Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

MOTHERANDBABY.CO.ID

MOTHERANDBABY.CO.ID
Shared Attributes
Domain
cosmopolitan.co.id cosmopolitan.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Nov 2008 Mar 2020 11 years, 141 days
CA CA-PUB-3746615079893481 Oct 2013 Jul 2020 6 years, 280 days
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 36 days
IEX IEX-186779 May 2020 Jun 2021 1 year, 36 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 36 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 36 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 36 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 36 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 36 days
RUB RUB-18110 May 2020 Jun 2021 1 year, 36 days
SPTX SPTX-283632 May 2020 Jun 2021 1 year, 29 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 13 days
LOOP LOOP-S-2411 May 2020 Apr 2021 341 days
SCLP SCLP-6426 May 2020 Apr 2021 341 days
SCLP SCLP-390 May 2020 Apr 2021 318 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 279 days
IEX IEX-186266 May 2020 Feb 2021 279 days
OX OX-540553856 May 2020 Feb 2021 256 days
SCLP SCLP-6793 May 2020 Dec 2020 204 days
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
FB FB-1498944493475809 Nov 2017 May 2018 168 days
CA CA-PUB-2186101008500724 Jul 2020 Jul 2020 One Off
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
herworld.co.id herworld.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-3746615079893481 Nov 2013 May 2020 6 years, 175 days
UA UA-4418968 Dec 2013 Aug 2018 4 years, 245 days
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 33 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 33 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 33 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 33 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 33 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 33 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 33 days
RUB RUB-18110 May 2020 May 2021 1 year, 3 days
SCLP SCLP-390 May 2020 Apr 2021 338 days
OX OX-540099026 Jul 2020 Jun 2021 338 days
SCLP SCLP-6426 Jul 2020 Jun 2021 338 days
LOOP LOOP-S-2411 Jun 2020 Apr 2021 310 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 276 days
OX OX-540553856 May 2020 Feb 2021 276 days
SPTX SPTX-283632 Jun 2020 Mar 2021 273 days
IEX IEX-186779 May 2020 Jan 2021 248 days
IEX IEX-186266 Jun 2020 Feb 2021 248 days
AT AT-RA-54EFF682151B7671 Jun 2015 Dec 2015 181 days
SCLP SCLP-6793 Sep 2020 Dec 2020 85 days
TB TB-1363359 May 2021 Jun 2021 30 days
CA CA-PUB-2186101008500724 May 2020 May 2020 One Off
casaindonesia.com casaindonesia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2020 Jun 2021 329 days
IEX IEX-186779 Jul 2020 Jun 2021 329 days
OX OX-540099026 Jul 2020 Jun 2021 329 days
PUBM PUBM-158039 Jul 2020 Jun 2021 329 days
YUME YUME-102973855 Jul 2020 Jun 2021 329 days
SVRN SVRN-230297 Jul 2020 Jun 2021 329 days
LIJI LIJI-230297 Jul 2020 Jun 2021 329 days
YIMO YIMO-2073946213921227802 Jul 2020 Jun 2021 329 days
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 327 days
LOOP LOOP-5918 Jul 2020 Jun 2021 327 days
RUB RUB-18110 Jul 2020 Jun 2021 327 days
LOOP LOOP-S-2411 Jul 2020 Apr 2021 269 days
SCLP SCLP-390 Jul 2020 Apr 2021 269 days
OX OX-540553856 Jul 2020 Feb 2021 207 days
SCLP SCLP-6426 Aug 2020 Feb 2021 199 days
SPTX SPTX-283632 Dec 2020 Jun 2021 166 days
SCLP SCLP-6793 Jul 2020 Dec 2020 155 days
TB TB-1363359 Apr 2021 Jun 2021 48 days
IEX IEX-186266 Dec 2020 Feb 2021 44 days
CA CA-PUB-3746615079893481 Jul 2020 Jul 2020 One Off
thanhniennews.com thanhniennews.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Sep 2019 Apr 2020 209 days
IEX IEX-186779 Sep 2019 Apr 2020 209 days
LIJI LIJI-230297 Sep 2019 Apr 2020 209 days
OX OX-540553856 Sep 2019 Apr 2020 209 days
SVRN SVRN-230297 Sep 2019 Apr 2020 209 days
SCLP SCLP-390 Sep 2019 Apr 2020 209 days
FWHL FWHL-897697 Sep 2019 Apr 2020 209 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 209 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 209 days
CA CA-PUB-1738284215641521 Sep 2019 Mar 2020 175 days
CA CA-PUB-2186101008500724 Nov 2019 Apr 2020 144 days
RUB RUB-18110 Jan 2020 Apr 2020 78 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
thesundaily.my thesundaily.my
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Nov 2019 May 2020 185 days
LIJI LIJI-230297 Nov 2019 May 2020 185 days
IEX IEX-186779 Nov 2019 May 2020 185 days
FWHL FWHL-897697 Nov 2019 May 2020 185 days
PUBM PUBM-158039 Nov 2019 May 2020 185 days
YUME YUME-102973855 Nov 2019 May 2020 185 days
YIMO YIMO-2073946213921227802 Nov 2019 May 2020 185 days
LOOP LOOP-5918 Nov 2019 May 2020 185 days
OX OX-540553856 Nov 2019 Apr 2020 144 days
RUB RUB-18110 Nov 2019 Apr 2020 144 days
OX OX-539872073 Nov 2019 Mar 2020 131 days
CA CA-PUB-1738284215641521 Mar 2020 May 2020 75 days
SCLP SCLP-6426 Mar 2020 May 2020 54 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
CA CA-PUB-2186101008500724 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
smartm.com.tw smartm.com.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Jun 2020 299 days
LOOP LOOP-S-2411 Sep 2019 Jun 2020 299 days
OX OX-540553856 Sep 2019 Jun 2020 299 days
PUBM PUBM-158039 Sep 2019 Jun 2020 299 days
YUME YUME-102973855 Sep 2019 Jun 2020 299 days
RUB RUB-18110 Sep 2019 Jun 2020 299 days
SVRN SVRN-230297 Sep 2019 Jun 2020 299 days
LIJI LIJI-230297 Sep 2019 Jun 2020 299 days
YIMO YIMO-2073946213921227802 Sep 2019 Jun 2020 299 days
IEX IEX-186779 Sep 2019 May 2020 259 days
LOOP LOOP-5918 Nov 2019 May 2020 196 days
IEX IEX-186266 Feb 2020 Jun 2020 119 days
SCLP SCLP-390 Feb 2020 Jun 2020 119 days
SCLP SCLP-6426 Mar 2020 May 2020 51 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
gocekan.com gocekan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Dec 2019 Mar 2021 1 year, 85 days
FWHL FWHL-897697 Dec 2019 Mar 2021 1 year, 85 days
LOOP LOOP-S-2411 Dec 2019 Mar 2021 1 year, 85 days
YUME YUME-102973855 Dec 2019 Mar 2021 1 year, 85 days
SVRN SVRN-230297 Dec 2019 Mar 2021 1 year, 85 days
LIJI LIJI-230297 Dec 2019 Mar 2021 1 year, 85 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2021 1 year, 85 days
IEX IEX-186266 Dec 2019 Feb 2021 1 year, 62 days
CA CA-PUB-2186101008500724 Feb 2020 Mar 2021 1 year, 20 days
RUB RUB-18110 Feb 2020 Mar 2021 1 year, 20 days
IEX IEX-186779 Mar 2020 Mar 2021 350 days
LOOP LOOP-5918 Mar 2020 Mar 2021 350 days
SCLP SCLP-6793 Feb 2020 Dec 2020 310 days
OX OX-540099026 Feb 2020 Nov 2020 282 days
SCLP SCLP-6426 Mar 2020 Nov 2020 247 days
CA CA-PUB-1738284215641521 Dec 2019 Mar 2020 100 days
SCLP SCLP-390 Sep 2020 Nov 2020 66 days
OX OX-540553856 May 2020 May 2020 One Off
papillon-world.com papillon-world.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Mar 2021 313 days
LOOP LOOP-5918 May 2020 Mar 2021 313 days
PUBM PUBM-158039 May 2020 Mar 2021 313 days
YUME YUME-102973855 May 2020 Mar 2021 313 days
RUB RUB-18110 May 2020 Mar 2021 313 days
SCLP SCLP-390 May 2020 Mar 2021 313 days
SVRN SVRN-230297 May 2020 Mar 2021 313 days
LIJI LIJI-230297 May 2020 Mar 2021 313 days
YIMO YIMO-2073946213921227802 May 2020 Mar 2021 313 days
OX OX-540553856 May 2020 Jan 2021 258 days
IEX IEX-186779 Aug 2020 Mar 2021 209 days
IEX IEX-186266 May 2020 Dec 2020 208 days
SCLP SCLP-6793 Jun 2020 Dec 2020 173 days
CA CA-PUB-1738284215641521 Oct 2020 Jan 2021 108 days
LOOP LOOP-S-2411 Oct 2020 Jan 2021 108 days
CA CA-PUB-2186101008500724 Jun 2020 Jun 2020 One Off
SCLP SCLP-6426 Oct 2020 Oct 2020 One Off
OX OX-540099026 Mar 2021 Mar 2021 One Off
spidermannews.com spidermannews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jun 2021 1 year, 328 days
PUBM PUBM-158039 Jul 2019 Jun 2021 1 year, 328 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 328 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 328 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 328 days
RUB RUB-18110 Sep 2019 Jun 2021 1 year, 272 days
YUME YUME-102973855 Sep 2019 Jun 2021 1 year, 272 days
LOOP LOOP-S-2411 Jul 2019 Apr 2021 1 year, 268 days
IEX IEX-186779 Nov 2019 Jun 2021 1 year, 207 days
OX OX-540553856 Jul 2019 Feb 2021 1 year, 206 days
IEX IEX-186266 Sep 2019 Feb 2021 1 year, 150 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
SCLP SCLP-6793 Sep 2019 Dec 2020 1 year, 98 days
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 97 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SCLP SCLP-390 Mar 2020 Apr 2021 1 year, 37 days
OX OX-539872073 Sep 2019 Mar 2020 196 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
teqnoforia.com teqnoforia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2021 1 year, 149 days
IEX IEX-186779 Nov 2019 Apr 2021 1 year, 149 days
LOOP LOOP-5918 Nov 2019 Apr 2021 1 year, 149 days
PUBM PUBM-158039 Nov 2019 Apr 2021 1 year, 149 days
YUME YUME-102973855 Nov 2019 Apr 2021 1 year, 149 days
RUB RUB-18110 Nov 2019 Apr 2021 1 year, 149 days
SVRN SVRN-230297 Nov 2019 Apr 2021 1 year, 149 days
LIJI LIJI-230297 Nov 2019 Apr 2021 1 year, 149 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2021 1 year, 149 days
OX OX-540553856 Nov 2019 Feb 2021 1 year, 88 days
IEX IEX-186266 Jan 2020 Feb 2021 1 year, 22 days
SCLP SCLP-6426 Mar 2020 Apr 2021 1 year, 7 days
OX OX-540099026 Apr 2020 Apr 2021 363 days
SCLP SCLP-390 Mar 2020 Feb 2021 337 days
LOOP LOOP-S-2411 May 2020 Feb 2021 259 days
SCLP SCLP-6793 May 2020 Dec 2020 209 days
CA CA-PUB-2186101008500724 May 2020 Oct 2020 157 days
CA CA-PUB-1738284215641521 Mar 2020 May 2020 78 days
makanyuks.com makanyuks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2021 1 year, 83 days
PUBM PUBM-158039 Dec 2019 Mar 2021 1 year, 83 days
YUME YUME-102973855 Dec 2019 Mar 2021 1 year, 83 days
SVRN SVRN-230297 Dec 2019 Mar 2021 1 year, 83 days
LIJI LIJI-230297 Dec 2019 Mar 2021 1 year, 83 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2021 1 year, 83 days
LOOP LOOP-S-2411 Dec 2019 Jan 2021 1 year, 32 days
IEX IEX-186779 Feb 2020 Mar 2021 1 year, 24 days
RUB RUB-18110 Feb 2020 Mar 2021 1 year, 24 days
SCLP SCLP-6793 Dec 2019 Dec 2020 362 days
LOOP LOOP-5918 Mar 2020 Mar 2021 354 days
SCLP SCLP-6426 Mar 2020 Mar 2021 353 days
IEX IEX-186266 Dec 2019 Dec 2020 348 days
OX OX-540553856 Feb 2020 Dec 2020 289 days
SCLP SCLP-390 May 2020 Jan 2021 256 days
OX OX-540099026 May 2020 Oct 2020 145 days
CA CA-PUB-2186101008500724 Dec 2020 Mar 2021 100 days
OX OX-539872073 Mar 2020 Mar 2020 1 day
angelsontrip.com angelsontrip.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2021 1 year, 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2021 1 year, 144 days
YUME YUME-102973855 Nov 2019 Apr 2021 1 year, 144 days
PUBM PUBM-158039 Nov 2019 Apr 2021 1 year, 144 days
LIJI LIJI-230297 Nov 2019 Apr 2021 1 year, 144 days
SVRN SVRN-230297 Nov 2019 Apr 2021 1 year, 144 days
LOOP LOOP-S-2411 Nov 2019 Apr 2021 1 year, 141 days
IEX IEX-186779 Jan 2020 Apr 2021 1 year, 79 days
IEX IEX-186266 Nov 2019 Feb 2021 1 year, 79 days
LOOP LOOP-5918 Jan 2020 Feb 2021 1 year, 20 days
RUB RUB-18110 Apr 2020 Apr 2021 1 year, 2 days
SCLP SCLP-390 Mar 2020 Feb 2021 343 days
SCLP SCLP-6793 Jan 2020 Dec 2020 327 days
CA CA-PUB-1738284215641521 Apr 2020 Feb 2021 302 days
OX OX-540099026 Feb 2020 Nov 2020 268 days
OX OX-540553856 May 2020 Feb 2021 262 days
SCLP SCLP-6426 Mar 2020 Nov 2020 233 days
CA CA-PUB-2186101008500724 May 2020 Nov 2020 184 days
astaqauliyah.com astaqauliyah.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 263 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 263 days
PUBM PUBM-158039 Jul 2019 Apr 2020 263 days
YUME YUME-102973855 Jul 2019 Apr 2020 263 days
SVRN SVRN-230297 Jul 2019 Apr 2020 263 days
LIJI LIJI-230297 Jul 2019 Apr 2020 263 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 263 days
IEX IEX-186779 Jul 2019 Mar 2020 229 days
SCLP SCLP-6793 Sep 2019 Apr 2020 206 days
LOOP LOOP-5918 Sep 2019 Jan 2020 131 days
RUB RUB-18110 Sep 2019 Jan 2020 131 days
IEX IEX-186266 Jan 2020 Apr 2020 75 days
OX OX-539872073 Jan 2020 Mar 2020 58 days
OX OX-540099026 Feb 2020 Apr 2020 52 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 17 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
tailieu.vn tailieu.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Apr 2020 1 year, 32 days
PUBM PUBM-158039 Jul 2019 Apr 2020 267 days
YUME YUME-102973855 Jul 2019 Apr 2020 267 days
SVRN SVRN-230297 Jul 2019 Apr 2020 267 days
LIJI LIJI-230297 Jul 2019 Apr 2020 267 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 267 days
FWHL FWHL-897697 Jul 2019 Mar 2020 233 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 233 days
LOOP LOOP-5918 Sep 2019 Apr 2020 214 days
OX OX-540553856 Sep 2019 Mar 2020 180 days
SCLP SCLP-390 Sep 2019 Mar 2020 180 days
IEX IEX-186779 Sep 2019 Nov 2019 64 days
OX OX-540099026 Feb 2020 Apr 2020 43 days
SCLP SCLP-6426 Mar 2020 Apr 2020 8 days
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
womany.net womany.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Jul 2020 312 days
IEX IEX-186779 Sep 2019 Jul 2020 312 days
LOOP LOOP-5918 Sep 2019 Jul 2020 312 days
PUBM PUBM-158039 Sep 2019 Jul 2020 312 days
YUME YUME-102973855 Sep 2019 Jul 2020 312 days
SVRN SVRN-230297 Sep 2019 Jul 2020 312 days
LIJI LIJI-230297 Sep 2019 Jul 2020 312 days
YIMO YIMO-2073946213921227802 Sep 2019 Jul 2020 312 days
SCLP SCLP-390 Sep 2019 May 2020 254 days
LOOP LOOP-S-2411 Nov 2019 May 2020 188 days
OX OX-540553856 Jan 2020 Jul 2020 182 days
RUB RUB-18110 Sep 2019 Mar 2020 177 days
SCLP SCLP-6426 Mar 2020 Jul 2020 112 days
IEX IEX-186266 Apr 2020 May 2020 43 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
businessinsider.in businessinsider.in
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Nov 2019 Apr 2020 144 days
SVRN SVRN-230297 Nov 2019 Apr 2020 144 days
IEX IEX-186266 Nov 2019 Apr 2020 144 days
YUME YUME-102973855 Nov 2019 Apr 2020 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 144 days
OX OX-539872073 Nov 2019 Mar 2020 131 days
IEX IEX-186779 Nov 2019 Mar 2020 110 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
OX OX-540553856 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
LIJI LIJI-230297 Jan 2020 Mar 2020 45 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
gpsbestari.com gpsbestari.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 224 days
IEX IEX-186779 Aug 2019 Mar 2020 224 days
PUBM PUBM-158039 Aug 2019 Mar 2020 224 days
YUME YUME-102973855 Aug 2019 Mar 2020 224 days
SVRN SVRN-230297 Aug 2019 Mar 2020 224 days
LIJI LIJI-230297 Aug 2019 Mar 2020 224 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 224 days
RUB RUB-18110 Aug 2019 Mar 2020 212 days
LOOP LOOP-5918 Aug 2019 Mar 2020 212 days
SCLP SCLP-6793 Aug 2019 Feb 2020 189 days
OX OX-539872073 Oct 2019 Mar 2020 164 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 27 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
juksy.com juksy.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Oct 2019 Mar 2020 161 days
IEX IEX-186266 Oct 2019 Mar 2020 161 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 161 days
PUBM PUBM-158039 Oct 2019 Mar 2020 161 days
YUME YUME-102973855 Oct 2019 Mar 2020 161 days
RUB RUB-18110 Oct 2019 Mar 2020 161 days
SVRN SVRN-230297 Oct 2019 Mar 2020 161 days
LIJI LIJI-230297 Oct 2019 Mar 2020 161 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 161 days
IEX IEX-186779 Dec 2019 Mar 2020 96 days
LOOP LOOP-5918 Dec 2019 Mar 2020 96 days
OX OX-540099026 Feb 2020 Mar 2020 31 days
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
