry.com
beavercreekcommonsdental.com beavercreekcommonsdental.com
bedfordavenuedentistry.com bedfordavenuedentistry.com
bernwoodparkdentalcare.com bernwoodparkdentalcare.com
bigbendsquaredentalcenter.com bigbendsquaredentalcenter.com
bluebonnetdentalcarecoursey.com bluebonnetdentalcarecoursey.com
bluebonnetdentalmandeville.com bluebonnetdentalmandeville.com
bluebonnetdentalslidell.com bluebonnetdentalslidell.com
washingtonfamilydental.com washingtonfamilydental.com
breakfastpointdentalcare.com breakfastpointdentalcare.com
westbeachesdentalcare.com westbeachesdentalcare.com
wildrosedentalcare.com wildrosedentalcare.com
brookercreekdentalgroup.com brookercreekdentalgroup.com
brownstowndentalcare.com brownstowndentalcare.com
wolfcreekdental.com wolfcreekdental.com
calderonedental.com calderonedental.com
cannoncrossroadsdentalcare.com cannoncrossroadsdentalcare.com
canoecreekdentalcare.com canoecreekdentalcare.com
capegirardeaudentalcare.com capegirardeaudentalcare.com
cdservicesflorenceky.com cdservicesflorenceky.com
centerstreetdental.com centerstreetdental.com
fdracine.com fdracine.com
citrusfallsdentalcare.com citrusfallsdentalcare.com
coalmountaindentalcare.com coalmountaindentalcare.com
coddlecreekdentalcare.com coddlecreekdentalcare.com
columbuspikedentalcare.com columbuspikedentalcare.com
comfortablecarebradenton.com comfortablecarebradenton.com
completedentalofeducationhill.com completedentalofeducationhill.com
comprehensivedentalcarefl.com comprehensivedentalcarefl.com
concoursedentalcare.com concoursedentalcare.com
connertondentalcare.com connertondentalcare.com
coolidgecourtdentalcare.com coolidgecourtdentalcare.com
coolspringscosmeticdentalcare.com coolspringscosmeticdentalcare.com
coolspringsdentalcare.com coolspringsdentalcare.com
creekwooddentalbradenton.com creekwooddentalbradenton.com
crosswaterparkwaydental.com crosswaterparkwaydental.com
crosswindsdentalcare.com crosswindsdentalcare.com
debarydentalcares.com debarydentalcares.com
debarysmiles.com debarysmiles.com
dellagiodental.com dellagiodental.com
denhamspringsdentalcarela.com denhamspringsdentalcarela.com
dentalartsofaurora.com dentalartsofaurora.com
dentalartsofminneapolis.com dentalartsofminneapolis.com
dentalassociateplantcity.com dentalassociateplantcity.com
dentalcareatcollegestation.com dentalcareatcollegestation.com
dentalcareatcrosspointe.com dentalcareatcrosspointe.com
dentalcareatgatewaycommons.com dentalcareatgatewaycommons.com
dentalcareatgrandeoak.com dentalcareatgrandeoak.com
dentalcareatlandstarcommons.com dentalcareatlandstarcommons.com
dentalcareatmagnoliaplaza.com dentalcareatmagnoliaplaza.com
dentalcareatmarleysquare.com dentalcareatmarleysquare.com
dentalcareatmullinscolony.com dentalcareatmullinscolony.com
dentalcareatpalladium.com dentalcareatpalladium.com
dentalcareatprettypond.com dentalcareatprettypond.com
dentalcareatquailhollow.com dentalcareatquailhollow.com
dentalcareatsummerfieldcrossing.com dentalcareatsummerfieldcrossing.com
dentalcareattecheridge.com dentalcareattecheridge.com
dentalcareattumbleweedpass.com dentalcareattumbleweedpass.com
dentalcareatverandah.com dentalcareatverandah.com
dentalcaregroup.com dentalcaregroup.com
dentalcareofbrooklynpark.com dentalcareofbrooklynpark.com
dentalcareoffayetteville.com dentalcareoffayetteville.com
dentalcareofpalmcoast.com dentalcareofpalmcoast.com
dentalcareofpatchogue.com dentalcareofpatchogue.com
dentalcareofsherrillsford.com dentalcareofsherrillsford.com
dentalcareofwendellfalls.com dentalcareofwendellfalls.com
dentalcareofwinchester.com dentalcareofwinchester.com
dentalcareonparkview.com dentalcareonparkview.com
dentaldesignsofglenburnie.com dentaldesignsofglenburnie.com
dentalplusclarksville.com dentalplusclarksville.com
dentalpluslexington.com dentalpluslexington.com
dentalvillagecentral.com dentalvillagecentral.com
dentalvillagemarana.com dentalvillagemarana.com
dentist-in-kansas-city.com dentist-in-kansas-city.com
dentistbraselton.com dentistbraselton.com
dentistdebary.com dentistdebary.com
dentistenidok.com dentistenidok.com
dentistinmerrillville.com dentistinmerrillville.com
dentistofmaryland.com dentistofmaryland.com
dentistparkland.com dentistparkland.com
dentistryplusfranklin.com dentistryplusfranklin.com
dentistsclearwater.com dentistsclearwater.com
drycreekdentalcare.com drycreekdentalcare.com
durrdentistry.com durrdentistry.com
eastaltondentist.com eastaltondentist.com
elandentallasvegas.com elandentallasvegas.com
ellisvilledentist.com ellisvilledentist.com
exquisitedentalcareoh.com exquisitedentalcareoh.com
familydentalatdublinheights.com familydentalatdublinheights.com
familydentalcarefitchburg.com familydentalcarefitchburg.com
familydentalspringhill.com familydentalspringhill.com
familydentistryyukon.com familydentistryyukon.com
fdashburn.com fdashburn.com
fdoakcreek.com fdoakcreek.com
ivycreekdentalcare.com ivycreekdentalcare.com
gaetadental.com gaetadental.com
gattisschoolroaddental.com gattisschoolroaddental.com
greatoaksdentalcare.com greatoaksdentalcare.com
grovelanddentalcare.com grovelanddentalcare.com
gumspringsdentalcare.com gumspringsdentalcare.com
hammockgardensdentalcare.com hammockgardensdentalcare.com
hartlanddental.com hartlanddental.com
healthybrightsmiles.com healthybrightsmiles.com
heathbrookdentalcare.com heathbrookdentalcare.com
heritagedental.com heritagedental.com
herowaydentalcare.com herowaydentalcare.com
hershellgenesteeledds.com hershellgenesteeledds.com
howardshapirodds.com howardshapirodds.com
hunterscreekdentalcare.com hunterscreekdentalcare.com
imperiallakesdentalcare.com imperiallakesdentalcare.com
inoralsurgery.com inoralsurgery.com
mcalesterlifetimedentistry.com mcalesterlifetimedentistry.com
jesekseminars.com jesekseminars.com
joplinmigraineheadacheandfacialpain.com joplinmigraineheadacheandfacialpain.com
juelsdentalgroup.com juelsdentalgroup.com
lakeavenueco.com lakeavenueco.com
lakehancockdentalcare.com lakehancockdentalcare.com
lakejesupdentalcare.com lakejesupdentalcare.com
lakeridgedc.com lakeridgedc.com
lakeviewpointedentistry.com lakeviewpointedentistry.com
