Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

LIVEINGREENWOOD.COM

LIVEINGREENWOOD.COM
Shared Attributes
Domain
885southorangegroveblvd29.com 885southorangegroveblvd29.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 11 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 9 days
marthlakehome.com marthlakehome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Feb 2025 53 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
3123emichigan.com 3123emichigan.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 11 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 9 days
534clipper.com 534clipper.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
IC IC-ZN9P6ZWJ Dec 2024 Dec 2024 One Off
608n31st.com 608n31st.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Feb 2025 41 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 11 days
drakeislandcrossing.com drakeislandcrossing.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025 147 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 One Off
grandsummitranch.com grandsummitranch.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Jan 2025 139 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
5100cuestaverde.com 5100cuestaverde.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 7 days
3353derrhollow.com 3353derrhollow.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 19 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 4 days
homeinfederalway.com homeinfederalway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Jan 2025 106 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 8 days
801creeksidepl.com 801creeksidepl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Feb 2025 41 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 One Off
embouldin.com embouldin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Jan 2025 138 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 One Off
6543seattle.com 6543seattle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 11 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 One Off
52scout.com 52scout.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 11 days
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 6 days
601lagunadrive.com 601lagunadrive.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
3808balcones.com 3808balcones.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 4 days
IC IC-ZN9P6ZWJ Dec 2024 Dec 2024 One Off
homeinseatac.com homeinseatac.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Jan 2025 106 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 8 days
812cathedraldr.com 812cathedraldr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 6 days
6838fairridge.com 6838fairridge.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 11 days
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
3131lucindaln.com 3131lucindaln.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
relahq.com relahq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Jan 2025 141 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
3821hargis.com 3821hargis.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 36 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 4 days
multifamilyinsnohomish.com multifamilyinsnohomish.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025 133 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 8 days
5741turnbullct.com 5741turnbullct.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 36 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
6thunect.com 6thunect.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 11 days
IC IC-ZN9P6ZWJ Dec 2024 Dec 2024 One Off
homeinsewardpark.com homeinsewardpark.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Jan 2025 106 days
IC IC-zn9p6zwj Jan 2025 Jan 2025 8 days
809auzeraisave.com 809auzeraisave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 4 days
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
3404viewmont.com 3404viewmont.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
IC IC-ZN9P6ZWJ Dec 2024 Dec 2024 One Off
launiupokoluxury.com launiupokoluxury.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Nov 2024 65 days
ramrockgolfcourselots.com ramrockgolfcourselots.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 29 days
palmiahomesforsale.com palmiahomesforsale.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Sep 2024 16 days
rent1313sealway.com rent1313sealway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 29 days
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Sep 2024 13 days
urbansophisticationofbouldin.com urbansophisticationofbouldin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 32 days
veeshome.com veeshome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 32 days
casaonpennell.com casaonpennell.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 44 days
4532virioleo.com 4532virioleo.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 5 days
1132pine.com 1132pine.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