kuchingborneo.info kuchingborneo.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jun 2021 1 year, 347 days
PUBM PUBM-158039 Jul 2019 Jun 2021 1 year, 347 days
YUME YUME-102973855 Jul 2019 Jun 2021 1 year, 347 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 347 days
LOOP LOOP-S-2411 Jul 2019 Apr 2021 1 year, 287 days
IEX IEX-186779 Oct 2019 Jun 2021 1 year, 239 days
LOOP LOOP-5918 Oct 2019 Jun 2021 1 year, 239 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 174 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
RUB RUB-18110 Mar 2020 Jun 2021 1 year, 79 days
SCLP SCLP-6793 Oct 2019 Dec 2020 1 year, 65 days
SVRN SVRN-230297 Jul 2019 May 2020 323 days
LIJI LIJI-230297 Jul 2019 May 2020 323 days
OX OX-540553856 Oct 2019 Mar 2020 160 days
OX OX-539872073 Dec 2019 Mar 2020 95 days
SCLP SCLP-390 Mar 2020 May 2020 48 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
miaminewtimes.com miaminewtimes.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Apr 2020 284 days
OX OX-540553856 Jan 2020 Apr 2020 79 days
YUME YUME-102973855 Jan 2020 Apr 2020 79 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LOOP LOOP-5918 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
IEX IEX-186266 Jan 2020 Apr 2020 79 days
IEX IEX-186779 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
SCLP SCLP-390 Jan 2020 Apr 2020 79 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
RUB RUB-18110 Jan 2020 Mar 2020 45 days
LIJI LIJI-230297 Jan 2020 Mar 2020 45 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
palingseru.com palingseru.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 291 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 291 days
PUBM PUBM-158039 Aug 2019 Jun 2021 1 year, 291 days
YUME YUME-102973855 Aug 2019 Jun 2021 1 year, 291 days
SVRN SVRN-230297 Aug 2019 Jun 2021 1 year, 291 days
YIMO YIMO-2073946213921227802 Aug 2019 Jun 2021 1 year, 291 days
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 231 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 169 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
LOOP LOOP-S-2411 Aug 2019 Mar 2020 218 days
IEX IEX-186779 Aug 2019 Feb 2020 183 days
OX OX-540553856 Aug 2019 Feb 2020 183 days
RUB RUB-18110 Aug 2019 Feb 2020 183 days
SCLP SCLP-6793 Oct 2019 Feb 2020 120 days
LIJI LIJI-230297 Aug 2019 Oct 2019 63 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
poki.co.il poki.co.il
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
OX OX-540099026 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
poki.com poki.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
poki.dk poki.dk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
poki.pt poki.pt
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
songdee.com songdee.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Jun 2021 1 year, 328 days
FWHL FWHL-897697 Jul 2019 Jun 2021 1 year, 328 days
YUME YUME-102973855 Jul 2019 Jun 2021 1 year, 328 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 328 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 328 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 328 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 288 days
LOOP LOOP-S-2411 Jul 2019 Apr 2021 1 year, 276 days
IEX IEX-186779 Sep 2019 Jun 2021 1 year, 276 days
LOOP LOOP-5918 Sep 2019 Jun 2021 1 year, 276 days
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
OX OX-540553856 Sep 2019 Feb 2021 1 year, 162 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 68 days
IEX IEX-186266 Aug 2019 Oct 2020 1 year, 62 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540099026 Jul 2020 Jul 2020 One Off
SCLP SCLP-6793 Oct 2020 Oct 2020 One Off
sportsplanetmag.com sportsplanetmag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 25 days
IEX IEX-186779 May 2020 Jun 2021 1 year, 25 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 25 days
RUB RUB-18110 May 2020 Jun 2021 1 year, 25 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 25 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 25 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 25 days
LOOP LOOP-5918 Jun 2020 Jun 2021 350 days
LOOP LOOP-S-2411 May 2020 Apr 2021 330 days
YUME YUME-102973855 Jul 2020 Jun 2021 329 days
OX OX-540099026 Sep 2020 Jun 2021 276 days
SCLP SCLP-390 Jul 2020 Apr 2021 269 days
OX OX-540553856 May 2020 Feb 2021 268 days
IEX IEX-186266 Jul 2020 Feb 2021 207 days
SCLP SCLP-6426 May 2020 Nov 2020 178 days
SCLP SCLP-6793 Jun 2020 Dec 2020 176 days
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
hipwee.com hipwee.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
OX OX-540553856 Jul 2019 Apr 2020 265 days
SCLP SCLP-390 Aug 2019 Apr 2020 233 days
YUME YUME-102973855 Jul 2019 Nov 2019 121 days
CA CA-PUB-1738284215641521 Mar 2019 Jun 2019 89 days
IEX IEX-186266 Aug 2019 Nov 2019 89 days
LOOP LOOP-5918 Aug 2019 Nov 2019 89 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
LOOP LOOP-S-2411 Jan 2020 Apr 2020 79 days
IEX IEX-186779 Jul 2019 Sep 2019 56 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
juksy.club juksy.club
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 161 days
LOOP LOOP-5918 Oct 2019 Mar 2020 161 days
PUBM PUBM-158039 Oct 2019 Mar 2020 161 days
YUME YUME-102973855 Oct 2019 Mar 2020 161 days
RUB RUB-18110 Oct 2019 Mar 2020 161 days
SVRN SVRN-230297 Oct 2019 Mar 2020 161 days
LIJI LIJI-230297 Oct 2019 Mar 2020 161 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 161 days
SCLP SCLP-390 Dec 2019 Mar 2020 96 days
IEX IEX-186779 Dec 2019 Mar 2020 96 days
LOOP LOOP-S-2411 Dec 2019 Mar 2020 96 days
OX OX-539872073 Oct 2019 Dec 2019 65 days
IEX IEX-186266 Oct 2019 Dec 2019 65 days
OX OX-540099026 Feb 2020 Mar 2020 31 days
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
poki.at poki.at
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
poki.com.br poki.com.br
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
poki.gr poki.gr
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
OX OX-540099026 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
poki.ro poki.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
rakluke.com rakluke.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
PUBM PUBM-158039 Aug 2019 Apr 2020 218 days
YUME YUME-102973855 Aug 2019 Apr 2020 218 days
SVRN SVRN-230297 Aug 2019 Apr 2020 218 days
LIJI LIJI-230297 Aug 2019 Apr 2020 218 days
YIMO YIMO-2073946213921227802 Aug 2019 Apr 2020 218 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 183 days
LOOP LOOP-5918 Oct 2019 Apr 2020 154 days
IEX IEX-186266 Aug 2019 Oct 2019 64 days
SCLP SCLP-6793 Aug 2019 Oct 2019 64 days
OX OX-540099026 Feb 2020 Apr 2020 40 days
OX OX-540553856 Aug 2019 Aug 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
rappler.com rappler.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
PUBM PUBM-158039 Jul 2019 Jun 2021 1 year, 347 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 347 days
OX OX-540553856 Jul 2019 Feb 2021 1 year, 225 days
LOOP LOOP-5918 Nov 2019 Jun 2021 1 year, 207 days
SCLP SCLP-390 Mar 2020 Apr 2021 1 year, 37 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 284 days
IEX IEX-186779 Jul 2019 Apr 2020 284 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
SCLP SCLP-6793 Jul 2019 Apr 2020 284 days
YUME YUME-102973855 Jul 2019 Apr 2020 265 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
IEX IEX-186266 Jan 2020 Mar 2020 45 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
astalog.com astalog.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Jul 2019 Jun 2021 1 year, 322 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 322 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 322 days
RUB RUB-18110 Sep 2019 Jun 2021 1 year, 265 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 174 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
LOOP LOOP-5918 Apr 2020 Jun 2021 1 year, 59 days
OX OX-540553856 Jan 2020 Feb 2021 1 year, 12 days
SCLP SCLP-6793 Mar 2020 Dec 2020 284 days
PUBM PUBM-158039 Jul 2019 Apr 2020 276 days
FWHL FWHL-897697 Jul 2019 Apr 2020 276 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 229 days
SCLP SCLP-390 Aug 2019 Jan 2020 162 days
SVRN SVRN-230297 Nov 2019 Apr 2020 154 days
OX OX-539872073 Nov 2019 Mar 2020 124 days
IEX IEX-186779 Nov 2019 Nov 2019 One Off
bola.com bola.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Apr 2020 205 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 205 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 205 days
SCLP SCLP-6793 Sep 2019 Mar 2020 171 days
IEX IEX-186779 Nov 2019 Apr 2020 140 days
FWHL FWHL-897697 Nov 2019 Apr 2020 140 days
LOOP LOOP-5918 Nov 2019 Apr 2020 140 days
LIJI LIJI-230297 Sep 2019 Feb 2020 131 days
PUBM PUBM-158039 Sep 2019 Feb 2020 131 days
OX OX-539872073 Nov 2019 Mar 2020 121 days
IEX IEX-186266 Feb 2020 Apr 2020 74 days
YUME YUME-102973855 Nov 2019 Feb 2020 66 days
OX OX-540099026 Feb 2020 Apr 2020 54 days
SCLP SCLP-6426 Mar 2020 Apr 2020 19 days
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
wowlavie.com wowlavie.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 211 days
IEX IEX-186779 Sep 2019 Apr 2020 211 days
PUBM PUBM-158039 Sep 2019 Apr 2020 211 days
SVRN SVRN-230297 Sep 2019 Apr 2020 211 days
LIJI LIJI-230297 Sep 2019 Apr 2020 211 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 211 days
LOOP LOOP-S-2411 Sep 2019 Mar 2020 177 days
OX OX-540553856 Sep 2019 Mar 2020 177 days
YUME YUME-102973855 Sep 2019 Mar 2020 177 days
RUB RUB-18110 Nov 2019 Apr 2020 145 days
OX OX-539872073 Jan 2020 Mar 2020 46 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
OX OX-540099026 Feb 2020 Mar 2020 12 days
IEX IEX-186266 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
gateworld.net gateworld.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 328 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
IEX IEX-186779 Jul 2019 Mar 2020 231 days
OX OX-540553856 Jul 2019 Mar 2020 231 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 231 days
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
PUBM PUBM-158039 Sep 2019 Mar 2020 175 days
SCLP SCLP-6793 Sep 2019 Nov 2019 65 days
SCLP SCLP-390 Jan 2020 Mar 2020 45 days
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

kincir.com kincir.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 May 2020 270 days
FWHL FWHL-897697 Aug 2019 May 2020 270 days
YUME YUME-102973855 Aug 2019 May 2020 270 days
SVRN SVRN-230297 Aug 2019 May 2020 270 days
LIJI LIJI-230297 Aug 2019 May 2020 270 days
YIMO YIMO-2073946213921227802 Aug 2019 May 2020 270 days
SCLP SCLP-6793 Aug 2019 Mar 2020 222 days
LOOP LOOP-5918 Aug 2019 Mar 2020 217 days
IEX IEX-186266 Oct 2019 May 2020 208 days
LOOP LOOP-S-2411 Oct 2019 May 2020 208 days
IEX IEX-186779 Aug 2019 Feb 2020 187 days
OX OX-540099026 Feb 2020 Mar 2020 32 days
RUB RUB-18110 Oct 2019 Oct 2019 One Off
OX OX-539872073 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
poki.no poki.no
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
OX OX-540099026 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
popular-world.com popular-world.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 27 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 27 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 27 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 27 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 27 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 27 days
LOOP LOOP-5918 Jun 2020 Jun 2021 356 days
LOOP LOOP-S-2411 May 2020 Apr 2021 332 days
IEX IEX-186779 Jul 2020 Jun 2021 332 days
RUB RUB-18110 Jul 2020 Jun 2021 332 days
SCLP SCLP-390 Jun 2020 Apr 2021 296 days
SCLP SCLP-6426 Aug 2020 Jun 2021 288 days
IEX IEX-186266 May 2020 Feb 2021 270 days
OX OX-540553856 Jun 2020 Feb 2021 234 days
SCLP SCLP-6793 May 2020 Dec 2020 218 days
CA CA-PUB-1738284215641521 Aug 2020 Feb 2021 166 days
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 134 days
remaja.my remaja.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 269 days
PUBM PUBM-158039 Jul 2019 Apr 2020 269 days
YUME YUME-102973855 Jul 2019 Apr 2020 269 days
SVRN SVRN-230297 Jul 2019 Apr 2020 269 days
LIJI LIJI-230297 Jul 2019 Apr 2020 269 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 269 days
IEX IEX-186779 Jul 2019 Feb 2020 234 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 234 days
LOOP LOOP-5918 Aug 2019 Apr 2020 217 days
SCLP SCLP-390 Aug 2019 Apr 2020 217 days
OX OX-540553856 Aug 2019 Feb 2020 182 days
SCLP SCLP-6793 Oct 2019 Feb 2020 119 days
OX OX-540099026 Feb 2020 Apr 2020 40 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
sosugary.com sosugary.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Nov 2019 Apr 2020 144 days
PUBM PUBM-158039 Nov 2019 Apr 2020 144 days
OX OX-540553856 Nov 2019 Apr 2020 144 days
IEX IEX-186779 Nov 2019 Apr 2020 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 144 days
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
OX OX-539872073 Nov 2019 Mar 2020 131 days
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
SVRN SVRN-230297 Nov 2019 Mar 2020 110 days
SCLP SCLP-390 Nov 2019 Mar 2020 110 days
IEX IEX-186266 Jan 2020 Apr 2020 79 days
YUME YUME-102973855 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
codeforgender.com codeforgender.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jul 2020 75 days
IEX IEX-186779 May 2020 Jul 2020 75 days
LOOP LOOP-5918 May 2020 Jul 2020 75 days
PUBM PUBM-158039 May 2020 Jul 2020 75 days
YUME YUME-102973855 May 2020 Jul 2020 75 days
SVRN SVRN-230297 May 2020 Jul 2020 75 days
LIJI LIJI-230297 May 2020 Jul 2020 75 days
YIMO YIMO-2073946213921227802 May 2020 Jul 2020 75 days
RUB RUB-18110 May 2020 Jul 2020 53 days
SCLP SCLP-6793 May 2020 Jul 2020 53 days
LOOP LOOP-S-2411 May 2020 Jul 2020 39 days
IEX IEX-186266 May 2020 Jul 2020 39 days
OX OX-540099026 May 2020 Jul 2020 39 days
SCLP SCLP-6426 May 2020 May 2020 22 days
OX OX-540553856 Jul 2020 Jul 2020 14 days
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
SCLP SCLP-390 Jul 2020 Jul 2020 One Off
ltn.com.tw ltn.com.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
OX OX-540553856 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
SCLP SCLP-6793 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
LOOP LOOP-5918 Aug 2019 Mar 2020 199 days
IEX IEX-186779 Sep 2019 Mar 2020 175 days
LOOP LOOP-S-2411 Sep 2019 Mar 2020 175 days
IEX IEX-186266 Aug 2019 Jan 2020 154 days
OX OX-539872073 Aug 2019 Sep 2019 24 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
poki.it poki.it
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
poki.jp poki.jp
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
poki.nl poki.nl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
poki.pl poki.pl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
abovetopsecret.com abovetopsecret.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
YIMO YIMO-2073946213921227802 Nov 2019 Jun 2021 1 year, 207 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 174 days
PUBM PUBM-158039 Mar 2020 Jun 2021 1 year, 97 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186779 Sep 2019 Apr 2020 209 days
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
OX OX-540553856 Nov 2019 Apr 2020 144 days
YUME YUME-102973855 Nov 2019 Mar 2020 110 days
SCLP SCLP-390 Sep 2019 Nov 2019 65 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
thefamouspeople.com thefamouspeople.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
LOOP LOOP-5918 Aug 2019 Mar 2020 199 days
SCLP SCLP-390 Aug 2019 Mar 2020 199 days