miramarparkwaydentalcare.com miramarparkwaydentalcare.com
logmanndental.com logmanndental.com
longcreekdentalcareil.com longcreekdentalcareil.com
loxahatcheedentalcare.com loxahatcheedentalcare.com
mainstreetdentalnh.com mainstreetdentalnh.com
mansfield-dentalcare.com mansfield-dentalcare.com
mdalbertville.com mdalbertville.com
mdapplevalleyflorencetrail.com mdapplevalleyflorencetrail.com
mdbrooklyncenter.com mdbrooklyncenter.com
mdchaska.com mdchaska.com
mdcoonrapids.com mdcoonrapids.com
mdedenprairie.com mdedenprairie.com
mdmaplegrovebasslake.com mdmaplegrovebasslake.com
mdsouthminneapolis.com mdsouthminneapolis.com
michaelmannddsandassociates.com michaelmannddsandassociates.com
midtowndentaltn.com midtowndentaltn.com
mountainlaureldentalcare.com mountainlaureldentalcare.com
mountainridgedentalcare.com mountainridgedentalcare.com
mydentistcasady.com mydentistcasady.com
mydentistharvard.com mydentistharvard.com
mydentistquivira.com mydentistquivira.com
mydentistraytown.com mydentistraytown.com
mydentistrogers.com mydentistrogers.com
mydentisttexarkana.com mydentisttexarkana.com
mymaplelawndentist.com mymaplelawndentist.com
northauroradentistaespanol.com northauroradentistaespanol.com
northwashingtondental.com northwashingtondental.com
northwestkentuckydentalcentre.com northwestkentuckydentalcentre.com
ofallonmodentistry.com ofallonmodentistry.com
palmharbordentists.com palmharbordentists.com
palmvalleydentistry.com palmvalleydentistry.com
pdpdowntown.com pdpdowntown.com
pdpnorthcounty.com pdpnorthcounty.com
pdpwestcountyoldballas.com pdpwestcountyoldballas.com
pecangrovefamilydentist.com pecangrovefamilydentist.com
pointhopedentalcaresc.com pointhopedentalcaresc.com
pontevedradental.com pontevedradental.com
prairiecrossingfamilydental.com prairiecrossingfamilydental.com
radiance-dental.com radiance-dental.com
ranaorthodontics.com ranaorthodontics.com
raytbollindds.com raytbollindds.com
reflectiondentallorton.com reflectiondentallorton.com
regalvalleydental.com regalvalleydental.com
lakestlouisdentalcare.com lakestlouisdentalcare.com
largodental.com largodental.com
hickorytreedentalcare.com hickorytreedentalcare.com
forumdentallaurie.com forumdentallaurie.com
libertytownshipdentist.com libertytownshipdentist.com
littleriverfamilydental-net.yodlesecure.com littleriverfamilydental-net.yodlesecure.com
mdburnsvilleridges.com mdburnsvilleridges.com
mdramseysunwood.com mdramseysunwood.com
mdscmaplegroveendodontics.com mdscmaplegroveendodontics.com
mdscmaplegroveoralsurgery.com mdscmaplegroveoralsurgery.com
mdscrichfieldperiodontics.com mdscrichfieldperiodontics.com
mdstpaulmidway.com mdstpaulmidway.com
milansedationdentist.com milansedationdentist.com
mustangorthodontics.com mustangorthodontics.com
mvcannon-dds.net mvcannon-dds.net
mydentistincmidtown.com mydentistincmidtown.com
mydentistincweatherford.com mydentistincweatherford.com
mydentistincwichitafalls.com mydentistincwichitafalls.com
mywhiteflintdentist.com mywhiteflintdentist.com
neibauerdentalcare.net neibauerdentalcare.net
neibauerdentalgainesville.com neibauerdentalgainesville.com
neibauerdentalgreatmills.com neibauerdentalgreatmills.com
neibauerdentalwarrenton.com neibauerdentalwarrenton.com
neshannockdental.com neshannockdental.com
newvalleydental.com newvalleydental.com
nineeaglesdentalcare.com nineeaglesdentalcare.com
lakeridgedentalcareva.com lakeridgedentalcareva.com
dentalcareatlelandtowncenter.com dentalcareatlelandtowncenter.com
nokomisdentalcare.com nokomisdentalcare.com
mdscburnsvilleperiodontics.com mdscburnsvilleperiodontics.com
northcreekvillagedental.com northcreekvillagedental.com
oakcreekfamilydental.com oakcreekfamilydental.com
orlandohotsmiles.com orlandohotsmiles.com
orlandoleevsitadental.com orlandoleevsitadental.com
osceoladentist.com osceoladentist.com
oswickdds.com oswickdds.com
owendrivefamilydental.com owendrivefamilydental.com
palmettodentalpcb.com palmettodentalpcb.com
parkstonedentalcare.com parkstonedentalcare.com
foleydentaloffice.com foleydentaloffice.com
pdpellisville.com pdpellisville.com
pdpwestcountyoldballasoralsurgery.com pdpwestcountyoldballasoralsurgery.com
pelicanparkdentalcare.com pelicanparkdentalcare.com
pelicanpreservedentalcare.com pelicanpreservedentalcare.com
pinerockdentalcare.com pinerockdentalcare.com
preservedentalcare.com preservedentalcare.com
prestigedentaldds.com prestigedentaldds.com
pustaka.io pustaka.io
quailspringsdentist.com quailspringsdentist.com
riverwooddentalcare.com riverwooddentalcare.com
rljdentalwestallis.com rljdentalwestallis.com
rockrunfamilydentistry.com rockrunfamilydentistry.com
rockinghamdentalgroup.com rockinghamdentalgroup.com
grandlelydentalcare.com grandlelydentalcare.com
dentalcareoffranklintownship.com dentalcareoffranklintownship.com
afdctn.com afdctn.com
affordabledentistrygahanna.com affordabledentistrygahanna.com
scottsburgdentalcare.com scottsburgdentalcare.com
sed8u.com sed8u.com
adcsuncity.com adcsuncity.com
sierrafamilydentistry.co sierrafamilydentistry.co
smilemagic.org smilemagic.org
smilenlr.com smilenlr.com
smilesofkaty.com smilesofkaty.com
smilesoneastbay.com smilesoneastbay.com
smithcrossingdentalcare.com smithcrossingdentalcare.com
sonrisasandsmiles.com sonrisasandsmiles.com
southbrowarddentistryandprosthodontics.com southbrowarddentistryandprosthodontics.com
southstonedentalcare.com southstonedentalcare.com
southstreetdental.com southstreetdental.com
southwestvegassmiles.com southwestvegassmiles.com
starrsmilldentalcare.com starrsmilldentalcare.com
stjosephmodentistry.com stjosephmodentistry.com
sugarloaffamilydental.net sugarloaffamilydental.net
adctucsonsouthmission.com adctucsonsouthmission.com
suncreekfamilydentistry.net suncreekfamilydentistry.net
supreetnagi.net supreetnagi.net
suwaneedental.com suwaneedental.com
suwaneedentalcare.com suwaneedentalcare.com
suwaneegadentist.com suwaneegadentist.com
tannencosmeticdentistry.com tannencosmeticdentistry.com
autumndentalnc.com autumndentalnc.com
tfdcrystallake.com tfdcrystallake.com
tfdelmwoodpark.com tfdelmwoodpark.com
tfdlivonia.com tfdlivonia.com