comehomeinwestseattle.com comehomeinwestseattle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Feb 2025 111 days
fairwaytolife.com fairwaytolife.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2024 Feb 2025 89 days
homeinbrier.com homeinbrier.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Jan 2025 106 days
justincarl.com justincarl.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Nov 2024 75 days
abbykahararealtor.com abbykahararealtor.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Jan 2025 142 days
501riverdriveriomarbay.com 501riverdriveriomarbay.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 25 days
115belmar.com 115belmar.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
casaazulcolinaslindas.com casaazulcolinaslindas.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025 147 days
110swestst.com 110swestst.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
forsaleinvistancia.com forsaleinvistancia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 22 days
2008harrisonst.com 2008harrisonst.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
infantasmadrid.com infantasmadrid.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Jan 2025 139 days
243elatimer.com 243elatimer.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
encore-parkpenthouse.com encore-parkpenthouse.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025 147 days
630w41st.com 630w41st.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 11 days
74asoleadodr.com 74asoleadodr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
liamlatin.com liamlatin.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Nov 2024 60 days
mynextseattlehome.com mynextseattlehome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 13 days
redingtontowersunit1805.com redingtontowersunit1805.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Sep 2024 One Off
roughhallowliving.com roughhallowliving.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 30 days
stonecrestlaketahoe.com stonecrestlaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 31 days
sunnyscottsdalehome.com sunnyscottsdalehome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 13 days
surfclub410.com surfclub410.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 31 days
thehomeonvashon.com thehomeonvashon.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 31 days
buriencharmer.com buriencharmer.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Oct 2024 One Off
1108everett.com 1108everett.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
3344hapsburgway.com 3344hapsburgway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
2502jarratt.com 2502jarratt.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
3203funstonstreet.com 3203funstonstreet.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 30 days
3240nnewjersey.com 3240nnewjersey.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 19 days
11811lakestevens.com 11811lakestevens.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
24837olivetreeln.com 24837olivetreeln.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
618sandieguito.com 618sandieguito.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 5 days
603sharpparkrd.com 603sharpparkrd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 24 days
1106mccrea.com 1106mccrea.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
6973birdview.com 6973birdview.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 19 days
1501arcadia.com 1501arcadia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
2854ndelaware.com 2854ndelaware.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
modernchicagomf.com modernchicagomf.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2024 Jan 2025 81 days
keybiscayneresicence.com keybiscayneresicence.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Feb 2025 100 days
5840nbayroad.com 5840nbayroad.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
634portofinoway.com 634portofinoway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
seasidesandsinnmotel.com seasidesandsinnmotel.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 30 days
aliceavepackage.com aliceavepackage.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Feb 2025 113 days
yourqueenannehome.com yourqueenannehome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 13 days
116vdm.com 116vdm.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
509redbud.com 509redbud.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 11 days
eightysevenpark404.com eightysevenpark404.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2024 Feb 2025 74 days
grandlakevilla.com grandlakevilla.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Jan 2025 146 days
homeinrichmondhighlands.com homeinrichmondhighlands.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Oct 2024 Jan 2025 99 days
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 53 days
luxuryleaseaz.com luxuryleaseaz.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Jan 2025 140 days
movingyouintherightdirection.com movingyouintherightdirection.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Dec 2024 94 days