IEX IEX-186779 Jul 2019 Jan 2020 186 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 186 days
PUBM PUBM-158039 Sep 2019 Mar 2020 175 days
YUME YUME-102973855 Sep 2019 Mar 2020 175 days
LIJI LIJI-230297 Jul 2019 Sep 2019 56 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
thpromotion.com thpromotion.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 May 2020 310 days
OX OX-540553856 Jul 2019 May 2020 310 days
PUBM PUBM-158039 Jul 2019 May 2020 310 days
YUME YUME-102973855 Jul 2019 May 2020 310 days
SVRN SVRN-230297 Jul 2019 May 2020 310 days
LIJI LIJI-230297 Jul 2019 May 2020 310 days
YIMO YIMO-2073946213921227802 Jul 2019 May 2020 310 days
IEX IEX-186266 Aug 2019 Mar 2020 194 days
IEX IEX-186779 Nov 2019 May 2020 193 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 183 days
OX OX-539872073 Nov 2019 Mar 2020 141 days
RUB RUB-18110 Jan 2020 May 2020 127 days
SCLP SCLP-390 Jan 2020 May 2020 127 days
LOOP LOOP-5918 Mar 2020 May 2020 78 days
SCLP SCLP-6426 Mar 2020 May 2020 52 days
SCLP SCLP-6793 May 2020 May 2020 One Off
vitdaily.com vitdaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 281 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 281 days
LIJI LIJI-230297 Jul 2019 Apr 2020 281 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 281 days
YUME YUME-102973855 Jul 2019 Apr 2020 265 days
PUBM PUBM-158039 Jul 2019 Jan 2020 200 days
IEX IEX-186266 Aug 2019 Mar 2020 196 days
LOOP LOOP-5918 Aug 2019 Mar 2020 196 days
SVRN SVRN-230297 Jul 2019 Nov 2019 135 days
SCLP SCLP-6793 Jan 2020 Mar 2020 47 days
OX OX-540099026 Feb 2020 Mar 2020 11 days
SCLP SCLP-6426 Mar 2020 Apr 2020 10 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
vtvgiaitri.vn vtvgiaitri.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 231 days
PUBM PUBM-158039 Jul 2019 Mar 2020 231 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 231 days
OX OX-540553856 Sep 2019 Mar 2020 177 days
RUB RUB-18110 Aug 2019 Jan 2020 149 days
SCLP SCLP-390 Nov 2019 Mar 2020 112 days
IEX IEX-186779 Jul 2019 Sep 2019 54 days
IEX IEX-186266 Jan 2020 Mar 2020 47 days
OX OX-540099026 Feb 2020 Mar 2020 11 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
brickset.com brickset.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Sep 2019 Mar 2020 175 days
PUBM PUBM-158039 Sep 2019 Mar 2020 175 days
SCLP SCLP-6793 Sep 2019 Mar 2020 175 days
YUME YUME-102973855 Sep 2019 Mar 2020 175 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
chordzaa.com chordzaa.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 261 days
YUME YUME-102973855 Jul 2019 Apr 2020 261 days
SVRN SVRN-230297 Jul 2019 Apr 2020 261 days
LIJI LIJI-230297 Jul 2019 Apr 2020 261 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 261 days
FWHL FWHL-897697 Jul 2019 Mar 2020 228 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 228 days
SCLP SCLP-6793 Jul 2019 Feb 2020 189 days
RUB RUB-18110 Feb 2020 Apr 2020 72 days
IEX IEX-186266 Aug 2019 Sep 2019 37 days
SCLP SCLP-390 Mar 2020 Apr 2020 33 days
OX OX-540099026 Feb 2020 Mar 2020 21 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
cnyes.com cnyes.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 265 days
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
PUBM PUBM-158039 Jul 2019 Apr 2020 265 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 265 days
SCLP SCLP-6793 Jul 2019 Apr 2020 265 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 265 days
IEX IEX-186266 Aug 2019 Apr 2020 233 days
IEX IEX-186779 Jul 2019 Mar 2020 231 days
OX OX-540553856 Jul 2019 Mar 2020 231 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
FWHL FWHL-897697 Jul 2019 Jan 2020 186 days
OX OX-539872073 Nov 2019 Mar 2020 110 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
LOOP LOOP-5918 Jan 2020 Mar 2020 45 days
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
doc24.vn doc24.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 167 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 167 days
PUBM PUBM-158039 Oct 2019 Mar 2020 167 days
YUME YUME-102973855 Oct 2019 Mar 2020 167 days
SCLP SCLP-390 Oct 2019 Mar 2020 167 days
SVRN SVRN-230297 Oct 2019 Mar 2020 167 days
LIJI LIJI-230297 Oct 2019 Mar 2020 167 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 167 days
IEX IEX-186266 Dec 2019 Mar 2020 103 days
OX OX-540553856 Dec 2019 Mar 2020 103 days
LOOP LOOP-5918 Dec 2019 Feb 2020 66 days
OX OX-539872073 Feb 2020 Mar 2020 37 days
IEX IEX-186779 Oct 2019 Oct 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Dec 2019 Dec 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
dodeden.com dodeden.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 314 days
IEX IEX-186779 Aug 2019 Jun 2021 1 year, 314 days
PUBM PUBM-158039 Aug 2019 Jun 2021 1 year, 314 days
YUME YUME-102973855 Aug 2019 Jun 2021 1 year, 314 days
SVRN SVRN-230297 Aug 2019 Jun 2021 1 year, 314 days
LIJI LIJI-230297 Aug 2019 Jun 2021 1 year, 314 days
YIMO YIMO-2073946213921227802 Aug 2019 Jun 2021 1 year, 314 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 296 days
LOOP LOOP-S-2411 Oct 2019 Apr 2021 1 year, 195 days
RUB RUB-18110 Feb 2020 Jun 2021 1 year, 125 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SCLP SCLP-390 Feb 2020 Apr 2021 1 year, 65 days
SCLP SCLP-6793 Dec 2019 Dec 2020 1 year, 17 days
IEX IEX-186266 Feb 2020 Feb 2021 1 year, 3 days
OX OX-540553856 Feb 2020 Feb 2021 1 year, 3 days
freemalaysiatoday.com freemalaysiatoday.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
LOOP LOOP-5918 Aug 2019 Apr 2020 233 days
SCLP SCLP-390 Aug 2019 Apr 2020 233 days
YUME YUME-102973855 Sep 2019 Apr 2020 209 days
PUBM PUBM-158039 Jul 2019 Jan 2020 205 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
OX OX-539872073 Sep 2019 Mar 2020 196 days
IEX IEX-186266 Nov 2019 Apr 2020 144 days
LOOP LOOP-S-2411 Sep 2019 Jan 2020 130 days
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
liputan.co.id liputan.co.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jun 2020 Jun 2021 364 days
IEX IEX-186779 Jun 2020 Jun 2021 364 days
LOOP LOOP-5918 Jun 2020 Jun 2021 364 days
PUBM PUBM-158039 Jun 2020 Jun 2021 364 days
YUME YUME-102973855 Jun 2020 Jun 2021 364 days
RUB RUB-18110 Jun 2020 Jun 2021 364 days
SVRN SVRN-230297 Jun 2020 Jun 2021 364 days
LIJI LIJI-230297 Jun 2020 Jun 2021 364 days
YIMO YIMO-2073946213921227802 Jun 2020 Jun 2021 364 days
OX OX-540099026 Jul 2020 Jun 2021 336 days
SCLP SCLP-6426 Jul 2020 Jun 2021 336 days
SCLP SCLP-390 Jun 2020 Apr 2021 304 days
LOOP LOOP-S-2411 Jul 2020 Apr 2021 276 days
OX OX-540553856 Jun 2020 Feb 2021 242 days
IEX IEX-186266 Jul 2020 Feb 2021 214 days
SCLP SCLP-6793 Jul 2020 Dec 2020 143 days
pesonapengantin.my pesonapengantin.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jun 2020 355 days
PUBM PUBM-158039 Jul 2019 Jun 2020 355 days
SVRN SVRN-230297 Jul 2019 Jun 2020 355 days
LIJI LIJI-230297 Jul 2019 Jun 2020 355 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2020 355 days
LOOP LOOP-S-2411 Jul 2019 Jun 2020 350 days
YUME YUME-102973855 Jul 2019 Jun 2020 350 days
RUB RUB-18110 Aug 2019 Jun 2020 304 days
IEX IEX-186266 Oct 2019 Jun 2020 236 days
SCLP SCLP-6793 Jul 2019 Feb 2020 234 days
LOOP LOOP-5918 Aug 2019 Jan 2020 133 days
SCLP SCLP-6426 Mar 2020 Jun 2020 84 days
IEX IEX-186779 Jul 2019 Jul 2019 5 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Jul 2019 Jul 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
phoenixnewtimes.com phoenixnewtimes.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Nov 2019 Mar 2020 110 days
OX OX-540553856 Jan 2020 Apr 2020 79 days
YUME YUME-102973855 Jan 2020 Apr 2020 79 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
RUB RUB-18110 Jan 2020 Apr 2020 79 days
IEX IEX-186779 Jan 2020 Apr 2020 79 days
IEX IEX-186266 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
FWHL FWHL-897697 Jan 2020 Mar 2020 45 days
SCLP SCLP-390 Jan 2020 Mar 2020 45 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
poki.cn poki.cn
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
aelitaxtranslate.com aelitaxtranslate.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Nov 2019 May 2020 183 days
YIMO YIMO-2073946213921227802 Nov 2019 May 2020 183 days
YUME YUME-102973855 Nov 2019 May 2020 183 days
LIJI LIJI-230297 Nov 2019 May 2020 183 days
FWHL FWHL-897697 Nov 2019 May 2020 164 days
SCLP SCLP-390 Nov 2019 May 2020 163 days
IEX IEX-186779 Nov 2019 May 2020 163 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 151 days
LOOP LOOP-5918 Jan 2020 May 2020 117 days
PUBM PUBM-158039 Jan 2020 May 2020 98 days
OX OX-540099026 Feb 2020 May 2020 91 days
OX OX-540553856 Mar 2020 May 2020 55 days
RUB RUB-18110 Mar 2020 Apr 2020 43 days
SCLP SCLP-6793 Apr 2020 May 2020 40 days
IEX IEX-186266 Apr 2020 May 2020 21 days
SCLP SCLP-6426 May 2020 May 2020 One Off
springnews.co.th springnews.co.th
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Apr 2020 278 days
SVRN SVRN-230297 Jul 2019 Apr 2020 278 days
LIJI LIJI-230297 Jul 2019 Apr 2020 278 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 278 days
YUME YUME-102973855 Jul 2019 Apr 2020 267 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
FWHL FWHL-897697 Jul 2019 Jan 2020 193 days
IEX IEX-186266 Aug 2019 Mar 2020 193 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 193 days
PUBM PUBM-158039 Jul 2019 Jan 2020 193 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
bernama.com bernama.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 186 days
YUME YUME-102973855 Jul 2019 Jan 2020 186 days
PUBM PUBM-158039 Jul 2019 Jan 2020 186 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 186 days
FWHL FWHL-897697 Jul 2019 Jan 2020 186 days
SCLP SCLP-390 Sep 2019 Jan 2020 130 days
OX OX-540553856 Jul 2019 Nov 2019 121 days
LIJI LIJI-230297 Jul 2019 Nov 2019 121 days
SCLP SCLP-6793 Jul 2019 Nov 2019 121 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
IEX IEX-186266 Aug 2019 Nov 2019 89 days
LOOP LOOP-5918 Aug 2019 Nov 2019 89 days
IEX IEX-186779 Sep 2019 Nov 2019 65 days
OX OX-539872073 Aug 2019 Sep 2019 24 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
turnnewsapp.com turnnewsapp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Jun 2021 1 year, 280 days
PUBM PUBM-158039 Sep 2019 Jun 2021 1 year, 280 days
YIMO YIMO-2073946213921227802 Sep 2019 Jun 2021 1 year, 280 days
YUME YUME-102973855 Sep 2019 Feb 2021 1 year, 158 days
SVRN SVRN-230297 Sep 2019 Feb 2021 1 year, 158 days
LIJI LIJI-230297 Sep 2019 Feb 2021 1 year, 158 days
IEX IEX-186266 Sep 2019 Dec 2020 1 year, 101 days
LOOP LOOP-S-2411 Sep 2019 Dec 2020 1 year, 101 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 24 days
IEX IEX-186779 May 2020 Feb 2021 267 days
OX OX-540553856 May 2020 Feb 2021 266 days
RUB RUB-18110 May 2020 Feb 2021 266 days
SCLP SCLP-6793 May 2020 Dec 2020 215 days
SCLP SCLP-6426 May 2020 Nov 2020 176 days
SCLP SCLP-390 May 2020 Jul 2020 58 days
OX OX-540099026 Nov 2020 Nov 2020 One Off
ytower.com.tw ytower.com.tw
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Jun 2021 1 year, 274 days
LIJI LIJI-230297 Sep 2019 Jun 2021 1 year, 274 days
YUME YUME-102973855 Sep 2019 Jun 2021 1 year, 274 days
FWHL FWHL-897697 Sep 2019 Jun 2021 1 year, 274 days
LOOP LOOP-5918 Sep 2019 Jun 2021 1 year, 274 days
PUBM PUBM-158039 Sep 2019 Jun 2021 1 year, 274 days
YIMO YIMO-2073946213921227802 Sep 2019 Jun 2021 1 year, 274 days
SCLP SCLP-390 Sep 2019 Apr 2021 1 year, 214 days
IEX IEX-186266 Sep 2019 Feb 2021 1 year, 152 days
RUB RUB-18110 Jan 2020 Jun 2021 1 year, 143 days
IEX IEX-186779 Jan 2020 Jun 2021 1 year, 143 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
OX OX-540553856 Jan 2020 Feb 2021 1 year, 21 days
SCLP SCLP-6793 Jan 2020 Dec 2020 334 days
LOOP LOOP-S-2411 May 2020 Apr 2021 327 days
OX OX-540099026 Apr 2021 Jun 2021 61 days
choosephilippines.com choosephilippines.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Apr 2020 264 days
SVRN SVRN-230297 Jul 2019 Apr 2020 264 days
LIJI LIJI-230297 Jul 2019 Apr 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 264 days
SCLP SCLP-6793 Jul 2019 Apr 2020 264 days
RUB RUB-18110 Aug 2019 Apr 2020 233 days
SCLP SCLP-390 Aug 2019 Apr 2020 233 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 230 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
PUBM PUBM-158039 Jul 2019 Sep 2019 55 days
YUME YUME-102973855 Jul 2019 Sep 2019 55 days
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
zi.media zi.media
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Jun 2021 1 year, 327 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 327 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 327 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 296 days
LOOP LOOP-S-2411 Nov 2019 Apr 2021 1 year, 146 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
OX OX-540553856 Nov 2019 Feb 2021 1 year, 84 days
IEX IEX-186779 Jul 2019 Apr 2020 265 days
SCLP SCLP-6793 Jul 2019 Apr 2020 265 days
FWHL FWHL-897697 Jul 2019 Apr 2020 265 days
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
YUME YUME-102973855 Jul 2019 Apr 2020 265 days
RUB RUB-18110 Jan 2020 Apr 2020 79 days
SCLP SCLP-6426 Mar 2020 Apr 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
dallasobserver.com dallasobserver.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Mar 2020 45 days
IEX IEX-186779 Jan 2020 Mar 2020 45 days
PUBM PUBM-158039 Jan 2020 Mar 2020 45 days
YIMO YIMO-2073946213921227802 Jan 2020 Mar 2020 45 days
RUB RUB-18110 Jan 2020 Mar 2020 45 days
OX OX-540553856 Jan 2020 Mar 2020 45 days
FWHL FWHL-897697 Jan 2020 Mar 2020 45 days
LIJI LIJI-230297 Jan 2020 Mar 2020 45 days
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
happeningbkk.com happeningbkk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Jun 2021 1 year, 247 days
LOOP LOOP-5918 Oct 2019 Jun 2021 1 year, 247 days
PUBM PUBM-158039 Oct 2019 Jun 2021 1 year, 247 days
YUME YUME-102973855 Oct 2019 Jun 2021 1 year, 247 days
RUB RUB-18110 Oct 2019 Jun 2021 1 year, 247 days
SVRN SVRN-230297 Oct 2019 Jun 2021 1 year, 247 days
LIJI LIJI-230297 Oct 2019 Jun 2021 1 year, 247 days
YIMO YIMO-2073946213921227802 Oct 2019 Jun 2021 1 year, 247 days
IEX IEX-186779 Dec 2019 Jun 2021 1 year, 182 days
IEX IEX-186266 Oct 2019 Feb 2021 1 year, 125 days
SCLP SCLP-6793 Oct 2019 Dec 2020 1 year, 73 days
OX OX-540099026 May 2020 Jun 2021 1 year, 33 days
LOOP LOOP-S-2411 May 2020 Apr 2021 338 days
SCLP SCLP-390 May 2020 Apr 2021 338 days
OX OX-540553856 May 2020 Feb 2021 276 days
OX OX-539872073 Dec 2019 Mar 2020 106 days
hotinfonow.com hotinfonow.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 32 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 32 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 32 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 32 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 32 days
FWHL FWHL-897697 Jun 2020 Jun 2021 1 year, 4 days
SCLP SCLP-6426 Jun 2020 Jun 2021 1 year, 4 days
LOOP LOOP-5918 Jun 2020 Jun 2021 1 year, 4 days
OX OX-540099026 Jun 2020 Jun 2021 1 year, 4 days
LOOP LOOP-S-2411 May 2020 Apr 2021 337 days
RUB RUB-18110 Jul 2020 Jun 2021 319 days
SCLP SCLP-390 Jul 2020 Apr 2021 277 days
IEX IEX-186266 May 2020 Feb 2021 275 days
OX OX-540553856 May 2020 Feb 2021 275 days
SCLP SCLP-6793 May 2020 Dec 2020 223 days
IEX IEX-186779 Jan 2021 Jun 2021 149 days
joiiup.com joiiup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2020 Jun 2021 336 days
PUBM PUBM-158039 Jul 2020 Jun 2021 336 days
YUME YUME-102973855 Jul 2020 Jun 2021 336 days