tfdsouthfield.com tfdsouthfield.com
thebaldwinparkdentist.com thebaldwinparkdentist.com
themilldentalcare.com themilldentalcare.com
thundermountaindentistry.net thundermountaindentistry.net
timberspringsdentalcare.com timberspringsdentalcare.com
bayareadentalcaretx.com bayareadentalcaretx.com
baysidedentalcareal-net.yodlesecure.com baysidedentalcareal-net.yodlesecure.com
towncenterdentalcaremn.com towncenterdentalcaremn.com
tracyorcharddentalcare.net tracyorcharddentalcare.net
bluemountaindentalcare.com bluemountaindentalcare.com
bocaparkdental.com bocaparkdental.com
waldorfdentist.com waldorfdentist.com
walkerdentalcaremi.com walkerdentalcaremi.com
bonitaesterodentalgroup.com bonitaesterodentalgroup.com
wearegentledentistry.net wearegentledentistry.net
wdentalgroup.com wdentalgroup.com
weekiwacheedentalcare.com weekiwacheedentalcare.com
brennandentistry.info brennandentistry.info
westlakesdentalcare.com westlakesdentalcare.com
wesed8u.com wesed8u.com
westtowndentalcaresc.net westtowndentalcaresc.net
buffalovalleydentalcare.com buffalovalleydentalcare.com
canyoncreekfamily.com canyoncreekfamily.com
completedentalatgovernmentcenterclinic.com completedentalatgovernmentcenterclinic.com
completedentistryofyork.com completedentistryofyork.com
carushutto.com carushutto.com
carussurgicalcenterwestlake.com carussurgicalcenterwestlake.com
yourraleighdentist.com yourraleighdentist.com
youngsvilledentalcare.com youngsvilledentalcare.com
casonlanedentalcare.com casonlanedentalcare.com
ypsilantisedationdentistry.com ypsilantisedationdentistry.com
cdatpaddockpark.com cdatpaddockpark.com
cdofmeadowcrest.com cdofmeadowcrest.com
cdserviceswhiteoak.com cdserviceswhiteoak.com
chdnhuntingdon.com chdnhuntingdon.com
completesmilestx.com completesmilestx.com
citrusgrovefamilydental.com citrusgrovefamilydental.com
comfortablecareclearwater.com comfortablecareclearwater.com
comfortablecareicot.com comfortablecareicot.com
cosmeticdentistryglendale.com cosmeticdentistryglendale.com
cosmeticdentistryofflorida.com cosmeticdentistryofflorida.com
cosmeticdentistryofnaples.com cosmeticdentistryofnaples.com
crescenthilldental.net crescenthilldental.net
crystalcitysmileforlife.com crystalcitysmileforlife.com
deerwoodorthofranklin.com deerwoodorthofranklin.com
deerwoodorthoracine.com deerwoodorthoracine.com
dentalcareatcrosscreekranch.com dentalcareatcrosscreekranch.com
dentalcareatnorthpoint.com dentalcareatnorthpoint.com
dentalcareato-townwest.com dentalcareato-townwest.com
dentalcareatroyalcreek.com dentalcareatroyalcreek.com
dentalcareerfair.com dentalcareerfair.com
dentalcareofaloma.com dentalcareofaloma.com
dentalcareofbryan.com dentalcareofbryan.com
dentalcareofcitrusgroves.com dentalcareofcitrusgroves.com
dentalcareoflakewoodranch.com dentalcareoflakewoodranch.com
dentalcareofnorthfortmyers.com dentalcareofnorthfortmyers.com
dentalcareofwhisperingpines.com dentalcareofwhisperingpines.com
dentaldesignsofplantation.net dentaldesignsofplantation.net
dentalplusburlington.com dentalplusburlington.com
dentistinmidwestcity.com dentistinmidwestcity.com
dentistinmwc.com dentistinmwc.com
dentistryplusmadison.com dentistryplusmadison.com
lwssredmill.com lwssredmill.com
downtowndentalassociatesfl.com downtowndentalassociatesfl.com
dradentist.com dradentist.com
eastbroadfamilydentistry.net eastbroadfamilydentistry.net
familydentalcareofspringvalley.com familydentalcareofspringvalley.com
familydentalcaresiouxcity.net familydentalcaresiouxcity.net
familydentalwilmington.com familydentalwilmington.com
familydentistryaustin.net familydentistryaustin.net
fcdentalcarechambersburg.net fcdentalcarechambersburg.net
fdglendale.com fdglendale.com
fdmuskego.com fdmuskego.com
fdsunprairie.com fdsunprairie.com
friendlydentalmerrillville.com friendlydentalmerrillville.com
galbreathdds.com galbreathdds.com
greaterpittsburghdentalgroup.com greaterpittsburghdentalgroup.com
greensdental.com greensdental.com
griffithdentist.com griffithdentist.com
grmetrodental.com grmetrodental.com
hammondinfamilydentistry.com hammondinfamilydentistry.com
heartlandfamilydentalcare.net heartlandfamilydentalcare.net
independencedentalcare.net independencedentalcare.net
indianriverdentistry.info indianriverdentistry.info
dentalcarecamden.com dentalcarecamden.com
killeendentalhealthcenter.com killeendentalhealthcenter.com
mdminnetonka.com mdminnetonka.com
familydentalabq.com familydentalabq.com
advanceddentistryatwindhaven.com advanceddentistryatwindhaven.com
dentalcareatvenicegardens.com dentalcareatvenicegardens.com
hernandosmiles.com hernandosmiles.com
caneycrossingdentalcare.com caneycrossingdentalcare.com
bedfordpasmiles.com bedfordpasmiles.com
lwssfirstcolonial.com lwssfirstcolonial.com
carusgeorgetownuniversity.com carusgeorgetownuniversity.com
caruswoodlands.com caruswoodlands.com
dentalcareatpolarispointe.com dentalcareatpolarispointe.com
cdofviera.com cdofviera.com
dentalcareatwardlake.com dentalcareatwardlake.com
cdsebastianhighway.com cdsebastianhighway.com
dentalcareonquebec.com dentalcareonquebec.com
chdpittsburghsqhill.com chdpittsburghsqhill.com
dentalcareofelkton.com dentalcareofelkton.com
completedentalcaresouthflorida.com completedentalcaresouthflorida.com
completedentalatlakeside.com completedentalatlakeside.com
fdmequon.com fdmequon.com
lorraineroaddentalcare.com lorraineroaddentalcare.com
dentalcareofcrossville.com dentalcareofcrossville.com
holmestowncommonsdentalcare.com holmestowncommonsdentalcare.com
aviddentallindenhurst.com aviddentallindenhurst.com
forumdentalstlouis.com forumdentalstlouis.com
hiddencreekpremierdentistry.com hiddencreekpremierdentistry.com
dentaldesignsonpoplar.com dentaldesignsonpoplar.com
dentalcarebeyondsmiles.com dentalcarebeyondsmiles.com
dentistgainesvilletx.com dentistgainesvilletx.com
kokopellifamilydentistry.com kokopellifamilydentistry.com
kokosmiles.com kokosmiles.com
kruyerdental.com kruyerdental.com
lakemionadentistry.com lakemionadentistry.com
lansingelitedentist.com lansingelitedentist.com
fdbrowndeer.com fdbrowndeer.com
legacydentalcareofplano.com legacydentalcareofplano.com