napiliresidence.com napiliresidence.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 13 days
nurmiisles.com nurmiisles.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 28 days
oasisatiroquois.com oasisatiroquois.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 28 days
ricoretreat.com ricoretreat.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 30 days
bishopneighborhood.com bishopneighborhood.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025 147 days
26745hickoryblvd.com 26745hickoryblvd.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
2485greathighway.com 2485greathighway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
5022e68th.com 5022e68th.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 19 days
3933balcones.com 3933balcones.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
5025ralston.com 5025ralston.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 11 days
6636glebehillis4you.com 6636glebehillis4you.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 24 days
10170autrymill.com 10170autrymill.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
10236brookville.com 10236brookville.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 5 days
929delanoter5.com 929delanoter5.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
70101viavicenza.com 70101viavicenza.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Feb 2025 41 days
3417cuparosa.com 3417cuparosa.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
solpix.co sites.solpix.co
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 31 days
sprawlingkohalaranchestate.com sprawlingkohalaranchestate.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 31 days
assemblyliving.com assemblyliving.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025 147 days
10979chalonroad.net 10979chalonroad.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025 147 days
www362topaz.com www362topaz.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 33 days
yourhomeinfederalway.com yourhomeinfederalway.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 13 days
yourtudorhome.com yourtudorhome.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Oct 2024 13 days
57sawgrasslane.com 57sawgrasslane.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 12 days
355svine.com 355svine.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 30 days
7500n75thst.com 7500n75thst.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Feb 2025 41 days
dwellon871-44th.com dwellon871-44th.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025 124 days
intercontinental18a.com intercontinental18a.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 20 days
leiladenna.com leiladenna.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Nov 2024 Feb 2025 65 days
2502columbia.com 2502columbia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
8109eorchidlane.com 8109eorchidlane.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 24 days
350portola.com 350portola.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 11 days
365srengstorff52.com 365srengstorff52.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
8mystic2.com 8mystic2.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Dec 2024 One Off
546easternave.com 546easternave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 17 days
546eastern.com 546eastern.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Feb 2025 17 days
401olympicoasis.com 401olympicoasis.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
765unitalomaverdeave.com 765unitalomaverdeave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Dec 2024 Jan 2025 11 days
11174lindavista.com 11174lindavista.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
4601fletcher.com 4601fletcher.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
2201covecourtlongwood.com 2201covecourtlongwood.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-ZN9P6ZWJ Jan 2025 Jan 2025 One Off
3505hillbrookcircle.com 3505hillbrookcircle.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 4 days
34laurelave.com 34laurelave.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
307seaheroplace.com 307seaheroplace.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 11 days
8320yuma.com 8320yuma.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 13 days
507ngladstone.com 507ngladstone.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-zn9p6zwj Jan 2025 Jan 2025 7 days
LIVEINGREENWOOD.COM
Non IP Attributes
Attribute First Last
IC IC-ZN9P6ZWJ Sep 2024 Feb 2025
IC IC-zn9p6zwj Jan 2025 Jan 2025
LIVEINGREENWOOD.COM
Overlap Attribute Domains
885southorangegroveblvd29.com 885southorangegroveblvd29.com
marthlakehome.com marthlakehome.com
3123emichigan.com 3123emichigan.com
534clipper.com 534clipper.com
608n31st.com 608n31st.com
liveingreenwood.com liveingreenwood.com
drakeislandcrossing.com drakeislandcrossing.com
grandsummitranch.com grandsummitranch.com
5100cuestaverde.com 5100cuestaverde.com
3353derrhollow.com 3353derrhollow.com