RUB RUB-18110 Jul 2020 Jun 2021 336 days
SVRN SVRN-230297 Jul 2020 Jun 2021 336 days
LIJI LIJI-230297 Jul 2020 Jun 2021 336 days
YIMO YIMO-2073946213921227802 Jul 2020 Jun 2021 336 days
IEX IEX-186779 Jul 2020 Jun 2021 336 days
LOOP LOOP-5918 Jul 2020 Jun 2021 336 days
OX OX-540099026 Jul 2020 Jun 2021 336 days
LOOP LOOP-S-2411 Jul 2020 Apr 2021 276 days
IEX IEX-186266 Jul 2020 Feb 2021 214 days
OX OX-540553856 Jul 2020 Feb 2021 196 days
SCLP SCLP-6793 Jul 2020 Dec 2020 162 days
SCLP SCLP-6426 Jan 2021 Jun 2021 141 days
SCLP SCLP-390 Dec 2020 Apr 2021 131 days
mombaby.com.tw mombaby.com.tw
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 296 days
YUME YUME-102973855 Aug 2019 Jun 2021 1 year, 296 days
SVRN SVRN-230297 Aug 2019 Jun 2021 1 year, 296 days
LIJI LIJI-230297 Aug 2019 Jun 2021 1 year, 296 days
YIMO YIMO-2073946213921227802 Aug 2019 Jun 2021 1 year, 296 days
IEX IEX-186779 Oct 2019 Jun 2021 1 year, 234 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 174 days
LOOP LOOP-S-2411 Oct 2019 Apr 2021 1 year, 174 days
SCLP SCLP-390 Oct 2019 Apr 2021 1 year, 174 days
SCLP SCLP-6793 Aug 2019 Dec 2020 1 year, 122 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
RUB RUB-18110 Feb 2020 Jun 2021 1 year, 111 days
FWHL FWHL-897697 Aug 2019 Mar 2020 220 days
PUBM PUBM-158039 Aug 2019 Mar 2020 220 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
motthegioi.vn motthegioi.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Mar 2020 1 year, 24 days
FWHL FWHL-897697 Jul 2019 Mar 2020 271 days
IEX IEX-186779 Jul 2019 Mar 2020 271 days
LIJI LIJI-230297 Jul 2019 Mar 2020 271 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 271 days
SVRN SVRN-230297 Jul 2019 Feb 2020 236 days
LOOP LOOP-5918 Aug 2019 Mar 2020 220 days
PUBM PUBM-158039 Aug 2019 Mar 2020 220 days
YUME YUME-102973855 Jul 2019 Dec 2019 178 days
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 157 days
IEX IEX-186266 Oct 2019 Feb 2020 122 days
RUB RUB-18110 Dec 2019 Mar 2020 93 days
SCLP SCLP-390 Dec 2019 Mar 2020 93 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
pushbike.tw pushbike.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 275 days
LIJI LIJI-230297 Jul 2019 Apr 2020 275 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 240 days
RUB RUB-18110 Aug 2019 Apr 2020 224 days
IEX IEX-186266 Aug 2019 Feb 2020 189 days
SVRN SVRN-230297 Jul 2019 Jan 2020 186 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 186 days
YUME YUME-102973855 Jul 2019 Jan 2020 180 days
LOOP LOOP-5918 Aug 2019 Oct 2019 70 days
OX OX-540553856 Oct 2019 Jan 2020 65 days
OX OX-540099026 Feb 2020 Apr 2020 39 days
FWHL FWHL-897697 Jul 2019 Jul 2019 6 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
OX OX-539872073 Aug 2019 Aug 2019 One Off
universemc.us universemc.us
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Apr 2021 322 days
PUBM PUBM-158039 May 2020 Apr 2021 322 days
YUME YUME-102973855 May 2020 Apr 2021 322 days
SVRN SVRN-230297 May 2020 Apr 2021 322 days
LIJI LIJI-230297 May 2020 Apr 2021 322 days
YIMO YIMO-2073946213921227802 May 2020 Apr 2021 322 days
IEX IEX-186266 May 2020 Feb 2021 266 days
LOOP LOOP-5918 May 2020 Feb 2021 260 days
RUB RUB-18110 May 2020 Feb 2021 260 days
SCLP SCLP-390 May 2020 Dec 2020 209 days
LOOP LOOP-S-2411 Oct 2020 Apr 2021 164 days
SCLP SCLP-6793 Sep 2020 Dec 2020 106 days
OX OX-540099026 Oct 2020 Dec 2020 51 days
IEX IEX-186779 Jul 2020 Jul 2020 One Off
SCLP SCLP-6426 Jul 2020 Jul 2020 One Off
OX OX-540553856 Feb 2021 Feb 2021 One Off
upmedia.mg upmedia.mg
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 332 days
LOOP LOOP-5918 Sep 2019 Jun 2021 1 year, 279 days
LOOP LOOP-S-2411 Jul 2019 Apr 2021 1 year, 272 days
OX OX-540553856 Jul 2019 Feb 2021 1 year, 210 days
IEX IEX-186266 Sep 2019 Feb 2021 1 year, 157 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SCLP SCLP-6793 Mar 2020 Dec 2020 292 days
PUBM PUBM-158039 Jul 2019 Apr 2020 266 days
FWHL FWHL-897697 Jul 2019 Apr 2020 266 days
IEX IEX-186779 Jul 2019 Apr 2020 266 days
YUME YUME-102973855 Jul 2019 Apr 2020 266 days
SVRN SVRN-230297 Jul 2019 Apr 2020 266 days
LIJI LIJI-230297 Jul 2019 Apr 2020 266 days
RUB RUB-18110 Aug 2019 Apr 2020 230 days
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
westword.com westword.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Apr 2020 284 days
YUME YUME-102973855 Jan 2020 Apr 2020 79 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
RUB RUB-18110 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
IEX IEX-186266 Jan 2020 Apr 2020 79 days
IEX IEX-186779 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
SCLP SCLP-390 Jan 2020 Apr 2020 79 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
cincainews.com cincainews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 May 2020 311 days
FWHL FWHL-897697 Jul 2019 May 2020 311 days
SCLP SCLP-6793 Jul 2019 May 2020 311 days
YIMO YIMO-2073946213921227802 Jul 2019 May 2020 311 days
YUME YUME-102973855 Jul 2019 May 2020 281 days
RUB RUB-18110 Aug 2019 May 2020 260 days
LOOP LOOP-5918 Aug 2019 May 2020 260 days
OX OX-540553856 Jul 2019 Mar 2020 257 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
SVRN SVRN-230297 Jul 2019 Feb 2020 188 days
LIJI LIJI-230297 Feb 2020 May 2020 93 days
OX OX-540099026 Feb 2020 May 2020 75 days
IEX IEX-186779 Mar 2020 May 2020 54 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
detalog.com detalog.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Aug 2019 Mar 2020 227 days
FWHL FWHL-897697 Aug 2019 Mar 2020 227 days
YUME YUME-102973855 Aug 2019 Mar 2020 227 days
SVRN SVRN-230297 Aug 2019 Mar 2020 227 days
LIJI LIJI-230297 Aug 2019 Mar 2020 227 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 227 days
OX OX-539872073 Aug 2019 Mar 2020 208 days
IEX IEX-186779 Aug 2019 Feb 2020 190 days
PUBM PUBM-158039 Sep 2019 Mar 2020 168 days
RUB RUB-18110 Sep 2019 Mar 2020 168 days
LOOP LOOP-5918 Sep 2019 Mar 2020 168 days
LOOP LOOP-S-2411 Aug 2019 Dec 2019 123 days
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
kocaelibarisgazetesi.com kocaelibarisgazetesi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Dec 2020 1 year, 173 days
LOOP LOOP-S-2411 Jul 2019 Dec 2020 1 year, 173 days
PUBM PUBM-158039 Jul 2019 Dec 2020 1 year, 173 days
YUME YUME-102973855 Jul 2019 Dec 2020 1 year, 173 days
SVRN SVRN-230297 Jul 2019 Dec 2020 1 year, 173 days
LIJI LIJI-230297 Jul 2019 Dec 2020 1 year, 173 days
YIMO YIMO-2073946213921227802 Jul 2019 Dec 2020 1 year, 173 days
IEX IEX-186779 Aug 2019 Dec 2020 1 year, 127 days
LOOP LOOP-5918 Aug 2019 Nov 2020 1 year, 84 days
RUB RUB-18110 Aug 2019 Nov 2020 1 year, 84 days
IEX IEX-186266 Aug 2019 Sep 2020 1 year, 20 days
SCLP SCLP-6793 Dec 2019 Nov 2020 328 days
OX OX-540553856 May 2020 Dec 2020 222 days
SCLP SCLP-390 May 2020 Dec 2020 222 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
libur.com.my libur.com.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 269 days
PUBM PUBM-158039 Jul 2019 Mar 2020 269 days
YUME YUME-102973855 Jul 2019 Mar 2020 269 days
SCLP SCLP-6793 Jul 2019 Mar 2020 269 days
SVRN SVRN-230297 Jul 2019 Mar 2020 269 days
LIJI LIJI-230297 Jul 2019 Mar 2020 269 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 269 days
IEX IEX-186779 Jul 2019 Feb 2020 234 days
RUB RUB-18110 Aug 2019 Mar 2020 218 days
LOOP LOOP-5918 Aug 2019 Mar 2020 218 days
OX OX-539872073 Aug 2019 Mar 2020 218 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 186 days
OX OX-540553856 Aug 2019 Feb 2020 186 days
IEX IEX-186266 Oct 2019 Mar 2020 159 days
SCLP SCLP-390 Aug 2019 Oct 2019 59 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
managertoday.com.tw managertoday.com.tw
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
IEX IEX-186779 Jul 2019 Apr 2020 284 days
OX OX-540553856 Jul 2019 Apr 2020 284 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 265 days
SCLP SCLP-6793 Jul 2019 Mar 2020 250 days
IEX IEX-186266 Aug 2019 Apr 2020 233 days
SCLP SCLP-390 Sep 2019 Apr 2020 209 days
LOOP LOOP-5918 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Nov 2019 Apr 2020 144 days
PUBM PUBM-158039 Jul 2019 Nov 2019 140 days
YUME YUME-102973855 Jul 2019 Nov 2019 121 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
OX OX-539872073 Sep 2019 Sep 2019 One Off
momocheck.tw momocheck.tw
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Mar 2020 271 days
SVRN SVRN-230297 Jul 2019 Mar 2020 271 days
YUME YUME-102973855 Jul 2019 Mar 2020 271 days
FWHL FWHL-897697 Jul 2019 Feb 2020 236 days
IEX IEX-186266 Aug 2019 Mar 2020 220 days
PUBM PUBM-158039 Jul 2019 Dec 2019 178 days
LIJI LIJI-230297 Jul 2019 Dec 2019 178 days
YIMO YIMO-2073946213921227802 Jul 2019 Dec 2019 178 days
SCLP SCLP-6793 Jul 2019 Dec 2019 178 days
LOOP LOOP-5918 Aug 2019 Dec 2019 127 days
OX OX-540553856 Jul 2019 Oct 2019 113 days
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
OX OX-539872073 Aug 2019 Aug 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Dec 2019 Dec 2019 One Off
turnnewsapp.com mycte.turnnewsapp.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Sep 2020 Jun 2021 276 days
FWHL FWHL-897697 Sep 2020 Jun 2021 276 days
IEX IEX-186779 Sep 2020 Jun 2021 276 days
PUBM PUBM-158039 Sep 2020 Jun 2021 276 days
RUB RUB-18110 Sep 2020 Jun 2021 276 days
SVRN SVRN-230297 Sep 2020 Jun 2021 276 days
LIJI LIJI-230297 Sep 2020 Jun 2021 276 days
YIMO YIMO-2073946213921227802 Sep 2020 Jun 2021 276 days
LOOP LOOP-S-2411 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Apr 2021 152 days
LOOP LOOP-5918 Feb 2021 Jun 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
OX OX-540099026 Feb 2021 Apr 2021 62 days
SCLP SCLP-390 Feb 2021 Apr 2021 62 days
IEX IEX-186266 Dec 2020 Feb 2021 52 days
OX OX-540553856 Dec 2020 Feb 2021 52 days
penatimor.com penatimor.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jun 2021 1 year, 163 days
IEX IEX-186779 Jan 2020 Jun 2021 1 year, 163 days
PUBM PUBM-158039 Jan 2020 Jun 2021 1 year, 163 days
YUME YUME-102973855 Jan 2020 Jun 2021 1 year, 163 days
SVRN SVRN-230297 Jan 2020 Jun 2021 1 year, 163 days
LIJI LIJI-230297 Jan 2020 Jun 2021 1 year, 163 days
YIMO YIMO-2073946213921227802 Jan 2020 Jun 2021 1 year, 163 days
LOOP LOOP-5918 Feb 2020 Jun 2021 1 year, 108 days
RUB RUB-18110 Feb 2020 Jun 2021 1 year, 108 days
LOOP LOOP-S-2411 Jan 2020 Apr 2021 1 year, 103 days
SCLP SCLP-390 Jan 2020 Apr 2021 1 year, 103 days
OX OX-540553856 Jul 2020 Feb 2021 210 days
OX OX-540099026 Feb 2020 Jul 2020 144 days
IEX IEX-186266 Feb 2020 Jun 2020 116 days
SCLP SCLP-6793 May 2020 Jul 2020 61 days
SCLP SCLP-6426 Mar 2020 May 2020 48 days
poki.be poki.be
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
pulsk.com pulsk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 217 days
IEX IEX-186266 Aug 2019 Apr 2020 217 days
PUBM PUBM-158039 Aug 2019 Apr 2020 217 days
YUME YUME-102973855 Aug 2019 Apr 2020 217 days
SVRN SVRN-230297 Aug 2019 Apr 2020 217 days
LIJI LIJI-230297 Aug 2019 Apr 2020 217 days
YIMO YIMO-2073946213921227802 Aug 2019 Apr 2020 217 days
RUB RUB-18110 Oct 2019 Apr 2020 154 days
LOOP LOOP-S-2411 Aug 2019 Jan 2020 128 days
OX OX-540553856 Jan 2020 Apr 2020 89 days
SCLP SCLP-390 Jan 2020 Feb 2020 54 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
rajah.com rajah.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Jun 2021 1 year, 63 days
IEX IEX-186266 Apr 2020 Feb 2021 306 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
OX OX-540553856 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
sohh.com sohh.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Apr 2020 209 days
RUB RUB-18110 Sep 2019 Apr 2020 209 days
LIJI LIJI-230297 Sep 2019 Apr 2020 209 days
OX OX-540553856 Sep 2019 Apr 2020 209 days
PUBM PUBM-158039 Sep 2019 Apr 2020 209 days
FWHL FWHL-897697 Sep 2019 Apr 2020 209 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 209 days
YUME YUME-102973855 Sep 2019 Apr 2020 209 days
OX OX-539872073 Sep 2019 Mar 2020 196 days
SVRN SVRN-230297 Sep 2019 Mar 2020 175 days
SCLP SCLP-6793 Sep 2019 Mar 2020 175 days
IEX IEX-186779 Sep 2019 Jan 2020 130 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
thetruenet.com thetruenet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 24 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 24 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 24 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 24 days
RUB RUB-18110 May 2020 Jun 2021 1 year, 24 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 24 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 24 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 24 days
SCLP SCLP-390 May 2020 Apr 2021 329 days
IEX IEX-186779 Sep 2020 Jun 2021 282 days
IEX IEX-186266 May 2020 Feb 2021 267 days
OX OX-540553856 May 2020 Feb 2021 267 days
OX OX-540099026 Oct 2020 Jun 2021 232 days
SCLP SCLP-6426 Oct 2020 Jun 2021 232 days
LOOP LOOP-S-2411 Feb 2021 Apr 2021 70 days
SCLP SCLP-6793 Dec 2020 Dec 2020 6 days
bella.tw bella.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 38 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 38 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 38 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 38 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 38 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 38 days
IEX IEX-186779 May 2020 Jun 2021 1 year, 17 days
RUB RUB-18110 May 2020 Jun 2021 1 year, 17 days
LOOP LOOP-5918 May 2020 Apr 2021 342 days
SCLP SCLP-6426 Jul 2020 Apr 2021 280 days
SCLP SCLP-6793 May 2020 Dec 2020 208 days
SCLP SCLP-390 May 2020 Nov 2020 190 days
IEX IEX-186266 May 2020 Sep 2020 127 days
OX OX-540553856 May 2020 Jul 2020 74 days
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
OX OX-540099026 Nov 2020 Nov 2020 One Off
tvshowbox.tw tvshowbox.tw
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 280 days
SCLP SCLP-6793 Jul 2019 Apr 2020 266 days
PUBM PUBM-158039 Jul 2019 Mar 2020 246 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 246 days
SCLP SCLP-390 Aug 2019 Apr 2020 229 days
LOOP LOOP-5918 Aug 2019 Apr 2020 229 days
FWHL FWHL-897697 Jul 2019 Jan 2020 197 days
IEX IEX-186779 Jul 2019 Jan 2020 197 days
LIJI LIJI-230297 Jul 2019 Jan 2020 197 days
OX OX-539872073 Aug 2019 Mar 2020 195 days
RUB RUB-18110 Aug 2019 Jan 2020 146 days
LOOP LOOP-S-2411 Jul 2019 Nov 2019 132 days
OX OX-540099026 Feb 2020 Apr 2020 44 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
umpan.com.my umpan.com.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 213 days
IEX IEX-186266 Sep 2019 Apr 2020 213 days
LOOP LOOP-5918 Sep 2019 Apr 2020 213 days
PUBM PUBM-158039 Sep 2019 Apr 2020 213 days
YUME YUME-102973855 Sep 2019 Apr 2020 213 days
SVRN SVRN-230297 Sep 2019 Apr 2020 213 days
LIJI LIJI-230297 Sep 2019 Apr 2020 213 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 213 days
IEX IEX-186779 Nov 2019 Mar 2020 113 days
SCLP SCLP-6426 Mar 2020 Apr 2020 10 days
OX OX-539872073 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
wildaboutmovies.com wildaboutmovies.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Aug 2019 Apr 2020 233 days
OX OX-540553856 Nov 2019 Apr 2020 144 days
LIJI LIJI-230297 Nov 2019 Apr 2020 144 days
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 144 days
SCLP SCLP-6793 Jul 2019 Nov 2019 140 days
IEX IEX-186779 Jan 2020 Apr 2020 79 days
RUB RUB-18110 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
YUME YUME-102973855 Jan 2020 Mar 2020 45 days
SCLP SCLP-390 Jan 2020 Mar 2020 45 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