lexingtondentists.com lexingtondentists.com
lochridgedentalcare.net lochridgedentalcare.net
mdblaine.com mdblaine.com
mdroseville.com mdroseville.com
mdstpauloralsurgery.com mdstpauloralsurgery.com
dentalcareatstarkeyranch.com dentalcareatstarkeyranch.com
mosaicdentalridges.com mosaicdentalridges.com
mousecreekdentalcare.com mousecreekdentalcare.com
mydentistinckansascity.com mydentistinckansascity.com
mydentistincmustangorthodontics.com mydentistincmustangorthodontics.com
mydentistshawnee.com mydentistshawnee.com
mydesertdental.com mydesertdental.com
nagi.me nagi.me
ndcdental.com ndcdental.com
neibauerdentaloxonhill.net neibauerdentaloxonhill.net
newtowndentalarts.net newtowndentalarts.net
fddelafield.com fddelafield.com
afdsouthaven.com afdsouthaven.com
northbullittfamilydental.com northbullittfamilydental.com
northhillsfamilydental.com northhillsfamilydental.com
northloopfd.com northloopfd.com
northportoralsurgeryanddentalcare.com northportoralsurgeryanddentalcare.com
northspringsdentalcare.com northspringsdentalcare.com
oakvalleydentalcare.com oakvalleydentalcare.com
eastsandidgedental.com eastsandidgedental.com
mountainstatedentalcare.com mountainstatedentalcare.com
carussurgicalcenterwoodlands.com carussurgicalcenterwoodlands.com
olatheorthodontics.net olatheorthodontics.net
deerwoodorthomenomoneefalls.com deerwoodorthomenomoneefalls.com
morgantonparkdentalcare.com morgantonparkdentalcare.com
pacedentalcare.com pacedentalcare.com
paddockdentist.com paddockdentist.com
palmroyaldentalcare.com palmroyaldentalcare.com
redwingdentalcare.com redwingdentalcare.com
panorafamilydentistry.com panorafamilydentistry.com
parkwayvillagedentalcare.com parkwayvillagedentalcare.com
parsi-osorio.com parsi-osorio.com
dentalcareofmilford.com dentalcareofmilford.com
pennpremierdental.net pennpremierdental.net
peoriasmiledesign.com peoriasmiledesign.com
relaxdentistrichmond.com relaxdentistrichmond.com
pinehavendentalcare.com pinehavendentalcare.com
plazahealthdentistry.com plazahealthdentistry.com
pointerfamilydental.com pointerfamilydental.com
prairiecrossingdentalcare.com prairiecrossingdentalcare.com
prestondentalcenter.com prestondentalcenter.com
prestwoodcompletedentalcare.com prestwoodcompletedentalcare.com
dentalcareofsouthernpalm.com dentalcareofsouthernpalm.com
rahndentalgroup.com rahndentalgroup.com
richardwallacedds.com richardwallacedds.com
ridgefieldvillagedentalcare.com ridgefieldvillagedentalcare.com
ridgeviewfamilydental.com ridgeviewfamilydental.com
gavilanpeakdentalcare.com gavilanpeakdentalcare.com
360dentaltulsa.com 360dentaltulsa.com
dentalcareatelliscrossing.com dentalcareatelliscrossing.com
rljdentalappleton.com rljdentalappleton.com
rljdentalneenah.com rljdentalneenah.com
rljdentaloshkosh.com rljdentaloshkosh.com
saintandrewsdentalcare.com saintandrewsdentalcare.com
salemdentalcareva.com salemdentalcareva.com
sanantonio-dentistry.com sanantonio-dentistry.com
sandoakdentalcare.com sandoakdentalcare.com
santanvalleydentalcare.com santanvalleydentalcare.com
sayebrookdentalcare.com sayebrookdentalcare.com
afdeastmemphiskirby.com afdeastmemphiskirby.com
seamsporu.online seamsporu.online
adcchandler.com adcchandler.com
smilecenterofcoralgables.com smilecenterofcoralgables.com
smiledesignpeoria.com smiledesignpeoria.com
smilescience.net smilescience.net
smilesthatimpress.com smilesthatimpress.com
southcarolinadentalcenter.com southcarolinadentalcenter.com
southsheboygandentist.com southsheboygandentist.com
southwestdentalcaremn.com southwestdentalcaremn.com
springfieldmodentist.com springfieldmodentist.com
springfieldsedationdentistry.com springfieldsedationdentistry.com
stevenscrossingdentalcare.com stevenscrossingdentalcare.com
stratforddental.com stratforddental.com
adctucsonnorthcampbell.com adctucsonnorthcampbell.com
sunstonedentalcare.com sunstonedentalcare.com
enclavedentalcare.com enclavedentalcare.com
supreetnagi.com supreetnagi.com
swanlakedentalcare.com swanlakedentalcare.com
afdcordova.com afdcordova.com
tampabaydentistarmenia.com tampabaydentistarmenia.com
tenderdentalcare.com tenderdentalcare.com
texasbluebonnetdental.com texasbluebonnetdental.com
tfdbeecher.com tfdbeecher.com
tfdfenton.com tfdfenton.com
tfdflossmoor.com tfdflossmoor.com
tfdnaperville.com tfdnaperville.com
tfdpaloshills.com tfdpaloshills.com
thedentistplacelakelandkids.com thedentistplacelakelandkids.com
babineausmiles.net babineausmiles.net
toddstooth.com toddstooth.com
totalhealthdentistry.net totalhealthdentistry.net
tramontofamilydentistry.com tramontofamilydentistry.com
treasurecoastfamilydental.com treasurecoastfamilydental.com
vermillionfamilydental.com vermillionfamilydental.com
veronadentalcare.net veronadentalcare.net
veronapadentalcare.net veronapadentalcare.net
boggycreekdentalcare.com boggycreekdentalcare.com
wakeforestdentalarts.com wakeforestdentalarts.com
wearegentledentistry-net.yodlesecure.com wearegentledentistry-net.yodlesecure.com
albertvillefamilydental.com albertvillefamilydental.com
westenddentalcarewi.com westenddentalcarewi.com
westminsterfamilydentalcare.com westminsterfamilydentalcare.com
broadmoordental.com broadmoordental.com
wildernesscanyondentalcare.com wildernesscanyondentalcare.com
willowbenddental.com willowbenddental.com
wimaumadentalcare.com wimaumadentalcare.com
williamsburgcosmeticdentistry.com williamsburgcosmeticdentistry.com
wiregrassfamilydentalcare.net wiregrassfamilydentalcare.net
winghavensmiles.com winghavensmiles.com
caneridgedentist.net caneridgedentist.net
carusorthosanmarcos.com carusorthosanmarcos.com
carussurgicalcenterkilleen.com carussurgicalcenterkilleen.com
carussurgicalcentersanmarcos.com carussurgicalcentersanmarcos.com
cdbelleview.com cdbelleview.com
chaddsforddentist.com chaddsforddentist.com
champaignsedationdentist.com champaignsedationdentist.com
chdcranberrycommons.com chdcranberrycommons.com
chdmonroeville.com chdmonroeville.com
completedentalcareofnaples.com completedentalcareofnaples.com
completedentalcareofrichmond.com completedentalcareofrichmond.com