homeinfederalway.com homeinfederalway.com
801creeksidepl.com 801creeksidepl.com
embouldin.com embouldin.com
6543seattle.com 6543seattle.com
52scout.com 52scout.com
601lagunadrive.com 601lagunadrive.com
3808balcones.com 3808balcones.com
homeinseatac.com homeinseatac.com
812cathedraldr.com 812cathedraldr.com
6838fairridge.com 6838fairridge.com
3131lucindaln.com 3131lucindaln.com
relahq.com relahq.com
3821hargis.com 3821hargis.com
multifamilyinsnohomish.com multifamilyinsnohomish.com
5741turnbullct.com 5741turnbullct.com
6thunect.com 6thunect.com
homeinsewardpark.com homeinsewardpark.com
809auzeraisave.com 809auzeraisave.com
3404viewmont.com 3404viewmont.com
launiupokoluxury.com launiupokoluxury.com
ramrockgolfcourselots.com ramrockgolfcourselots.com
palmiahomesforsale.com palmiahomesforsale.com
rent1313sealway.com rent1313sealway.com
seasidepearlfarmgatewinery.info seasidepearlfarmgatewinery.info
urbansophisticationofbouldin.com urbansophisticationofbouldin.com
veeshome.com veeshome.com
casaonpennell.com casaonpennell.com
4532virioleo.com 4532virioleo.com
1132pine.com 1132pine.com
comehomeinwestseattle.com comehomeinwestseattle.com
fairwaytolife.com fairwaytolife.com
homeinbrier.com homeinbrier.com
justincarl.com justincarl.com
abbykahararealtor.com abbykahararealtor.com
501riverdriveriomarbay.com 501riverdriveriomarbay.com
115belmar.com 115belmar.com
casaazulcolinaslindas.com casaazulcolinaslindas.com
110swestst.com 110swestst.com
forsaleinvistancia.com forsaleinvistancia.com
2008harrisonst.com 2008harrisonst.com
infantasmadrid.com infantasmadrid.com
243elatimer.com 243elatimer.com
encore-parkpenthouse.com encore-parkpenthouse.com
630w41st.com 630w41st.com
74asoleadodr.com 74asoleadodr.com
liamlatin.com liamlatin.com
mynextseattlehome.com mynextseattlehome.com
redingtontowersunit1805.com redingtontowersunit1805.com
roughhallowliving.com roughhallowliving.com
stonecrestlaketahoe.com stonecrestlaketahoe.com
sunnyscottsdalehome.com sunnyscottsdalehome.com
surfclub410.com surfclub410.com
thehomeonvashon.com thehomeonvashon.com
buriencharmer.com buriencharmer.com
1108everett.com 1108everett.com
3344hapsburgway.com 3344hapsburgway.com
2502jarratt.com 2502jarratt.com
3203funstonstreet.com 3203funstonstreet.com
3240nnewjersey.com 3240nnewjersey.com
11811lakestevens.com 11811lakestevens.com
24837olivetreeln.com 24837olivetreeln.com
618sandieguito.com 618sandieguito.com
603sharpparkrd.com 603sharpparkrd.com
1106mccrea.com 1106mccrea.com
6973birdview.com 6973birdview.com
1501arcadia.com 1501arcadia.com
2854ndelaware.com 2854ndelaware.com
modernchicagomf.com modernchicagomf.com
keybiscayneresicence.com keybiscayneresicence.com
5840nbayroad.com 5840nbayroad.com
634portofinoway.com 634portofinoway.com
seasidesandsinnmotel.com seasidesandsinnmotel.com
aliceavepackage.com aliceavepackage.com
yourqueenannehome.com yourqueenannehome.com
116vdm.com 116vdm.com
509redbud.com 509redbud.com
eightysevenpark404.com eightysevenpark404.com
grandlakevilla.com grandlakevilla.com
homeinrichmondhighlands.com homeinrichmondhighlands.com
lakeforestparkmidcenturygem.com lakeforestparkmidcenturygem.com
luxuryleaseaz.com luxuryleaseaz.com
movingyouintherightdirection.com movingyouintherightdirection.com
napiliresidence.com napiliresidence.com
nurmiisles.com nurmiisles.com
oasisatiroquois.com oasisatiroquois.com
ricoretreat.com ricoretreat.com
bishopneighborhood.com bishopneighborhood.com
26745hickoryblvd.com 26745hickoryblvd.com
2485greathighway.com 2485greathighway.com
5022e68th.com 5022e68th.com
3933balcones.com 3933balcones.com
5025ralston.com 5025ralston.com
6636glebehillis4you.com 6636glebehillis4you.com
10170autrymill.com 10170autrymill.com
10236brookville.com 10236brookville.com
929delanoter5.com 929delanoter5.com
70101viavicenza.com 70101viavicenza.com
3417cuparosa.com 3417cuparosa.com
sites.solpix.co sites.solpix.co
sprawlingkohalaranchestate.com sprawlingkohalaranchestate.com
assemblyliving.com assemblyliving.com
10979chalonroad.net 10979chalonroad.net
www362topaz.com www362topaz.com
yourhomeinfederalway.com yourhomeinfederalway.com
yourtudorhome.com yourtudorhome.com
57sawgrasslane.com 57sawgrasslane.com
355svine.com 355svine.com
7500n75thst.com 7500n75thst.com
dwellon871-44th.com dwellon871-44th.com
intercontinental18a.com intercontinental18a.com
leiladenna.com leiladenna.com
2502columbia.com 2502columbia.com
8109eorchidlane.com 8109eorchidlane.com
350portola.com 350portola.com
365srengstorff52.com 365srengstorff52.com
8mystic2.com 8mystic2.com
546easternave.com 546easternave.com
546eastern.com 546eastern.com
401olympicoasis.com 401olympicoasis.com
765unitalomaverdeave.com 765unitalomaverdeave.com
11174lindavista.com 11174lindavista.com
4601fletcher.com 4601fletcher.com
2201covecourtlongwood.com 2201covecourtlongwood.com
3505hillbrookcircle.com 3505hillbrookcircle.com
34laurelave.com 34laurelave.com
307seaheroplace.com 307seaheroplace.com
8320yuma.com 8320yuma.com
507ngladstone.com 507ngladstone.com
LIVEINGREENWOOD.COM
IP History

Click the IP addresses to see over domains using them.