wonkette.com wonkette.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Nov 2019 Mar 2020 110 days
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
YUME YUME-102973855 Nov 2019 Mar 2020 110 days
OX OX-539872073 Nov 2019 Mar 2020 110 days
OX OX-540553856 Nov 2019 Mar 2020 110 days
RUB RUB-18110 Nov 2019 Mar 2020 110 days
IEX IEX-186266 Nov 2019 Mar 2020 110 days
IEX IEX-186779 Nov 2019 Mar 2020 110 days
FWHL FWHL-897697 Nov 2019 Mar 2020 110 days
PUBM PUBM-158039 Nov 2019 Mar 2020 110 days
YIMO YIMO-2073946213921227802 Nov 2019 Mar 2020 110 days
LOOP LOOP-S-2411 Nov 2019 Jan 2020 65 days
SCLP SCLP-6793 Jan 2020 Mar 2020 45 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
zanzlanz.com zanzlanz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 285 days
LIJI LIJI-230297 Jul 2019 Apr 2020 285 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 285 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
IEX IEX-186266 Aug 2019 Apr 2020 234 days
RUB RUB-18110 Aug 2019 Apr 2020 234 days
LOOP LOOP-5918 Aug 2019 Apr 2020 234 days
PUBM PUBM-158039 Jul 2019 Mar 2020 230 days
IEX IEX-186779 Jul 2019 Mar 2020 230 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 210 days
SCLP SCLP-6793 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 49 days
OX OX-539872073 Aug 2019 Sep 2019 24 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
dailyview.tw dailyview.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Jun 2021 1 year, 193 days
PUBM PUBM-158039 Dec 2019 Jun 2021 1 year, 193 days
SVRN SVRN-230297 Dec 2019 Jun 2021 1 year, 193 days
LIJI LIJI-230297 Dec 2019 Jun 2021 1 year, 193 days
YIMO YIMO-2073946213921227802 Dec 2019 Jun 2021 1 year, 193 days
RUB RUB-18110 Mar 2020 Jun 2021 1 year, 89 days
IEX IEX-186266 Dec 2019 Feb 2021 1 year, 71 days
LOOP LOOP-S-2411 Feb 2020 Apr 2021 1 year, 66 days
SCLP SCLP-390 Feb 2020 Apr 2021 1 year, 66 days
OX OX-540099026 May 2020 Jun 2021 1 year, 36 days
LOOP LOOP-5918 Dec 2019 May 2020 180 days
OX OX-540553856 Dec 2019 May 2020 180 days
YUME YUME-102973855 Dec 2019 May 2020 180 days
IEX IEX-186779 Mar 2020 May 2020 76 days
SCLP SCLP-6426 Mar 2020 May 2020 63 days
SCLP SCLP-6793 Mar 2020 May 2020 53 days
dreamers.id dreamers.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jun 2020 Jun 2021 1 year, 11 days
PUBM PUBM-158039 Jun 2020 Jun 2021 1 year, 11 days
YUME YUME-102973855 Jun 2020 Jun 2021 1 year, 11 days
RUB RUB-18110 Jun 2020 Jun 2021 1 year, 11 days
SCLP SCLP-6426 Jun 2020 Jun 2021 1 year, 11 days
SVRN SVRN-230297 Jun 2020 Jun 2021 1 year, 11 days
LIJI LIJI-230297 Jun 2020 Jun 2021 1 year, 11 days
YIMO YIMO-2073946213921227802 Jun 2020 Jun 2021 1 year, 11 days
LOOP LOOP-5918 Jun 2020 Jun 2021 1 year, 11 days
OX OX-540099026 Jul 2020 Jun 2021 329 days
OX OX-540553856 Jun 2020 Feb 2021 254 days
IEX IEX-186266 Jul 2020 Feb 2021 217 days
SCLP SCLP-6793 Jul 2020 Dec 2020 165 days
LOOP LOOP-S-2411 Jun 2020 Sep 2020 100 days
SCLP SCLP-390 Jul 2020 Jul 2020 One Off
IEX IEX-186779 Sep 2020 Sep 2020 One Off
esports.id esports.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2020 Jun 2021 326 days
OX OX-540099026 Jul 2020 Jun 2021 326 days
PUBM PUBM-158039 Jul 2020 Jun 2021 326 days
YUME YUME-102973855 Jul 2020 Jun 2021 326 days
SVRN SVRN-230297 Jul 2020 Jun 2021 326 days
LIJI LIJI-230297 Jul 2020 Jun 2021 326 days
YIMO YIMO-2073946213921227802 Jul 2020 Jun 2021 326 days
LOOP LOOP-S-2411 Jul 2020 Apr 2021 266 days
IEX IEX-186266 Jul 2020 Feb 2021 204 days
OX OX-540553856 Jul 2020 Feb 2021 204 days
IEX IEX-186779 Jan 2021 Jun 2021 157 days
LOOP LOOP-5918 Jan 2021 Jun 2021 157 days
SCLP SCLP-6793 Jul 2020 Dec 2020 152 days
RUB RUB-18110 Feb 2021 Jun 2021 105 days
SCLP SCLP-6426 Feb 2021 Jun 2021 105 days
SCLP SCLP-390 Jan 2021 Apr 2021 97 days
free.com.tw free.com.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Aug 2019 Jun 2021 1 year, 310 days
PUBM PUBM-158039 Aug 2019 Jun 2021 1 year, 310 days
LIJI LIJI-230297 Aug 2019 Jun 2021 1 year, 310 days
YIMO YIMO-2073946213921227802 Aug 2019 Jun 2021 1 year, 310 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
LOOP LOOP-S-2411 Aug 2019 Apr 2021 1 year, 250 days
FWHL FWHL-897697 Aug 2019 Sep 2020 1 year, 34 days
YUME YUME-102973855 Aug 2019 Sep 2020 1 year, 34 days
SVRN SVRN-230297 Aug 2019 Sep 2020 1 year, 34 days
LOOP LOOP-5918 Jul 2020 Jun 2021 338 days
IEX IEX-186266 Mar 2020 Feb 2021 328 days
SCLP SCLP-390 Aug 2019 Jul 2020 323 days
SCLP SCLP-6793 Mar 2020 Dec 2020 276 days
OX OX-540553856 Feb 2020 May 2020 86 days
OX OX-540099026 May 2020 Jul 2020 61 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
givegoodjuju.com givegoodjuju.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 May 2020 Jan 2021 247 days
OX OX-540099026 May 2020 Jan 2021 247 days
FWHL FWHL-897697 May 2020 Jan 2021 247 days
LOOP LOOP-5918 May 2020 Jan 2021 247 days
YIMO YIMO-2073946213921227802 May 2020 Jan 2021 247 days
SCLP SCLP-6793 May 2020 Dec 2020 224 days
SVRN SVRN-230297 Aug 2020 Jan 2021 150 days
OX OX-540553856 Jul 2020 Nov 2020 144 days
YUME YUME-102973855 Jul 2020 Nov 2020 144 days
LIJI LIJI-230297 Jul 2020 Sep 2020 78 days
LOOP LOOP-S-2411 Jul 2020 Sep 2020 78 days
RUB RUB-18110 Jul 2020 Sep 2020 59 days
SCLP SCLP-390 Jul 2020 Sep 2020 59 days
IEX IEX-186779 Jul 2020 Jul 2020 One Off
SCLP SCLP-6426 Nov 2020 Nov 2020 One Off
PUBM PUBM-158039 Jan 2021 Jan 2021 One Off
mid-day.com mid-day.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
IEX IEX-186779 Jul 2019 Apr 2020 284 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 284 days
SCLP SCLP-6793 Jul 2019 Apr 2020 284 days
PUBM PUBM-158039 Jul 2019 Apr 2020 265 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
RUB RUB-18110 Aug 2019 Apr 2020 233 days
IEX IEX-186266 Aug 2019 Apr 2020 233 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
LOOP LOOP-5918 Sep 2019 Mar 2020 175 days
FWHL FWHL-897697 Jul 2019 Nov 2019 140 days
YUME YUME-102973855 Nov 2019 Jan 2020 65 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
SCLP SCLP-390 Jan 2020 Mar 2020 45 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
newser.com newser.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 144 days
LOOP LOOP-5918 Nov 2019 Apr 2020 144 days
OX OX-539872073 Nov 2019 Mar 2020 131 days
IEX IEX-186266 Nov 2019 Mar 2020 110 days
IEX IEX-186779 Nov 2019 Mar 2020 110 days
PUBM PUBM-158039 Nov 2019 Mar 2020 110 days
SVRN SVRN-230297 Nov 2019 Mar 2020 110 days
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
OX OX-540553856 Nov 2019 Mar 2020 110 days
YUME YUME-102973855 Nov 2019 Mar 2020 110 days
RUB RUB-18110 Nov 2019 Mar 2020 110 days
FWHL FWHL-897697 Nov 2019 Mar 2020 110 days
LOOP LOOP-S-2411 Jan 2020 Mar 2020 45 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
niniandblue.com niniandblue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jun 2021 1 year, 345 days
PUBM PUBM-158039 Jul 2019 Jun 2021 1 year, 345 days
YUME YUME-102973855 Jul 2019 Jun 2021 1 year, 345 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 345 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 345 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 345 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 294 days
LOOP LOOP-S-2411 Jul 2019 Apr 2021 1 year, 285 days
RUB RUB-18110 Aug 2019 Feb 2021 1 year, 174 days
SCLP SCLP-6793 Aug 2019 Dec 2020 1 year, 120 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SCLP SCLP-390 Feb 2020 Apr 2021 1 year, 50 days
IEX IEX-186266 Aug 2019 Sep 2020 1 year, 20 days
IEX IEX-186779 Nov 2020 Jun 2021 212 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 May 2020 May 2020 One Off
onlymyhealth.com onlymyhealth.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Aug 2019 Apr 2020 233 days
SCLP SCLP-390 Aug 2019 Apr 2020 233 days
LOOP LOOP-5918 Aug 2019 Apr 2020 233 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 186 days
PUBM PUBM-158039 Nov 2019 Apr 2020 144 days
SVRN SVRN-230297 Nov 2019 Apr 2020 144 days
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
IEX IEX-186779 Nov 2019 Apr 2020 144 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 144 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
LIJI LIJI-230297 Nov 2019 Jan 2020 65 days
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
poki.cz poki.cz
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
poki.de poki.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
RUB RUB-18110 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 31 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
aksisosial.org aksisosial.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2020 Dec 2020 141 days
LIJI LIJI-230297 Aug 2020 Dec 2020 141 days
YUME YUME-102973855 Aug 2020 Dec 2020 141 days
YIMO YIMO-2073946213921227802 Aug 2020 Dec 2020 141 days
FWHL FWHL-897697 Aug 2020 Dec 2020 141 days
SVRN SVRN-230297 Aug 2020 Dec 2020 141 days
RUB RUB-18110 Aug 2020 Nov 2020 103 days
LOOP LOOP-5918 Aug 2020 Nov 2020 103 days
LOOP LOOP-S-2411 Sep 2020 Dec 2020 102 days
SCLP SCLP-6793 Sep 2020 Dec 2020 100 days
OX OX-540553856 Sep 2020 Nov 2020 52 days
IEX IEX-186266 Nov 2020 Dec 2020 50 days
IEX IEX-186779 Aug 2020 Sep 2020 39 days
CA CA-PUB-2186101008500724 Nov 2020 Nov 2020 One Off
SCLP SCLP-390 Aug 2020 Aug 2020 One Off
newtalk.tw ap1.newtalk.tw
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 288 days
LIJI LIJI-230297 Jul 2019 Apr 2020 288 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 288 days
PUBM PUBM-158039 Jul 2019 Apr 2020 288 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 288 days
FWHL FWHL-897697 Jul 2019 Jan 2020 212 days
LOOP LOOP-5918 Aug 2019 Mar 2020 203 days
YUME YUME-102973855 Jul 2019 Jan 2020 188 days
SCLP SCLP-6793 Jul 2019 Nov 2019 122 days
IEX IEX-186266 Aug 2019 Nov 2019 95 days
OX OX-540099026 Feb 2020 Mar 2020 18 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
abplive.com abplive.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Nov 2019 Apr 2020 150 days
OX OX-540553856 Nov 2019 Apr 2020 150 days
FWHL FWHL-897697 Nov 2019 Apr 2020 150 days
SCLP SCLP-6793 Nov 2019 Apr 2020 150 days
SVRN SVRN-230297 Nov 2019 Apr 2020 150 days
LIJI LIJI-230297 Nov 2019 Apr 2020 150 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 150 days
OX OX-539872073 Nov 2019 Mar 2020 127 days
LOOP LOOP-S-2411 Nov 2019 Mar 2020 108 days
LOOP LOOP-5918 Jan 2020 Apr 2020 85 days
PUBM PUBM-158039 Nov 2019 Jan 2020 65 days
OX OX-540099026 Mar 2020 Apr 2020 42 days
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
sudsapda.com sudsapda.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 268 days
FWHL FWHL-897697 Jul 2019 Apr 2020 268 days
YUME YUME-102973855 Jul 2019 Apr 2020 268 days
SVRN SVRN-230297 Jul 2019 Apr 2020 268 days
LIJI LIJI-230297 Jul 2019 Apr 2020 268 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 268 days
LOOP LOOP-5918 Aug 2019 Apr 2020 228 days
OX OX-539872073 Aug 2019 Mar 2020 193 days
IEX IEX-186266 Aug 2019 Mar 2020 193 days
LOOP LOOP-S-2411 Sep 2019 Mar 2020 180 days
RUB RUB-18110 Aug 2019 Jan 2020 143 days
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
astroawani.com astroawani.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
IEX IEX-186779 Jul 2019 Mar 2020 231 days
PUBM PUBM-158039 Jul 2019 Mar 2020 231 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 231 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 186 days
RUB RUB-18110 Sep 2019 Mar 2020 175 days
OX OX-540553856 Sep 2019 Mar 2020 175 days
SCLP SCLP-6793 Sep 2019 Mar 2020 175 days
SCLP SCLP-390 Aug 2019 Jan 2020 154 days
OX OX-539872073 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
techz.vn techz.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Apr 2020 1 year, 37 days
LIJI LIJI-230297 Jul 2019 Apr 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 264 days
FWHL FWHL-897697 Sep 2019 Apr 2020 209 days
OX OX-540553856 Sep 2019 Apr 2020 209 days
LOOP LOOP-5918 Sep 2019 Apr 2020 209 days
YUME YUME-102973855 Sep 2019 Apr 2020 209 days
SVRN SVRN-230297 Jul 2019 Jan 2020 185 days
SCLP SCLP-390 Aug 2019 Jan 2020 154 days
RUB RUB-18110 Sep 2019 Jan 2020 130 days
PUBM PUBM-158039 Sep 2019 Nov 2019 65 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
IEX IEX-186779 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Nov 2019 Nov 2019 One Off
thethao247.vn thethao247.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Apr 2020 1 year, 37 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
OX OX-540553856 Jul 2019 Mar 2020 250 days
PUBM PUBM-158039 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
CA CA-PUB-2186101008500724 Oct 2019 Apr 2020 170 days
SCLP SCLP-390 Aug 2019 Jan 2020 154 days
IEX IEX-186266 Aug 2019 Jan 2020 154 days
LIJI LIJI-230297 Jul 2019 Sep 2019 75 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
LOOP LOOP-5918 Aug 2019 Sep 2019 24 days
OX OX-539872073 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
batman-news.com batman-news.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jan 2020 205 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 205 days
OX OX-540553856 Jul 2019 Jan 2020 205 days
FWHL FWHL-897697 Jul 2019 Jan 2020 205 days
IEX IEX-186266 Aug 2019 Jan 2020 154 days
OX OX-539872073 Aug 2019 Jan 2020 154 days
RUB RUB-18110 Aug 2019 Jan 2020 154 days
SVRN SVRN-230297 Jul 2019 Nov 2019 140 days
LIJI LIJI-230297 Jul 2019 Nov 2019 121 days
YUME YUME-102973855 Nov 2019 Jan 2020 65 days
PUBM PUBM-158039 Nov 2019 Jan 2020 65 days
LOOP LOOP-S-2411 Jul 2019 Jul 2019 19 days
SCLP SCLP-6793 Jul 2019 Jul 2019 19 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
toonado.com toonado.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 267 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 267 days
RUB RUB-18110 Aug 2019 Apr 2020 229 days
OX OX-539872073 Sep 2019 Mar 2020 204 days
SVRN SVRN-230297 Jul 2019 Nov 2019 118 days
OX OX-540553856 Nov 2019 Jan 2020 65 days
YUME YUME-102973855 Jul 2019 Sep 2019 54 days
SCLP SCLP-6793 Jul 2019 Sep 2019 54 days
LIJI LIJI-230297 Jul 2019 Sep 2019 54 days
IEX IEX-186266 Aug 2019 Sep 2019 16 days
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
vanz.bike vanz.bike
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
browardpalmbeach.com browardpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Jan 2020 205 days
IEX IEX-186266 Jan 2020 Apr 2020 79 days
IEX IEX-186779 Jan 2020 Apr 2020 79 days
OX OX-540553856 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
RUB RUB-18110 Jan 2020 Apr 2020 79 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
harianhaluan.com harianhaluan.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jul 2020 69 days
IEX IEX-186266 May 2020 Jul 2020 69 days
LOOP LOOP-5918 May 2020 Jul 2020 69 days
PUBM PUBM-158039 May 2020 Jul 2020 69 days
YUME YUME-102973855 May 2020 Jul 2020 69 days
SCLP SCLP-390 May 2020 Jul 2020 69 days
SVRN SVRN-230297 May 2020 Jul 2020 69 days
LIJI LIJI-230297 May 2020 Jul 2020 69 days
YIMO YIMO-2073946213921227802 May 2020 Jul 2020 69 days
RUB RUB-18110 Jun 2020 Jul 2020 32 days
OX OX-540553856 Jul 2020 Jul 2020 9 days
IEX IEX-186779 Jun 2020 Jun 2020 One Off
LOOP LOOP-S-2411 Jul 2020 Jul 2020 One Off
SCLP SCLP-6793 Jul 2020 Jul 2020 One Off
CA CA-PUB-1738284215641521 Jul 2020 Jul 2020 One Off
hops.id hops.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2020 Sep 2020 53 days
OX OX-540099026 Jul 2020 Sep 2020 53 days
PUBM PUBM-158039 Jul 2020 Sep 2020 53 days
YUME YUME-102973855 Jul 2020 Sep 2020 53 days
SVRN SVRN-230297 Jul 2020 Sep 2020 53 days
LIJI LIJI-230297 Jul 2020 Sep 2020 53 days
YIMO YIMO-2073946213921227802 Jul 2020 Sep 2020 53 days