completedentaloffrankfort.com completedentaloffrankfort.com
completefamilydental.com completefamilydental.com
mdscrichfieldendodontics.com mdscrichfieldendodontics.com
coolspringscosmeticdentistry.com coolspringscosmeticdentistry.com
countryclubdentalcareil.com countryclubdentalcareil.com
creativesmileschampaign.net creativesmileschampaign.net
creativesmilesdentalwinghaven.com creativesmilesdentalwinghaven.com
creeksidedentalcaretx.com creeksidedentalcaretx.com
crowfielddental.com crowfielddental.com
cypresscreekdentalcarefl.com cypresscreekdentalcarefl.com
lwsssuffolk.com lwsssuffolk.com
daltongadentist.com daltongadentist.com
deerwoodorthojanesville.com deerwoodorthojanesville.com
deerwoodorthosunprairie.com deerwoodorthosunprairie.com
dentalcareatavalonpark.com dentalcareatavalonpark.com
dentalcareatmillscrossing.com dentalcareatmillscrossing.com
dentalcareatthelanding.com dentalcareatthelanding.com
dentalcarenorman.com dentalcarenorman.com
dentalcareofboilingsprings.net dentalcareofboilingsprings.net
dentalcareofleevillage.com dentalcareofleevillage.com
dentalcareofsouthpuyallup.com dentalcareofsouthpuyallup.com
dentalsolutions.online dentalsolutions.online
dentistaiken.com dentistaiken.com
dentistryetcmi.com dentistryetcmi.com
dentistslargo.com dentistslargo.com
dfwdentalcare.com dfwdentalcare.com
familydentalcareofbelton.com familydentalcareofbelton.com
familydentalofcedarpark.net familydentalofcedarpark.net
drgregjohnson.com drgregjohnson.com
drhershellgenesteele.com drhershellgenesteele.com
drklemma.net drklemma.net
eaststatedentalcare.com eaststatedentalcare.com
eastviewfamilydentalne.com eastviewfamilydentalne.com
follyroaddentalcare.com follyroaddentalcare.com
exceldentalaustin.com exceldentalaustin.com
fdpewaukee.com fdpewaukee.com
lwsskempsvilleortho.com lwsskempsvilleortho.com
forumdentalrolla.com forumdentalrolla.com
gatescosmeticdentistry.net gatescosmeticdentistry.net
gatewayfd.com gatewayfd.com
getahealthysmile-nh-net.yodlesecure.com getahealthysmile-nh-net.yodlesecure.com
getahealthysmile-nh.net getahealthysmile-nh.net
happyvalleydentistry-net.yodlesecure.com happyvalleydentistry-net.yodlesecure.com
happyvalleyfamilydental.com happyvalleyfamilydental.com
fdgreenbay.com fdgreenbay.com
heartoftexasperioandimplantology.com heartoftexasperioandimplantology.com
hershellgenesteeleddspa.com hershellgenesteeleddspa.com
highwinddentalcare.com highwinddentalcare.com
indianlandscdentist.com indianlandscdentist.com
innovativedentalcareofshorewood.com innovativedentalcareofshorewood.com
jesek.com jesek.com
creatingsmilescfd.com creatingsmilescfd.com
dentalcareatalamancecrossing.com dentalcareatalamancecrossing.com
forthamerdentalcare.com forthamerdentalcare.com
macedoniadentalarts.com macedoniadentalarts.com
capstonedentalnc.com capstonedentalnc.com
caruskilleen.com caruskilleen.com
carusorthowestlake.com carusorthowestlake.com
carusnorthaustinmedicalcenter.com carusnorthaustinmedicalcenter.com
idealdentistryfl.com idealdentistryfl.com
cdserviceswestchester.com cdserviceswestchester.com
certusdentalcare.com certusdentalcare.com
dentalcareofpewaukee.com dentalcareofpewaukee.com
churchvillefamilydentistry.com churchvillefamilydentistry.com
citysmilesdc.com citysmilesdc.com
fdjanesville.com fdjanesville.com
fdwaukeshastoneridge.com fdwaukeshastoneridge.com
dentalcareatmidpoint.com dentalcareatmidpoint.com
lifetimedentalcareoffrostburg.com lifetimedentalcareoffrostburg.com
mdweststpaul.com mdweststpaul.com
deerwoodorthoappleton.com deerwoodorthoappleton.com
innovativedentalcareofmuncie.com innovativedentalcareofmuncie.com
mosaicdentalnicollet.com mosaicdentalnicollet.com
dentalcareatgastonday.com dentalcareatgastonday.com
ducktowndentalcare.com ducktowndentalcare.com
rayviewdentalgroup.com rayviewdentalgroup.com
reinitzdental.com reinitzdental.com
renaissanceaestheticdentistry.com renaissanceaestheticdentistry.com
archdental.com archdental.com
1stadvantagedentalqueensbury.com 1stadvantagedentalqueensbury.com
rljdentalmenasha.com rljdentalmenasha.com
roanokerapidsdentalcare.com roanokerapidsdentalcare.com
rockymountsmilemakers.com rockymountsmilemakers.com
royalpalmdentist.com royalpalmdentist.com
russellvilledentalgroup.com russellvilledentalgroup.com
saladocreekfamilydental.com saladocreekfamilydental.com
adcglendalewestbell.com adcglendalewestbell.com
sdshouston.com sdshouston.com
shadybrookfamilydental.com shadybrookfamilydental.com
alfaindentistry.com alfaindentistry.com
adctucsoneastcarondelet.com adctucsoneastcarondelet.com
signaturesmilesbrighton.com signaturesmilesbrighton.com
signaturesmilesmi.com signaturesmilesmi.com
americanfamilydental.com americanfamilydental.com
sixmilecypressdentalcare.com sixmilecypressdentalcare.com
anderson-dental.com anderson-dental.com
mdinvergroveheights.com mdinvergroveheights.com
advanceddentistrylecanto.com advanceddentistrylecanto.com
ssdgsmiles.com ssdgsmiles.com
ascotaesthetics.com ascotaesthetics.com
staugustinedentistry.net staugustinedentistry.net
stauntondentalcare.com stauntondentalcare.com
stonebridgeranchsmiles.com stonebridgeranchsmiles.com
summerlindentalcare.com summerlindentalcare.com
swordsfamilydentalcare.com swordsfamilydentalcare.com
afdolivebranch.com afdolivebranch.com
afdmemphispoplar.com afdmemphispoplar.com
afdgermantown.com afdgermantown.com
tamiamitraildentalcare.com tamiamitraildentalcare.com
austellfamilydentistry.com austellfamilydentistry.com
tennysonlakedental.com tennysonlakedental.com
tfdjoliet.com tfdjoliet.com
tfdtrenton.com tfdtrenton.com
thedentistplacelakeland.com thedentistplacelakeland.com
threeriversdental.com threeriversdental.com
tmjexperts.com tmjexperts.com
tomokafamilydentistry-net.yodlesecure.com tomokafamilydentistry-net.yodlesecure.com
berkshiredentalgroup.com berkshiredentalgroup.com
tulsahillsdentistry.com tulsahillsdentistry.com
universityparkwaydentalcare.com universityparkwaydentalcare.com
waldorforthodonticsmd.com waldorforthodonticsmd.com
watertowerdentalcareco.com watertowerdentalcareco.com
bowlinggreenfamilydentistry.com bowlinggreenfamilydentistry.com