IEX IEX-186266 Jul 2020 Jul 2020 One Off
LOOP LOOP-5918 Jul 2020 Jul 2020 One Off
OX OX-540553856 Jul 2020 Jul 2020 One Off
SCLP SCLP-6426 Jul 2020 Jul 2020 One Off
SCLP SCLP-6793 Jul 2020 Jul 2020 One Off
IEX IEX-186779 Sep 2020 Sep 2020 One Off
LOOP LOOP-S-2411 Sep 2020 Sep 2020 One Off
SCLP SCLP-390 Sep 2020 Sep 2020 One Off
ibudanbalita.net ibudanbalita.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 223 days
PUBM PUBM-158039 Aug 2019 Mar 2020 223 days
YUME YUME-102973855 Aug 2019 Mar 2020 223 days
SVRN SVRN-230297 Aug 2019 Mar 2020 223 days
LIJI LIJI-230297 Aug 2019 Mar 2020 223 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 223 days
IEX IEX-186266 Aug 2019 Feb 2020 179 days
OX OX-540553856 Oct 2019 Mar 2020 162 days
RUB RUB-18110 Oct 2019 Mar 2020 162 days
IEX IEX-186779 Dec 2019 Mar 2020 98 days
LOOP LOOP-5918 Dec 2019 Mar 2020 98 days
SCLP SCLP-6793 Dec 2019 Mar 2020 98 days
LOOP LOOP-S-2411 Aug 2019 Oct 2019 61 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
indozone.id indozone.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2020 Jun 2020 One Off
CA CA-PUB-2186101008500724 Jun 2020 Jun 2020 One Off
FWHL FWHL-897697 Jun 2020 Jun 2020 One Off
IEX IEX-186266 Jun 2020 Jun 2020 One Off
IEX IEX-186779 Jun 2020 Jun 2020 One Off
LOOP LOOP-S-2411 Jun 2020 Jun 2020 One Off
LOOP LOOP-5918 Jun 2020 Jun 2020 One Off
OX OX-540099026 Jun 2020 Jun 2020 One Off
OX OX-540553856 Jun 2020 Jun 2020 One Off
PUBM PUBM-158039 Jun 2020 Jun 2020 One Off
YUME YUME-102973855 Jun 2020 Jun 2020 One Off
SCLP SCLP-6793 Jun 2020 Jun 2020 One Off
SVRN SVRN-230297 Jun 2020 Jun 2020 One Off
LIJI LIJI-230297 Jun 2020 Jun 2020 One Off
YIMO YIMO-2073946213921227802 Jun 2020 Jun 2020 One Off
jagran.com jagran.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 250 days
SCLP SCLP-6793 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 230 days
IEX IEX-186779 Jul 2019 Jan 2020 205 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 205 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Aug 2019 Jan 2020 154 days
FWHL FWHL-897697 Jul 2019 Nov 2019 120 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 75 days
LOOP LOOP-5918 Jan 2020 Mar 2020 45 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
juksy.me juksy.me
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 161 days
SVRN SVRN-230297 Oct 2019 Mar 2020 161 days
LIJI LIJI-230297 Oct 2019 Mar 2020 161 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 161 days
IEX IEX-186266 Oct 2019 Feb 2020 126 days
PUBM PUBM-158039 Oct 2019 Feb 2020 126 days
YUME YUME-102973855 Oct 2019 Feb 2020 126 days
RUB RUB-18110 Oct 2019 Feb 2020 126 days
SCLP SCLP-390 Dec 2019 Mar 2020 96 days
IEX IEX-186779 Dec 2019 Mar 2020 96 days
LOOP LOOP-5918 Oct 2019 Dec 2019 65 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
OX OX-540553856 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
katadata.co.id katadata.co.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 267 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 267 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 233 days
SVRN SVRN-230297 Jul 2019 Feb 2020 233 days
LIJI LIJI-230297 Jul 2019 Feb 2020 233 days
SCLP SCLP-6793 Aug 2019 Mar 2020 222 days
IEX IEX-186266 Aug 2019 Mar 2020 216 days
IEX IEX-186779 Aug 2019 Feb 2020 188 days
PUBM PUBM-158039 Jul 2019 Dec 2019 171 days
OX OX-540553856 Oct 2019 Feb 2020 126 days
LOOP LOOP-5918 Aug 2019 Dec 2019 120 days
CA CA-PUB-2186101008500724 Oct 2019 Feb 2020 119 days
YUME YUME-102973855 Jul 2019 Oct 2019 107 days
CA CA-PUB-1738284215641521 Feb 2020 Mar 2020 34 days
OX OX-540099026 Mar 2020 Mar 2020 One Off
kilastimor.com kilastimor.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Jun 2021 1 year, 79 days
OX OX-540099026 Mar 2020 Jun 2021 1 year, 79 days
PUBM PUBM-158039 Mar 2020 Jun 2021 1 year, 79 days
YUME YUME-102973855 Mar 2020 Jun 2021 1 year, 79 days
RUB RUB-18110 Mar 2020 Jun 2021 1 year, 79 days
SVRN SVRN-230297 Mar 2020 Jun 2021 1 year, 79 days
LIJI LIJI-230297 Mar 2020 Jun 2021 1 year, 79 days
YIMO YIMO-2073946213921227802 Mar 2020 Jun 2021 1 year, 79 days
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 19 days
SCLP SCLP-390 May 2020 Apr 2021 336 days
IEX IEX-186266 Mar 2020 Feb 2021 322 days
SCLP SCLP-6793 Mar 2020 Dec 2020 270 days
IEX IEX-186779 May 2021 Jun 2021 23 days
LOOP LOOP-5918 May 2021 Jun 2021 23 days
SCLP SCLP-6426 May 2021 Jun 2021 23 days
kipkipfun.com kipkipfun.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 96 days
IEX IEX-186266 Dec 2019 Mar 2020 96 days
PUBM PUBM-158039 Dec 2019 Mar 2020 96 days
YUME YUME-102973855 Dec 2019 Mar 2020 96 days
SCLP SCLP-6793 Dec 2019 Mar 2020 96 days
SVRN SVRN-230297 Dec 2019 Mar 2020 96 days
LIJI LIJI-230297 Dec 2019 Mar 2020 96 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 96 days
LOOP LOOP-S-2411 Dec 2019 Feb 2020 61 days
RUB RUB-18110 Dec 2019 Feb 2020 61 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
lagged.com lagged.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 269 days
IEX IEX-186779 Jul 2019 Mar 2020 269 days
SVRN SVRN-230297 Jul 2019 Mar 2020 269 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 269 days
SCLP SCLP-6793 Jul 2019 Mar 2020 269 days
OX OX-539872073 Aug 2019 Mar 2020 218 days
RUB RUB-18110 Aug 2019 Mar 2020 218 days
OX OX-540553856 Dec 2019 Mar 2020 96 days
IEX IEX-186266 Dec 2019 Mar 2020 96 days
PUBM PUBM-158039 Dec 2019 Mar 2020 96 days
YUME YUME-102973855 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 33 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
love-beauty.cc love-beauty.cc
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Jun 2021 1 year, 113 days
LOOP LOOP-5918 Feb 2020 Jun 2021 1 year, 113 days
SCLP SCLP-390 Feb 2020 Apr 2021 1 year, 53 days
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 17 days
OX OX-540553856 Feb 2020 Feb 2021 356 days
RUB RUB-18110 Feb 2020 Mar 2020 36 days
PUBM PUBM-158039 Feb 2020 Mar 2020 36 days
SVRN SVRN-230297 Feb 2020 Mar 2020 36 days
YUME YUME-102973855 Feb 2020 Mar 2020 36 days
IEX IEX-186779 Feb 2020 Mar 2020 36 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 36 days
OX OX-540099026 Feb 2020 Mar 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 1 day
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
mugeanlitv.com mugeanlitv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 271 days
PUBM PUBM-158039 Jul 2019 Mar 2020 271 days
YUME YUME-102973855 Jul 2019 Mar 2020 271 days
SVRN SVRN-230297 Jul 2019 Mar 2020 271 days
LIJI LIJI-230297 Jul 2019 Mar 2020 271 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 271 days
IEX IEX-186779 Aug 2019 Mar 2020 220 days
OX OX-540553856 Aug 2019 Mar 2020 220 days
IEX IEX-186266 Aug 2019 Oct 2019 63 days
LOOP LOOP-5918 Aug 2019 Oct 2019 63 days
SCLP SCLP-6793 Aug 2019 Oct 2019 62 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 36 days
SCLP SCLP-390 Feb 2020 Mar 2020 36 days
RUB RUB-18110 Aug 2019 Aug 2019 One Off
OX OX-539872073 Oct 2019 Oct 2019 One Off
newtalk.tw newtalkcdn29080164.newtalk.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
FWHL FWHL-897697 Jul 2019 Feb 2020 235 days
RUB RUB-18110 Oct 2019 Mar 2020 157 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 157 days
IEX IEX-186779 Oct 2019 Feb 2020 122 days
OX OX-540553856 Oct 2019 Dec 2019 65 days
SCLP SCLP-6793 Oct 2019 Dec 2019 65 days
IEX IEX-186266 Aug 2019 Oct 2019 64 days
LOOP LOOP-5918 Aug 2019 Aug 2019 2 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
popbela.com popbela.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 275 days
FWHL FWHL-897697 Jul 2019 Apr 2020 275 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 275 days
YUME YUME-102973855 Jul 2019 Apr 2020 270 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 240 days
SCLP SCLP-6793 Jul 2019 Feb 2020 240 days
IEX IEX-186266 Aug 2019 Apr 2020 224 days
LOOP LOOP-5918 Aug 2019 Apr 2020 224 days
SCLP SCLP-390 Aug 2019 Apr 2020 224 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
SVRN SVRN-230297 Jul 2019 Oct 2019 120 days
LIJI LIJI-230297 Jul 2019 Oct 2019 120 days
IEX IEX-186779 Oct 2019 Feb 2020 120 days
RUB RUB-18110 Aug 2019 Oct 2019 69 days
OX OX-540099026 Feb 2020 Feb 2020 One Off
popmama.com popmama.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Apr 2020 275 days
FWHL FWHL-897697 Jul 2019 Apr 2020 275 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 275 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 275 days
IEX IEX-186779 Jul 2019 Apr 2020 270 days
YUME YUME-102973855 Jul 2019 Apr 2020 270 days
LIJI LIJI-230297 Jul 2019 Feb 2020 240 days
PUBM PUBM-158039 Jul 2019 Feb 2020 235 days
LOOP LOOP-5918 Aug 2019 Feb 2020 189 days
SVRN SVRN-230297 Jul 2019 Jan 2020 185 days
SCLP SCLP-6793 Aug 2019 Feb 2020 183 days
OX OX-539872073 Aug 2019 Oct 2019 69 days
IEX IEX-186266 Jan 2020 Feb 2020 55 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
posttoday.com posttoday.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Apr 2020 264 days
OX OX-540553856 Jul 2019 Apr 2020 264 days
PUBM PUBM-158039 Jul 2019 Apr 2020 264 days
YUME YUME-102973855 Jul 2019 Apr 2020 264 days
SVRN SVRN-230297 Jul 2019 Apr 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 264 days
RUB RUB-18110 Aug 2019 Apr 2020 233 days
LOOP LOOP-5918 Aug 2019 Apr 2020 233 days
FWHL FWHL-897697 Jul 2019 Mar 2020 230 days
LIJI LIJI-230297 Jul 2019 Nov 2019 120 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
SCLP SCLP-390 Jan 2020 Mar 2020 45 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
queeniego.com queeniego.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Apr 2020 276 days
PUBM PUBM-158039 Jul 2019 Apr 2020 276 days
RUB RUB-18110 Aug 2019 Apr 2020 225 days
IEX IEX-186266 Aug 2019 Apr 2020 225 days
OX OX-540553856 Aug 2019 Apr 2020 218 days
LOOP LOOP-5918 Aug 2019 Feb 2020 189 days
FWHL FWHL-897697 Jul 2019 Jan 2020 187 days
SVRN SVRN-230297 Jul 2019 Jan 2020 187 days
LIJI LIJI-230297 Jul 2019 Jan 2020 187 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 187 days
OX OX-539872073 Oct 2019 Mar 2020 150 days
LOOP LOOP-S-2411 Jul 2019 Oct 2019 115 days
YUME YUME-102973855 Jul 2019 Oct 2019 115 days
SCLP SCLP-6793 Jan 2020 Apr 2020 89 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
rubycatlife.com rubycatlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 277 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 269 days
PUBM PUBM-158039 Jul 2019 Feb 2020 242 days
OX OX-540553856 Jul 2019 Feb 2020 242 days
SCLP SCLP-6793 Jul 2019 Feb 2020 242 days
RUB RUB-18110 Aug 2019 Apr 2020 226 days
SCLP SCLP-390 Aug 2019 Apr 2020 226 days
SVRN SVRN-230297 Jul 2019 Jan 2020 189 days
LIJI LIJI-230297 Jul 2019 Jan 2020 189 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 189 days
LOOP LOOP-5918 Aug 2019 Jan 2020 138 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
stars12.com stars12.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 268 days
IEX IEX-186779 Jul 2019 Apr 2020 268 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 268 days
OX OX-540553856 Jul 2019 Apr 2020 268 days
PUBM PUBM-158039 Jul 2019 Apr 2020 268 days
SVRN SVRN-230297 Jul 2019 Apr 2020 268 days
LIJI LIJI-230297 Jul 2019 Apr 2020 268 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 268 days
YUME YUME-102973855 Jul 2019 Mar 2020 233 days
IEX IEX-186266 Nov 2019 Apr 2020 152 days
LOOP LOOP-5918 Nov 2019 Apr 2020 152 days
OX OX-540099026 Feb 2020 Apr 2020 43 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
tipsdancara.net tipsdancara.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 214 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 214 days
PUBM PUBM-158039 Sep 2019 Apr 2020 214 days
YUME YUME-102973855 Sep 2019 Apr 2020 214 days
SVRN SVRN-230297 Sep 2019 Apr 2020 214 days
LIJI LIJI-230297 Sep 2019 Apr 2020 214 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 214 days
IEX IEX-186779 Nov 2019 Apr 2020 150 days
SCLP SCLP-390 Nov 2019 Apr 2020 150 days
IEX IEX-186266 Sep 2019 Jan 2020 130 days
OX OX-540553856 Sep 2019 Jan 2020 130 days
LOOP LOOP-5918 Nov 2019 Jan 2020 66 days
RUB RUB-18110 Jan 2020 Mar 2020 49 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
toonclub-th.co toonclub-th.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 280 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 280 days
LIJI LIJI-230297 Jul 2019 Apr 2020 280 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 280 days
SVRN SVRN-230297 Jul 2019 Mar 2020 246 days
YUME YUME-102973855 Jul 2019 Mar 2020 233 days
RUB RUB-18110 Sep 2019 Apr 2020 213 days
PUBM PUBM-158039 Jul 2019 Jan 2020 196 days
LOOP LOOP-5918 Aug 2019 Mar 2020 195 days
SCLP SCLP-390 Aug 2019 Mar 2020 195 days
IEX IEX-186779 Jul 2019 Jan 2020 183 days
IEX IEX-186266 Aug 2019 Nov 2019 80 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
tuoitre.vn tuoitre.vn
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LOOP LOOP-S-2411 Sep 2019 Mar 2020 175 days
IEX IEX-186779 Jul 2019 Nov 2019 140 days
OX OX-540553856 Jul 2019 Nov 2019 140 days
FWHL FWHL-897697 Jul 2019 Nov 2019 140 days
PUBM PUBM-158039 Jul 2019 Nov 2019 121 days
LOOP LOOP-5918 Aug 2019 Nov 2019 89 days
IEX IEX-186266 Aug 2019 Nov 2019 89 days
OX OX-539872073 Aug 2019 Nov 2019 89 days
RUB RUB-18110 Sep 2019 Nov 2019 65 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
blocktoro.com blocktoro.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Apr 2020 263 days
PUBM PUBM-158039 Jul 2019 Apr 2020 263 days
OX OX-540553856 Jul 2019 Apr 2020 263 days
FWHL FWHL-897697 Jul 2019 Apr 2020 263 days
YUME YUME-102973855 Jul 2019 Apr 2020 263 days
SVRN SVRN-230297 Jul 2019 Apr 2020 263 days
LIJI LIJI-230297 Jul 2019 Apr 2020 263 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 263 days
LOOP LOOP-5918 Aug 2019 Apr 2020 239 days
SCLP SCLP-390 Aug 2019 Mar 2020 205 days
RUB RUB-18110 Aug 2019 Nov 2019 99 days
SCLP SCLP-6793 Feb 2020 Apr 2020 75 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 41 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
bluesea0925.com bluesea0925.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 140 days
IEX IEX-186266 Nov 2019 Apr 2020 140 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 140 days
YUME YUME-102973855 Nov 2019 Apr 2020 140 days
SVRN SVRN-230297 Nov 2019 Apr 2020 140 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 140 days
SCLP SCLP-6793 Feb 2020 Apr 2020 75 days
LOOP LOOP-5918 Feb 2020 Mar 2020 41 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 15 days
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
vropinions.com vropinions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 212 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 212 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 212 days
IEX IEX-186266 Sep 2019 Mar 2020 177 days
YUME YUME-102973855 Sep 2019 Mar 2020 177 days
SVRN SVRN-230297 Sep 2019 Mar 2020 177 days
LIJI LIJI-230297 Sep 2019 Mar 2020 177 days
RUB RUB-18110 Jan 2020 Apr 2020 82 days
PUBM PUBM-158039 Sep 2019 Nov 2019 65 days
LOOP LOOP-5918 Nov 2019 Jan 2020 65 days
OX OX-539872073 Nov 2019 Jan 2020 65 days
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Nov 2019 Nov 2019 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
epic7x.com epic7x.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Aug 2019 Jun 2021 1 year, 312 days
FWHL FWHL-897697 Jul 2019 Apr 2020 291 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 291 days
PUBM PUBM-158039 Aug 2019 Apr 2020 256 days
SCLP SCLP-390 Aug 2019 Apr 2020 240 days