bradfordvilledentalcare.com bradfordvilledentalcare.com
westpascodental.com westpascodental.com
whiteoakdentalcaretx.com whiteoakdentalcaretx.com
whiteoakdentistry.com whiteoakdentistry.com
williamsonroaddentalcare.com williamsonroaddentalcare.com
woodlanddentalcarefl.com woodlanddentalcarefl.com
cambyfamilydentistry.net cambyfamilydentistry.net
carpenterdentist.com carpenterdentist.com
cartydmd.com cartydmd.com
caruskidskilleendentistry.com caruskidskilleendentistry.com
carusroundrock.com carusroundrock.com
carussanmarcos.com carussanmarcos.com
your-smile-team.net your-smile-team.net
ypsilantitownshipdentist.com ypsilantitownshipdentist.com
reservoircommonsdental.com reservoircommonsdental.com
chdhomercity.com chdhomercity.com
chdindiana.com chdindiana.com
chdjohnstownrichland.com chdjohnstownrichland.com
chdmccandlesscovenant.com chdmccandlesscovenant.com
chdmtpleasant.com chdmtpleasant.com
chdmurrysville.com chdmurrysville.com
chdpittsburghshadyside.com chdpittsburghshadyside.com
choosemoderndentistry.com choosemoderndentistry.com
clairmontcosmeticdentistry.com clairmontcosmeticdentistry.com
coastalcarolinadentalcare.com coastalcarolinadentalcare.com
coastaldentalcareofmilford.com coastaldentalcareofmilford.com
coconutcreekwinningsmiles.net coconutcreekwinningsmiles.net
colonialdrivefamilydentistry.net colonialdrivefamilydentistry.net
comfortablecareoaks.com comfortablecareoaks.com
creativesmileschampaign-net.yodlesecure.com creativesmileschampaign-net.yodlesecure.com
deerwoodorthostoneridge.com deerwoodorthostoneridge.com
delanydentalimplants.com delanydentalimplants.com
dentalcareatbentslanding.com dentalcareatbentslanding.com
dentalcareathuntersgreen.com dentalcareathuntersgreen.com
dentalcareatlakeshores.com dentalcareatlakeshores.com
dentalcareatwinnowingway.com dentalcareatwinnowingway.com
dentalcaregreencastle.com dentalcaregreencastle.com
dentalcareofcarypark.com dentalcareofcarypark.com
dentalcareofedmonds.com dentalcareofedmonds.com
dentalcareofsantanvalley.com dentalcareofsantanvalley.com
dentalcareonbryant.com dentalcareonbryant.com
dentalcosmeticcenterbayarea.com dentalcosmeticcenterbayarea.com
dentaldesignsofplantation.com dentaldesignsofplantation.com
dentalemergencynh.com dentalemergencynh.com
dentalimplantnorthernkentucky.com dentalimplantnorthernkentucky.com
dentistingainesvillega.mobi dentistingainesvillega.mobi
dentistinlasvegasnv.com dentistinlasvegasnv.com
dentistlasvegastowncenter.com dentistlasvegastowncenter.com
dentistspringdalear.com dentistspringdalear.com
dentisttulsaoklahoma.com dentisttulsaoklahoma.com
drmasondmd.com drmasondmd.com
econriverdentalcare.com econriverdentalcare.com
energysquaredental.com energysquaredental.com
falconpointdentalcare.com falconpointdentalcare.com
familydentalmaplelawn.com familydentalmaplelawn.com
familydentalofspringhill.com familydentalofspringhill.com
familydentistlakeland.com familydentistlakeland.com
familydentistrymesa.com familydentistrymesa.com
fdgreenbaydevelopmentdrive.com fdgreenbaydevelopmentdrive.com
haynesbridgedentalcare.com haynesbridgedentalcare.com
greenvilledentistsc.com greenvilledentistsc.com
gwinnettdentist.com gwinnettdentist.com
harpethdentalcare.net harpethdentalcare.net
heightsdc.com heightsdc.com
hersheycosmeticdentist.com hersheycosmeticdentist.com
myvicksburgdentist.com myvicksburgdentist.com
adcorthoglendale.com adcorthoglendale.com
hoptowndental.com hoptowndental.com
horizondentalcenter.net horizondentalcenter.net
johnsdentistry.com johnsdentistry.com
indianrivercountyfloridadentist.biz indianrivercountyfloridadentist.biz
indianrivercountyfloridadentist.info indianrivercountyfloridadentist.info
longstonplacedental.com longstonplacedental.com
islandbayfamilydentistry.com islandbayfamilydentistry.com
jollyvilledental.com jollyvilledental.com
dentalcareattheplex.com dentalcareattheplex.com
katyfamilydentists.com katyfamilydentists.com
klintdds.com klintdds.com
lakesidedentaltuscaloosa.com lakesidedentaltuscaloosa.com
fdbrookfield.com fdbrookfield.com
lasvegasbocaparkdental.com lasvegasbocaparkdental.com
laureldentists.com laureldentists.com
lifetimesmilesdental.com lifetimesmilesdental.com
livoniadentalcare.com livoniadentalcare.com
loganavenuedental.com loganavenuedental.com
marketplace-dental.net marketplace-dental.net
marketplacedental.com marketplacedental.com
mdegansavage.com mdegansavage.com
mdscburnsvilleendodontics.com mdscburnsvilleendodontics.com
mdscburnsvilleoralsurgery.com mdscburnsvilleoralsurgery.com
allsmilesnw.com allsmilesnw.com
metromndental.com metromndental.com
millbrookdentalcare.com millbrookdentalcare.com
mtvernondentist.com mtvernondentist.com
mydentistinc.com mydentistinc.com
mydentistincmuskogee-com.yodlesecure.com mydentistincmuskogee-com.yodlesecure.com
mydentistincnorman.com mydentistincnorman.com
mydentistincspringfield.com mydentistincspringfield.com
mydentistmeridian.com mydentistmeridian.com
mydentistsapulpa.com mydentistsapulpa.com
nashborovillagedental.com nashborovillagedental.com
nexusdental.com nexusdental.com
northatlantadentistry.com northatlantadentistry.com
northbrowarddentalcare.com northbrowarddentalcare.com
northpointedentalcarein.net northpointedentalcarein.net
northtarrantdentalcare.com northtarrantdentalcare.com
oakopeningsdental.com oakopeningsdental.com
ofallonfamilydental.net ofallonfamilydental.net
afdbartlett.com afdbartlett.com
carustemple.com carustemple.com
oldetownlaureldental.com oldetownlaureldental.com
oldkingsdentalcare.com oldkingsdentalcare.com
deerwoodorthogreenbay.com deerwoodorthogreenbay.com
kenmoredentistry.com kenmoredentistry.com
orchardvalleydentalaurora.com orchardvalleydentalaurora.com
orlandodentistleevista.com orlandodentistleevista.com
oswegocommonsfamilydental.net oswegocommonsfamilydental.net
panamacitysmiles.com panamacitysmiles.com
panolafamilydental.com panolafamilydental.com
parkridgedentalcarefl.com parkridgedentalcarefl.com
pdpchesterfield.com pdpchesterfield.com
dentalcareatgordencrossing.com dentalcareatgordencrossing.com
perfectsmilesdental.net perfectsmilesdental.net
lakewestdental.com lakewestdental.com
pinearbordentalcare.com pinearbordentalcare.com
pleasentdentistry.com pleasentdentistry.com
plesantdentistry.com plesantdentistry.com
pmfdentist.com pmfdentist.com
riverbreezedentalcare.com riverbreezedentalcare.com
premierdentalcareatwesttown.com premierdentalcareatwesttown.com
allisonparkdentistry.com allisonparkdentistry.com
quarrysmiles.com quarrysmiles.com
queensroaddentistry.com queensroaddentistry.com
quirtdentistry.com quirtdentistry.com
quirtfamilydentistry-edgar.com quirtfamilydentistry-edgar.com
quirtfamilydentistry.com quirtfamilydentistry.com
raintreefamilydentistry.com raintreefamilydentistry.com
baysidesmilesdentalcare.com baysidesmilesdentalcare.com
middlesexdentalcarect.com middlesexdentalcarect.com
meadowcreekdentalcare.com meadowcreekdentalcare.com
dentalartsofpalmharbor.com dentalartsofpalmharbor.com
boulevardplacedentalcare.com boulevardplacedentalcare.com
jacarandadentalcare.com jacarandadentalcare.com
fdoconomowoc.com fdoconomowoc.com
junctiondentalcareil.com junctiondentalcareil.com
dentistnapervilleil.com dentistnapervilleil.com
hunterdentistry.com hunterdentistry.com
carusorthoroundrock.com carusorthoroundrock.com
caruscedarpark.com caruscedarpark.com
carussmithville.com carussmithville.com
jandadentistry.com jandadentistry.com
chdwarrenstreet.com chdwarrenstreet.com
lwsschesapeake.com lwsschesapeake.com
chiquitadentalcare.com chiquitadentalcare.com
mosaicdentalapplevalley.com mosaicdentalapplevalley.com
dentalcareonhollywood.com dentalcareonhollywood.com
farrowparkwaydentalcare.com farrowparkwaydentalcare.com
gatewayofnaplesdental.com gatewayofnaplesdental.com
deerwoodorthobayshore.com deerwoodorthobayshore.com
hightidesdentalcare.com hightidesdentalcare.com
fortmyersimplantdentist.com fortmyersimplantdentist.com
forumdentallebanon.com forumdentallebanon.com
dentalcareofmenomoneefalls.com dentalcareofmenomoneefalls.com
dentalcareatbartramcrossings.com dentalcareatbartramcrossings.com
dentalcareoflightfoot.com dentalcareoflightfoot.com
familydentistryoforangegroves.com familydentistryoforangegroves.com
farmingtonvillagedentalcare.com farmingtonvillagedentalcare.com
forumdentalstrobert.com forumdentalstrobert.com
afiniadentalorchardhill.com afiniadentalorchardhill.com
rivergatedentalcarenc.com rivergatedentalcarenc.com
riversdentalcare.net riversdentalcare.net
riversidevalleydentalcare.com riversidevalleydentalcare.com
83rdmarketplacedentalcare.com 83rdmarketplacedentalcare.com
fdappleton.com fdappleton.com
rljdentalgreenbay.com rljdentalgreenbay.com
rousseaufamilydentistry.com rousseaufamilydentistry.com
rtdental.com rtdental.com
dentalcareatmiramesa.com dentalcareatmiramesa.com
advanceddentalhealthcenter.com advanceddentalhealthcenter.com
aestheticdesignsofcherrycreek.com aestheticdesignsofcherrycreek.com
afdcoolsprings.com afdcoolsprings.com
afdsouthwind.com afdsouthwind.com
affordabledentistrycolumbia.net affordabledentistrycolumbia.net
affordabledentistryarmenia.com affordabledentistryarmenia.com
alegredentalnm.com alegredentalnm.com
albertosmilecenter.com albertosmilecenter.com
smiledesigndental-net.yodlesecure.com smiledesigndental-net.yodlesecure.com
smiledesigndental.net smiledesigndental.net
smilesonnorthern.net smilesonnorthern.net
smilecentrevenice.com smilecentrevenice.com
southlakedentalcarefl.net southlakedentalcarefl.net
andersondentallw.com andersondentallw.com
andersongentledentalcare.com andersongentledentalcare.com
southaikendentalcare.com southaikendentalcare.com
goldenparkvillagedental.com goldenparkvillagedental.com
stationsidedentalcare.com stationsidedentalcare.com
stevensonaldentist.com stevensonaldentist.com
sullivandentist.com sullivandentist.com
adctucsonwestina.com adctucsonwestina.com
afdraleigh.com afdraleigh.com
alliancedentalcenter.org alliancedentalcenter.org
tanyardspringsfamilydental.com tanyardspringsfamilydental.com
tanglewoodfamilydental.com tanglewoodfamilydental.com
tannendentalcare.com tannendentalcare.com
tfdlapeer.com tfdlapeer.com
tfdlitchfield.com tfdlitchfield.com
tfdportland.com tfdportland.com
tfdsterlingheights.com tfdsterlingheights.com
tfdwestchester.com tfdwestchester.com
avenuedentalpa.com avenuedentalpa.com
thundermountaindentistry-net.yodlesecure.com thundermountaindentistry-net.yodlesecure.com
tilleryfamilydental.com tilleryfamilydental.com
tomokafamilydentistry.net tomokafamilydentistry.net
baylessdentalgroup.com baylessdentalgroup.com
baysidedentalcareal.net baysidedentalcareal.net
totalhealthdentistryfl.com totalhealthdentistryfl.com
tpdental.com tpdental.com
tyronefamilydentistry.com tyronefamilydentistry.com
vanderbiltestates.dental vanderbiltestates.dental
wallawalladentalcare.com wallawalladentalcare.com
waterparkdentalcareco.com waterparkdentalcareco.com
wecare4smiles.com wecare4smiles.com
westcanyondentalcare.com westcanyondentalcare.com
westfielddentalcare.com westfielddentalcare.com
westhighlanddentalcare.com westhighlanddentalcare.com
westportdentalcare.com westportdentalcare.com
westtownedental.com westtownedental.com
wholelifedental.com wholelifedental.com
yourorlandparkfamilydentist.com yourorlandparkfamilydentist.com
carusorthoatascocita.com carusorthoatascocita.com
zangstreetdentalcare.com zangstreetdentalcare.com
cdofwilliston.com cdofwilliston.com
cedarcitydentalcare.com cedarcitydentalcare.com
clermontendo.com clermontendo.com
coconutpointdentalcare.com coconutpointdentalcare.com
colliervilledentist.com colliervilledentist.com
completefamilydentistryelkhart.com completefamilydentistryelkhart.com
comprehensivedentalnc.com comprehensivedentalnc.com
conversedentist.com conversedentist.com
crawfordfamilydental.com crawfordfamilydental.com
dentalprofessionalsplc.com dentalprofessionalsplc.com
crosspointdental.com crosspointdental.com
cumberlandriverdentalcare.com cumberlandriverdentalcare.com
deerwoodorthocudahy.com deerwoodorthocudahy.com
definitiondental.com definitiondental.com
dellagiodentistfl.com dellagiodentistfl.com
dentalartsofgettysburg.com dentalartsofgettysburg.com
dentalcareatlakewoodwalk.com dentalcareatlakewoodwalk.com