SVRN SVRN-230297 Aug 2019 Mar 2020 226 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 225 days
OX OX-540553856 Feb 2020 Apr 2020 66 days
SCLP SCLP-6793 Feb 2020 Mar 2020 36 days
YUME YUME-102973855 Mar 2020 Apr 2020 30 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
gtplanet.net gtplanet.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
IEX IEX-186266 Apr 2020 Feb 2021 306 days
OX OX-540553856 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
YUME YUME-102973855 Jul 2019 Apr 2020 264 days
LOOP LOOP-5918 Aug 2019 Apr 2020 233 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
SCLP SCLP-390 Aug 2019 Nov 2019 89 days
SCLP SCLP-6793 Jan 2020 Apr 2020 79 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
houstonpress.com houstonpress.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Apr 2020 284 days
RUB RUB-18110 Jan 2020 Apr 2020 98 days
OX OX-540553856 Jan 2020 Apr 2020 98 days
YUME YUME-102973855 Jan 2020 Apr 2020 98 days
IEX IEX-186266 Jan 2020 Apr 2020 98 days
IEX IEX-186779 Jan 2020 Apr 2020 98 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 98 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
PUBM PUBM-158039 Jan 2020 Mar 2020 45 days
SVRN SVRN-230297 Jan 2020 Mar 2020 45 days
LIJI LIJI-230297 Jan 2020 Mar 2020 45 days
SCLP SCLP-6793 Jan 2020 Mar 2020 45 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
inews.id inews.id
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Dec 2019 Feb 2020 63 days
IEX IEX-186779 Dec 2019 Feb 2020 63 days
FWHL FWHL-897697 Dec 2019 Feb 2020 63 days
PUBM PUBM-158039 Dec 2019 Feb 2020 63 days
OX OX-539872073 Dec 2019 Feb 2020 63 days
OX OX-540553856 Dec 2019 Feb 2020 63 days
YUME YUME-102973855 Dec 2019 Feb 2020 63 days
RUB RUB-18110 Dec 2019 Feb 2020 63 days
YIMO YIMO-2073946213921227802 Dec 2019 Feb 2020 63 days
IEX IEX-186266 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
inextlive.com inextlive.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 223 days
YUME YUME-102973855 Aug 2019 Mar 2020 223 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 223 days
RUB RUB-18110 Aug 2019 Mar 2020 215 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 188 days
OX OX-539872073 Aug 2019 Dec 2019 117 days
OX OX-540553856 Dec 2019 Feb 2020 63 days
SVRN SVRN-230297 Dec 2019 Feb 2020 63 days
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
ngthai.com ngthai.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 270 days
OX OX-540553856 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
LOOP LOOP-5918 Aug 2019 Mar 2020 221 days
RUB RUB-18110 Aug 2019 Mar 2020 219 days
SCLP SCLP-6793 Oct 2019 Feb 2020 121 days
IEX IEX-186779 Jul 2019 Aug 2019 51 days
PUBM PUBM-158039 Jul 2019 Aug 2019 51 days
SCLP SCLP-6426 Mar 2020 Mar 2020 1 day
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
ontheflix.com ontheflix.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Sep 2019 Apr 2020 209 days
PUBM PUBM-158039 Sep 2019 Apr 2020 209 days
SCLP SCLP-390 Sep 2019 Apr 2020 209 days
SCLP SCLP-6793 Sep 2019 Apr 2020 209 days
RUB RUB-18110 Sep 2019 Apr 2020 209 days
IEX IEX-186266 Sep 2019 Apr 2020 209 days
LIJI LIJI-230297 Sep 2019 Apr 2020 209 days
OX OX-539872073 Sep 2019 Mar 2020 196 days
FWHL FWHL-897697 Sep 2019 Mar 2020 175 days
SVRN SVRN-230297 Sep 2019 Mar 2020 175 days
IEX IEX-186779 Nov 2019 Apr 2020 144 days
YUME YUME-102973855 Sep 2019 Jan 2020 130 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
relyonhorror.com relyonhorror.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
OX OX-540553856 Jul 2019 Mar 2020 231 days
PUBM PUBM-158039 Jul 2019 Mar 2020 231 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
spoilertv.com spoilertv.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
SCLP SCLP-6793 Jul 2019 Apr 2020 284 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 284 days
IEX IEX-186779 Jul 2019 Apr 2020 265 days
OX OX-540553856 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
PUBM PUBM-158039 Jul 2019 Jan 2020 186 days
RUB RUB-18110 Nov 2019 Mar 2020 110 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
thefilmstage.com thefilmstage.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 285 days
OX OX-540553856 Jul 2019 Apr 2020 285 days
FWHL FWHL-897697 Jul 2019 Apr 2020 285 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 285 days
SVRN SVRN-230297 Jul 2019 Apr 2020 281 days
PUBM PUBM-158039 Jul 2019 Apr 2020 281 days
YUME YUME-102973855 Jul 2019 Apr 2020 281 days
IEX IEX-186266 Aug 2019 Apr 2020 253 days
RUB RUB-18110 Aug 2019 Apr 2020 249 days
SCLP SCLP-390 Aug 2019 Apr 2020 249 days
IEX IEX-186779 Sep 2019 Apr 2020 225 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
OX OX-540099026 Feb 2020 Apr 2020 68 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
cheers.com.tw cheers.com.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jul 2020 72 days
OX OX-540553856 May 2020 Jul 2020 72 days
PUBM PUBM-158039 May 2020 Jul 2020 72 days
RUB RUB-18110 May 2020 Jul 2020 72 days
SVRN SVRN-230297 May 2020 Jul 2020 72 days
LIJI LIJI-230297 May 2020 Jul 2020 72 days
YIMO YIMO-2073946213921227802 May 2020 Jul 2020 72 days
IEX IEX-186266 May 2020 Jul 2020 61 days
LOOP LOOP-5918 May 2020 Jul 2020 61 days
SCLP SCLP-390 May 2020 Jul 2020 61 days
IEX IEX-186779 May 2020 Jul 2020 50 days
YUME YUME-102973855 May 2020 Jul 2020 39 days
OX OX-540099026 May 2020 May 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
LOOP LOOP-S-2411 Jul 2020 Jul 2020 One Off
eznewlife.com eznewlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 225 days
PUBM PUBM-158039 Aug 2019 Mar 2020 225 days
YUME YUME-102973855 Aug 2019 Mar 2020 225 days
SVRN SVRN-230297 Aug 2019 Mar 2020 225 days
LIJI LIJI-230297 Aug 2019 Mar 2020 225 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 225 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 190 days
IEX IEX-186266 Oct 2019 Mar 2020 166 days
OX OX-540553856 Oct 2019 Mar 2020 166 days
RUB RUB-18110 Oct 2019 Mar 2020 166 days
IEX IEX-186779 Aug 2019 Dec 2019 124 days
LOOP LOOP-5918 Dec 2019 Mar 2020 101 days
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
gefiusth.club gefiusth.club
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Mar 2020 225 days
FWHL FWHL-897697 Aug 2019 Mar 2020 225 days
YUME YUME-102973855 Aug 2019 Mar 2020 225 days
SVRN SVRN-230297 Aug 2019 Mar 2020 225 days
LIJI LIJI-230297 Aug 2019 Mar 2020 225 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 225 days
IEX IEX-186779 Aug 2019 Feb 2020 190 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 190 days
SCLP SCLP-390 Dec 2019 Feb 2020 66 days
OX OX-540553856 Aug 2019 Oct 2019 60 days
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
malaysiamemilih.com malaysiamemilih.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 270 days
PUBM PUBM-158039 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
IEX IEX-186266 Aug 2019 Mar 2020 219 days
LOOP LOOP-5918 Aug 2019 Mar 2020 219 days
RUB RUB-18110 Aug 2019 Mar 2020 219 days
IEX IEX-186779 Aug 2019 Feb 2020 186 days
SCLP SCLP-6793 Aug 2019 Feb 2020 186 days
OX OX-540553856 Aug 2019 Oct 2019 62 days
SCLP SCLP-390 Aug 2019 Oct 2019 60 days
LOOP LOOP-S-2411 Dec 2019 Feb 2020 59 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
palingseru.id palingseru.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Feb 2020 183 days
IEX IEX-186779 Aug 2019 Feb 2020 183 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 183 days
LIJI LIJI-230297 Aug 2019 Feb 2020 183 days
YIMO YIMO-2073946213921227802 Aug 2019 Feb 2020 183 days
PUBM PUBM-158039 Aug 2019 Jan 2020 128 days
RUB RUB-18110 Aug 2019 Jan 2020 128 days
SVRN SVRN-230297 Aug 2019 Jan 2020 128 days
IEX IEX-186266 Oct 2019 Jan 2020 65 days
SCLP SCLP-6793 Oct 2019 Jan 2020 65 days
YUME YUME-102973855 Aug 2019 Oct 2019 63 days
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
OX OX-539872073 Oct 2019 Oct 2019 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
rileklah.com rileklah.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 288 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 288 days
PUBM PUBM-158039 Aug 2019 Jun 2021 1 year, 288 days
YUME YUME-102973855 Aug 2019 Jun 2021 1 year, 288 days
YIMO YIMO-2073946213921227802 Aug 2019 Jun 2021 1 year, 288 days
RUB RUB-18110 Nov 2019 Jun 2021 1 year, 224 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 166 days
SCLP SCLP-6793 Aug 2019 Dec 2020 1 year, 114 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
OX OX-540553856 Jan 2020 Feb 2021 1 year, 37 days
SVRN SVRN-230297 Aug 2019 Feb 2020 182 days
LIJI LIJI-230297 Aug 2019 Feb 2020 182 days
LOOP LOOP-S-2411 Nov 2019 Jan 2020 65 days
IEX IEX-186779 Nov 2019 Nov 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
repairiphone.com.tw repairiphone.com.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 276 days
LIJI LIJI-230297 Jul 2019 Apr 2020 276 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 241 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 241 days
LOOP LOOP-5918 Aug 2019 Apr 2020 225 days
IEX IEX-186266 Aug 2019 Feb 2020 190 days
OX OX-539872073 Aug 2019 Feb 2020 190 days
FWHL FWHL-897697 Jul 2019 Jan 2020 188 days
SVRN SVRN-230297 Jul 2019 Jan 2020 188 days
IEX IEX-186779 Aug 2019 Jan 2020 129 days
SCLP SCLP-6426 Mar 2020 Apr 2020 5 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
rmol.id rmol.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2020 Sep 2020 195 days
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
FWHL FWHL-897697 Dec 2020 Jun 2021 174 days
IEX IEX-186779 Dec 2020 Jun 2021 174 days
LOOP LOOP-5918 Dec 2020 Jun 2021 174 days
PUBM PUBM-158039 Dec 2020 Jun 2021 174 days
YUME YUME-102973855 Dec 2020 Jun 2021 174 days
SVRN SVRN-230297 Dec 2020 Jun 2021 174 days
LIJI LIJI-230297 Dec 2020 Jun 2021 174 days
YIMO YIMO-2073946213921227802 Dec 2020 Jun 2021 174 days
SCLP SCLP-6426 Apr 2021 Jun 2021 60 days
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
SCLP SCLP-390 Dec 2020 Dec 2020 One Off
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
LOOP LOOP-S-2411 Apr 2021 Apr 2021 One Off
abpganga.com abpganga.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 8 days
LIJI LIJI-230297 Apr 2020 Apr 2020 8 days
LOOP LOOP-S-2411 Apr 2020 Apr 2020 8 days
OX OX-540553856 Apr 2020 Apr 2020 8 days
SCLP SCLP-390 Apr 2020 Apr 2020 8 days
SVRN SVRN-230297 Apr 2020 Apr 2020 8 days
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 8 days
FWHL FWHL-897697 Apr 2020 Apr 2020 8 days
IEX IEX-186266 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
theybf.com theybf.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Nov 2019 Apr 2020 144 days
OX OX-540553856 Nov 2019 Apr 2020 144 days
LIJI LIJI-230297 Nov 2019 Apr 2020 144 days
YUME YUME-102973855 Nov 2019 Apr 2020 144 days
RUB RUB-18110 Nov 2019 Apr 2020 144 days
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 144 days
LOOP LOOP-5918 Nov 2019 Apr 2020 144 days
IEX IEX-186779 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LOOP LOOP-S-2411 Jan 2020 Apr 2020 79 days
SCLP SCLP-390 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
upeks.co.id upeks.co.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Jun 2021 1 year, 101 days
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 101 days
PUBM PUBM-158039 Mar 2020 Jun 2021 1 year, 101 days
YUME YUME-102973855 Mar 2020 Jun 2021 1 year, 101 days
SVRN SVRN-230297 Mar 2020 Jun 2021 1 year, 101 days
LIJI LIJI-230297 Mar 2020 Jun 2021 1 year, 101 days
YIMO YIMO-2073946213921227802 Mar 2020 Jun 2021 1 year, 101 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
IEX IEX-186779 Apr 2020 Jun 2021 1 year, 66 days
OX OX-540553856 May 2020 Feb 2021 266 days
IEX IEX-186266 Mar 2020 May 2020 78 days
RUB RUB-18110 Mar 2020 May 2020 78 days
OX OX-540099026 Apr 2020 May 2020 43 days
SCLP SCLP-6793 Apr 2020 May 2020 43 days
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
vgr.com vgr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 212 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 212 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 147 days
RUB RUB-18110 Nov 2019 Apr 2020 147 days
OX OX-540553856 Jul 2019 Nov 2019 134 days
SCLP SCLP-6793 Nov 2019 Mar 2020 113 days
IEX IEX-186266 Jan 2020 Mar 2020 48 days
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
violentegg.club violentegg.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 24 days
SCLP SCLP-6426 Mar 2020 Apr 2020 10 days
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
wahcricket.com wahcricket.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Jan 2020 184 days
FWHL FWHL-897697 Jul 2019 Jan 2020 184 days
SVRN SVRN-230297 Jul 2019 Jan 2020 184 days
LIJI LIJI-230297 Jul 2019 Jan 2020 184 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 184 days
LOOP LOOP-5918 Aug 2019 Jan 2020 149 days
YUME YUME-102973855 Sep 2019 Nov 2019 65 days
SCLP SCLP-390 Aug 2019 Sep 2019 19 days
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
zombsroyaleunblocked.com zombsroyaleunblocked.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 210 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 210 days
SVRN SVRN-230297 Sep 2019 Apr 2020 210 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 210 days
OX OX-539872073 Sep 2019 Mar 2020 197 days
PUBM PUBM-158039 Nov 2019 Apr 2020 145 days
YUME YUME-102973855 Sep 2019 Jan 2020 130 days
OX OX-540553856 Jan 2020 Apr 2020 80 days
RUB RUB-18110 Jan 2020 Apr 2020 80 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
comicbookmovie.com comicbookmovie.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
PUBM PUBM-158039 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
SCLP SCLP-6793 Jul 2019 Jan 2020 205 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
esnacky.com esnacky.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Apr 2020 65 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 65 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Mar 2020 Apr 2020 30 days
IEX IEX-186779 Mar 2020 Apr 2020 30 days
OX OX-539872073 Mar 2020 Mar 2020 10 days
YUME YUME-102973855 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
gamerdvr.com gamerdvr.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
IEX IEX-186779 Feb 2020 Jun 2021 1 year, 119 days
OX OX-540099026 Mar 2020 Jun 2021 1 year, 85 days
FWHL FWHL-897697 Jul 2019 Mar 2020 262 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 262 days
PUBM PUBM-158039 Jul 2019 Feb 2020 228 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 164 days
YUME YUME-102973855 Oct 2019 Feb 2020 130 days
IEX IEX-186266 Aug 2019 Dec 2019 111 days
SCLP SCLP-390 Aug 2019 Dec 2019 111 days
SVRN SVRN-230297 Jul 2019 Oct 2019 98 days
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
kaohoon.com kaohoon.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 267 days
YUME YUME-102973855 Jul 2019 Mar 2020 267 days
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 267 days
IEX IEX-186266 Aug 2019 Mar 2020 216 days
LOOP LOOP-5918 Aug 2019 Mar 2020 216 days
RUB RUB-18110 Aug 2019 Mar 2020 216 days
OX OX-540553856 Aug 2019 Feb 2020 187 days
IEX IEX-186779 Oct 2019 Feb 2020 125 days
PUBM PUBM-158039 Jul 2019 Oct 2019 107 days
SCLP SCLP-6793 Dec 2019 Feb 2020 61 days
LOOP LOOP-S-2411 Dec 2019 Feb 2020 61 days
OX OX-540099026 Feb 2020 Mar 2020 31 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
kashoorga.com kashoorga.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Oct 2019 Mar 2020 160 days