dentalcareatpalmerranch.com dentalcareatpalmerranch.com
dentalcareatnorthcreek.com dentalcareatnorthcreek.com
dentalcareattreatyoaks.com dentalcareattreatyoaks.com
dentalcareofhamilton.com dentalcareofhamilton.com
dentalcareofrolesville.com dentalcareofrolesville.com
dentaldesignslasvegas.net dentaldesignslasvegas.net
dentalplusgreentree.com dentalplusgreentree.com
dentistryforhealthomaha.com dentistryforhealthomaha.com
dentistryplushickoryhollow.com dentistryplushickoryhollow.com
denturesonlyny.com denturesonlyny.com
drklemma.com drklemma.com
drpeeler.net drpeeler.net
drpinsky.com drpinsky.com
drswedenburg.com drswedenburg.com
eastcreekdentalcare.com eastcreekdentalcare.com
eastlakesdentalcare.com eastlakesdentalcare.com
fdmadisoneast.com fdmadisoneast.com
ensodentistry.com ensodentistry.com
fcdentalcarewaynesboro.net fcdentalcarewaynesboro.net
fdbayview.com fdbayview.com
fdmadisonwest.com fdmadisonwest.com
fdmenomoneefalls.com fdmenomoneefalls.com
fdrivercenter.com fdrivercenter.com
feathertouchdentistry.com feathertouchdentistry.com
grandcypressdentalcare.com grandcypressdentalcare.com
grandridgedental.net grandridgedental.net
griffithsmilecenter.com griffithsmilecenter.com
harnechset.online harnechset.online
hawkesbaydentalcare.com hawkesbaydentalcare.com
heartlandfamilydentalcare-net.yodlesecure.com heartlandfamilydentalcare-net.yodlesecure.com
heronspringsdentalcare.com heronspringsdentalcare.com
hesselpark.com hesselpark.com
hgenesteeledds.com hgenesteeledds.com
highwaykdental.com highwaykdental.com
illinidentalcare.com illinidentalcare.com
irabergerdds.com irabergerdds.com
kinddentistry.com kinddentistry.com
lakelanddentistryfl.com lakelanddentistryfl.com
lakemionafamilydental.com lakemionafamilydental.com
libraryparkdental.com libraryparkdental.com
lifetimesmilesoakpark.com lifetimesmilesoakpark.com
littleriverfamilydental.net littleriverfamilydental.net
lortondentist.com lortondentist.com
macedoniadentalcare.com macedoniadentalcare.com
maplelawndentalgroup.com maplelawndentalgroup.com
markandbartholomewdental.com markandbartholomewdental.com
mdblainebaltimore.com mdblainebaltimore.com
mdchildrensdentistryburnsville.com mdchildrensdentistryburnsville.com
mdscmaplegroveperiodontics.com mdscmaplegroveperiodontics.com
mdscrichfieldoralsurgery.com mdscrichfieldoralsurgery.com
mdstlouispark.com mdstlouispark.com
mdstlouisparkwest.com mdstlouisparkwest.com
mdstpaulmidwayoralsurgery.com mdstpaulmidwayoralsurgery.com
meadowranchdentalcare.com meadowranchdentalcare.com
merrillvilledental-net.yodlesecure.com merrillvilledental-net.yodlesecure.com
merrillvilledental.net merrillvilledental.net
middelcompletedentalcare.com middelcompletedentalcare.com
missouriveneers.com missouriveneers.com
grandovervillagedentalcare.com grandovervillagedentalcare.com
muddybranchdentalgroupmd.com muddybranchdentalgroupmd.com
mydentistchickasha.com mydentistchickasha.com
mydentistincindependence.com mydentistincindependence.com
mydentistincshawneeok-com.yodlesecure.com mydentistincshawneeok-com.yodlesecure.com
mydentistincshawneeok.com mydentistincshawneeok.com
mydentistincspringfield-com.yodlesecure.com mydentistincspringfield-com.yodlesecure.com
mydentistincstillwater.com mydentistincstillwater.com
mydentistinctexarkana.com mydentistinctexarkana.com
neibauerdentalcare.com neibauerdentalcare.com
legacydentalcarepa.com legacydentalcarepa.com
dentalcareofgrandview.com dentalcareofgrandview.com
accuradentalcare.com accuradentalcare.com
norfolkfamilydental.com norfolkfamilydental.com
northarlingtondentalcare.com northarlingtondentalcare.com
northauroralifetimedentistry.com northauroralifetimedentistry.com
northcharlestondentalcare.com northcharlestondentalcare.com
northeastdentistry.com northeastdentistry.com
adcscottsdale.com adcscottsdale.com
oakleaffamilydental.net oakleaffamilydental.net
oakriverdentalcare.com oakriverdentalcare.com
carusatascocita.com carusatascocita.com
carusbrodielane.com carusbrodielane.com
carussurgicalatascocita.com carussurgicalatascocita.com
carussurgicalcenterroundrock.com carussurgicalcenterroundrock.com
oldmillfamilydental.com oldmillfamilydental.com
onepillsedation.com onepillsedation.com
orangetreedentalcare.com orangetreedentalcare.com
oswegosedationdentist.com oswegosedationdentist.com
dentalcareatavamarcrossing.com dentalcareatavamarcrossing.com
papilliondentalcare.net papilliondentalcare.net
fdforesthome.com fdforesthome.com
phoenixdentist.co phoenixdentist.co
pineislandroaddentalcare.com pineislandroaddentalcare.com
planolaserdentistry.com planolaserdentistry.com
premierdentalcarewesttown.com premierdentalcarewesttown.com
dentalcares.com dentalcares.com
dentalcarescordova.com dentalcarescordova.com
rcdcdental.com rcdcdental.com
regalvalleyfamilydental.com regalvalleyfamilydental.com
cherrywaydental.com cherrywaydental.com
msmainstreetdental.com msmainstreetdental.com
baycreekdentalcarega.com baycreekdentalcarega.com
greenvalleydentalcaretx.com greenvalleydentalcaretx.com
bristolheightsdental.com bristolheightsdental.com
fdwestbend.com fdwestbend.com
glendaleaestheticdentistry.com glendaleaestheticdentistry.com
carolinadentalgroup.com carolinadentalgroup.com
carusorthokilleen.com carusorthokilleen.com
carusspringkuykendahl.com carusspringkuykendahl.com
dentistsinwinchester.com dentistsinwinchester.com
cdofmerrittisland.com cdofmerrittisland.com
cdoftitusville.com cdoftitusville.com
charlestoncosmeticdentistry.com charlestoncosmeticdentistry.com
florencefamilydentistryky.com florencefamilydentistryky.com
advanceddentistryhomosassa.com advanceddentistryhomosassa.com
dentalcareatsouthcrest.com dentalcareatsouthcrest.com
fivepointsdentalal.com fivepointsdentalal.com
dentalcareofhampstead.com dentalcareofhampstead.com
dentalcareatmeadowridge.com dentalcareatmeadowridge.com
dentalcareonballentrae.com dentalcareonballentrae.com
dentistryathagerstown.com dentistryathagerstown.com
distinctivedmd.com distinctivedmd.com
foxgardendentalcare.com foxgardendentalcare.com
HAPPYVALLEYDENTISTRY.COM
IP History

Click the IP addresses to see over domains using them.