FWHL FWHL-897697 Oct 2019 Mar 2020 160 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 160 days
YUME YUME-102973855 Oct 2019 Mar 2020 160 days
SVRN SVRN-230297 Oct 2019 Mar 2020 160 days
LIJI LIJI-230297 Oct 2019 Mar 2020 160 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 160 days
SCLP SCLP-6793 Oct 2019 Feb 2020 125 days
IEX IEX-186266 Oct 2019 Dec 2019 64 days
LOOP LOOP-5918 Dec 2019 Feb 2020 61 days
IEX IEX-186779 Feb 2020 Mar 2020 35 days
RUB RUB-18110 Oct 2019 Oct 2019 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
overwolf.com overwolf.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 274 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 184 days
SCLP SCLP-6793 Jul 2019 Dec 2019 183 days
SVRN SVRN-230297 Aug 2019 Dec 2019 128 days
PUBM PUBM-158039 Jul 2019 Oct 2019 114 days
IEX IEX-186779 Jul 2019 Aug 2019 55 days
YUME YUME-102973855 Jul 2019 Aug 2019 51 days
OX OX-539872073 Feb 2020 Mar 2020 32 days
SCLP SCLP-6426 Mar 2020 Mar 2020 3 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
prachatai.com prachatai.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 269 days
PUBM PUBM-158039 Jul 2019 Apr 2020 269 days
YUME YUME-102973855 Jul 2019 Apr 2020 269 days
SVRN SVRN-230297 Jul 2019 Apr 2020 269 days
LIJI LIJI-230297 Jul 2019 Apr 2020 269 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 269 days
IEX IEX-186266 Aug 2019 Feb 2020 189 days
LOOP LOOP-5918 Aug 2019 Feb 2020 189 days
SCLP SCLP-390 Aug 2019 Feb 2020 183 days
IEX IEX-186779 Oct 2019 Apr 2020 155 days
LOOP LOOP-S-2411 Oct 2019 Apr 2020 155 days
RUB RUB-18110 Jan 2020 Apr 2020 89 days
OX OX-540553856 Jan 2020 Apr 2020 89 days
SCLP SCLP-6793 Jan 2020 Apr 2020 89 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
qucaiguoji333.com qucaiguoji333.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jan 2020 129 days
IEX IEX-186266 Aug 2019 Jan 2020 129 days
LOOP LOOP-S-2411 Aug 2019 Jan 2020 129 days
PUBM PUBM-158039 Aug 2019 Jan 2020 129 days
SVRN SVRN-230297 Aug 2019 Jan 2020 129 days
LIJI LIJI-230297 Aug 2019 Jan 2020 129 days
YIMO YIMO-2073946213921227802 Aug 2019 Jan 2020 129 days
OX OX-540553856 Oct 2019 Jan 2020 66 days
YUME YUME-102973855 Aug 2019 Oct 2019 63 days
SCLP SCLP-6793 Aug 2019 Oct 2019 63 days
OX OX-539872073 Aug 2019 Aug 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
rasa.my rasa.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 276 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 276 days
SVRN SVRN-230297 Jul 2019 Apr 2020 276 days
LIJI LIJI-230297 Jul 2019 Apr 2020 276 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 276 days
SCLP SCLP-6793 Jul 2019 Apr 2020 269 days
PUBM PUBM-158039 Jul 2019 Feb 2020 241 days
IEX IEX-186779 Jul 2019 Feb 2020 234 days
YUME YUME-102973855 Jul 2019 Feb 2020 234 days
IEX IEX-186266 Aug 2019 Apr 2020 225 days
RUB RUB-18110 Aug 2019 Feb 2020 190 days
LOOP LOOP-5918 Aug 2019 Feb 2020 190 days
OX OX-540553856 Aug 2019 Feb 2020 183 days
SCLP SCLP-390 Aug 2019 Oct 2019 64 days
OX OX-539872073 Jan 2020 Jan 2020 One Off
aimgallery.com aimgallery.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Nov 2019 Apr 2020 142 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 142 days
SCLP SCLP-6793 Nov 2019 Apr 2020 142 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 142 days
YUME YUME-102973855 Nov 2019 Apr 2020 142 days
PUBM PUBM-158039 Nov 2019 Apr 2020 142 days
SVRN SVRN-230297 Nov 2019 Apr 2020 142 days
IEX IEX-186266 Jan 2020 Apr 2020 77 days
RUB RUB-18110 Jan 2020 Apr 2020 77 days
SCLP SCLP-6426 Mar 2020 Apr 2020 16 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
sinarharian.com.my sinarharian.com.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 278 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 278 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 278 days
YUME YUME-102973855 Jul 2019 Apr 2020 268 days
PUBM PUBM-158039 Jul 2019 Feb 2020 243 days
LIJI LIJI-230297 Jul 2019 Jan 2020 191 days
LOOP LOOP-5918 Sep 2019 Feb 2020 181 days
IEX IEX-186779 Jul 2019 Nov 2019 126 days
OX OX-539872073 Aug 2019 Nov 2019 75 days
SCLP SCLP-6793 Nov 2019 Jan 2020 65 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SVRN SVRN-230297 Jul 2019 Jul 2019 10 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
amarintv.com amarintv.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 229 days
YUME YUME-102973855 Jul 2019 Mar 2020 229 days
FWHL FWHL-897697 Jul 2019 Mar 2020 229 days
SVRN SVRN-230297 Jul 2019 Mar 2020 229 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 229 days
LOOP LOOP-5918 Aug 2019 Mar 2020 202 days
RUB RUB-18110 Aug 2019 Jan 2020 160 days
SCLP SCLP-6793 Nov 2019 Mar 2020 108 days
SCLP SCLP-390 Aug 2019 Sep 2019 29 days
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
technology-portfolio.net technology-portfolio.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Nov 2019 65 days
IEX IEX-186779 Sep 2019 Nov 2019 65 days
OX OX-539872073 Sep 2019 Nov 2019 65 days
OX OX-540553856 Sep 2019 Nov 2019 65 days
RUB RUB-18110 Sep 2019 Nov 2019 65 days
SVRN SVRN-230297 Sep 2019 Nov 2019 65 days
LIJI LIJI-230297 Sep 2019 Nov 2019 65 days
FWHL FWHL-897697 Sep 2019 Nov 2019 65 days
PUBM PUBM-158039 Sep 2019 Nov 2019 65 days
YUME YUME-102973855 Sep 2019 Nov 2019 65 days
LOOP LOOP-S-2411 Sep 2019 Nov 2019 65 days
YIMO YIMO-2073946213921227802 Sep 2019 Nov 2019 65 days
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
thehealthsite.com thehealthsite.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Mar 2020 45 days
IEX IEX-186779 Jan 2020 Mar 2020 45 days
OX OX-540553856 Jan 2020 Mar 2020 45 days
OX OX-539872073 Jan 2020 Mar 2020 45 days
PUBM PUBM-158039 Jan 2020 Mar 2020 45 days
SVRN SVRN-230297 Jan 2020 Mar 2020 45 days
YUME YUME-102973855 Jan 2020 Mar 2020 45 days
YIMO YIMO-2073946213921227802 Jan 2020 Mar 2020 45 days
SCLP SCLP-390 Jan 2020 Mar 2020 45 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
travelerliv.com travelerliv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jan 2020 197 days
PUBM PUBM-158039 Jul 2019 Jan 2020 197 days
SVRN SVRN-230297 Jul 2019 Jan 2020 197 days
LIJI LIJI-230297 Jul 2019 Jan 2020 197 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 197 days
SCLP SCLP-390 Aug 2019 Mar 2020 195 days
OX OX-540553856 Nov 2019 Mar 2020 115 days
LOOP LOOP-5918 Aug 2019 Nov 2019 80 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
twinfinite.net twinfinite.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 285 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 285 days
PUBM PUBM-158039 Jul 2019 Mar 2020 250 days
LOOP LOOP-5918 Aug 2019 Apr 2020 234 days
OX OX-540553856 Sep 2019 Apr 2020 210 days
SCLP SCLP-6793 Jul 2019 Jan 2020 206 days
SVRN SVRN-230297 Jul 2019 Jan 2020 206 days
LIJI LIJI-230297 Jul 2019 Jan 2020 206 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Jan 2020 Apr 2020 79 days
SCLP SCLP-6426 Mar 2020 Apr 2020 14 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
waynedupree.com waynedupree.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 266 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 266 days
SCLP SCLP-6793 Jul 2019 Mar 2020 232 days
IEX IEX-186779 Jul 2019 Mar 2020 232 days
LOOP LOOP-5918 Aug 2019 Mar 2020 197 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 146 days
OX OX-540553856 Jul 2019 Nov 2019 120 days
SVRN SVRN-230297 Jul 2019 Nov 2019 120 days
IEX IEX-186266 Nov 2019 Mar 2020 112 days
OX OX-540099026 Feb 2020 Mar 2020 12 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
woop.id woop.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 22 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 22 days
OX OX-540099026 May 2020 Jun 2021 1 year, 22 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 22 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 22 days
RUB RUB-18110 May 2020 Jun 2021 1 year, 22 days
SCLP SCLP-6426 May 2020 Jun 2021 1 year, 22 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 22 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 22 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 22 days
IEX IEX-186266 May 2020 Feb 2021 265 days
SCLP SCLP-6793 May 2020 Dec 2020 213 days
IEX IEX-186779 Feb 2021 Jun 2021 122 days
SCLP SCLP-390 Feb 2021 Apr 2021 62 days
zineblog.com.tw zineblog.com.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jan 2020 Apr 2020 80 days
YUME YUME-102973855 Jan 2020 Apr 2020 80 days
SVRN SVRN-230297 Jan 2020 Apr 2020 80 days
LIJI LIJI-230297 Jan 2020 Apr 2020 80 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 80 days
SCLP SCLP-390 Jan 2020 Mar 2020 46 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
dek-d.com dek-d.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Mar 2020 250 days
OX OX-540553856 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
PUBM PUBM-158039 Jul 2019 Jan 2020 205 days
LOOP LOOP-5918 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Aug 2019 Jan 2020 154 days
SCLP SCLP-390 Aug 2019 Nov 2019 89 days
YUME YUME-102973855 Jan 2020 Mar 2020 45 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
doktercantik.com doktercantik.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 167 days
LOOP LOOP-5918 Oct 2019 Mar 2020 167 days
PUBM PUBM-158039 Oct 2019 Mar 2020 167 days
YUME YUME-102973855 Oct 2019 Mar 2020 167 days
LIJI LIJI-230297 Oct 2019 Mar 2020 167 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 167 days
IEX IEX-186779 Oct 2019 Feb 2020 130 days
SCLP SCLP-390 Oct 2019 Feb 2020 130 days
IEX IEX-186266 Dec 2019 Mar 2020 103 days
RUB RUB-18110 Dec 2019 Mar 2020 103 days
SCLP SCLP-6793 Dec 2019 Mar 2020 103 days
SVRN SVRN-230297 Feb 2020 Mar 2020 37 days
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
eca.party eca.party
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 226 days
PUBM PUBM-158039 Aug 2019 Mar 2020 226 days
YUME YUME-102973855 Aug 2019 Mar 2020 226 days
SVRN SVRN-230297 Aug 2019 Mar 2020 226 days
LIJI LIJI-230297 Aug 2019 Mar 2020 226 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 226 days
SCLP SCLP-390 Aug 2019 Mar 2020 209 days
LOOP LOOP-5918 Oct 2019 Mar 2020 167 days
OX OX-540553856 Oct 2019 Mar 2020 167 days
IEX IEX-186266 Aug 2019 Oct 2019 42 days
RUB RUB-18110 Aug 2019 Oct 2019 42 days
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
edtguide.com edtguide.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 226 days
LOOP LOOP-S-2411 Aug 2019 Mar 2020 226 days
PUBM PUBM-158039 Aug 2019 Mar 2020 226 days
YUME YUME-102973855 Aug 2019 Mar 2020 226 days
SVRN SVRN-230297 Aug 2019 Mar 2020 226 days
LIJI LIJI-230297 Aug 2019 Mar 2020 226 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 226 days
RUB RUB-18110 Aug 2019 Mar 2020 209 days
IEX IEX-186266 Aug 2019 Feb 2020 173 days
IEX IEX-186779 Oct 2019 Mar 2020 167 days
SCLP SCLP-390 Oct 2019 Feb 2020 131 days
OX OX-540553856 Dec 2019 Mar 2020 103 days
SCLP SCLP-6793 Dec 2019 Mar 2020 103 days
LOOP LOOP-5918 Oct 2019 Dec 2019 64 days
enanyang.my enanyang.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 102 days
LOOP LOOP-S-2411 Dec 2019 Mar 2020 102 days
PUBM PUBM-158039 Dec 2019 Mar 2020 102 days
YUME YUME-102973855 Dec 2019 Mar 2020 102 days
SCLP SCLP-6793 Dec 2019 Mar 2020 102 days
SVRN SVRN-230297 Dec 2019 Mar 2020 102 days
LIJI LIJI-230297 Dec 2019 Mar 2020 102 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 102 days
IEX IEX-186779 Dec 2019 Feb 2020 67 days
RUB RUB-18110 Dec 2019 Feb 2020 67 days
OX OX-540099026 Feb 2020 Mar 2020 24 days
OX OX-539872073 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
englishforeveryone.org englishforeveryone.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Nov 2019 Apr 2020 144 days
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 144 days
SCLP SCLP-6793 Nov 2019 Mar 2020 110 days
OX OX-540553856 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
LOOP LOOP-5918 Nov 2019 Nov 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
gmanetwork.com gmanetwork.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jan 2020 186 days
OX OX-540553856 Jul 2019 Jan 2020 186 days
YUME YUME-102973855 Jul 2019 Jan 2020 186 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 186 days
SVRN SVRN-230297 Jul 2019 Jan 2020 186 days
LIJI LIJI-230297 Jul 2019 Jan 2020 186 days
PUBM PUBM-158039 Jul 2019 Jan 2020 186 days
FWHL FWHL-897697 Jul 2019 Jan 2020 186 days
IEX IEX-186266 Aug 2019 Jan 2020 154 days
RUB RUB-18110 Aug 2019 Jan 2020 154 days
LOOP LOOP-5918 Aug 2019 Jan 2020 154 days
SCLP SCLP-6793 Sep 2019 Jan 2020 130 days
OX OX-539872073 Aug 2019 Sep 2019 24 days
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
haibunda.com haibunda.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 100 days
LIJI LIJI-230297 Dec 2019 Mar 2020 100 days
YUME YUME-102973855 Dec 2019 Mar 2020 100 days
SVRN SVRN-230297 Dec 2019 Mar 2020 100 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 100 days
LOOP LOOP-S-2411 Dec 2019 Feb 2020 65 days
IEX IEX-186266 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
IEX IEX-186779 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
hiptoro.com hiptoro.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 264 days
PUBM PUBM-158039 Jul 2019 Mar 2020 264 days
SVRN SVRN-230297 Jul 2019 Mar 2020 264 days
LIJI LIJI-230297 Jul 2019 Mar 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 264 days
LOOP LOOP-5918 Aug 2019 Mar 2020 213 days
RUB RUB-18110 Oct 2019 Mar 2020 163 days
SCLP SCLP-6793 Dec 2019 Mar 2020 99 days
IEX IEX-186266 Feb 2020 Mar 2020 34 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Feb 2020 Feb 2020 One Off
lagged.com.br lagged.com.br
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Mar 2020 96 days
RUB RUB-18110 Dec 2019 Mar 2020 96 days
IEX IEX-186779 Dec 2019 Mar 2020 96 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 96 days
FWHL FWHL-897697 Dec 2019 Mar 2020 96 days
SCLP SCLP-390 Dec 2019 Feb 2020 61 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
IEX IEX-186266 Feb 2020 Mar 2020 35 days
YUME YUME-102973855 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 33 days
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
momspresso.com momspresso.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Aug 2019 Mar 2020 220 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186779 Aug 2019 Mar 2020 220 days
LOOP LOOP-5918 Aug 2019 Mar 2020 220 days
LIJI LIJI-230297 Aug 2019 Mar 2020 220 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 220 days
PUBM PUBM-158039 Dec 2019 Mar 2020 93 days
OX OX-540099026 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
newtalk.tw newtalk.tw
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Oct 2019 Mar 2020 157 days
PUBM PUBM-158039 Oct 2019 Mar 2020 157 days
SVRN SVRN-230297 Oct 2019 Mar 2020 157 days
LIJI LIJI-230297 Oct 2019 Mar 2020 157 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 157 days
SCLP SCLP-390 Oct 2019 Feb 2020 122 days
FWHL FWHL-897697 Oct 2019 Feb 2020 122 days
IEX IEX-186779 Oct 2019 Dec 2019 65 days
YUME YUME-102973855 Oct 2019 Dec 2019 65 days
RUB RUB-18110 Oct 2019 Dec 2019 65 days
OX OX-539872073 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
oyunlar1.net oyunlar1.net
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 274 days
FWHL FWHL-897697 Jul 2019 Feb 2020 239 days
SVRN SVRN-230297 Jul 2019 Feb 2020 239 days
LIJI LIJI-230297 Jul 2019 Feb 2020 239 days
OX OX-540553856 Jul 2019 Feb 2020 235 days
LOOP LOOP-S-2411 Aug 2019 Mar 2020 219 days
SCLP SCLP-390 Aug 2019 Feb 2020 188 days
IEX IEX-186266 Aug 2019 Feb 2020 188 days
OX OX-539872073 Aug 2019 Feb 2020 184 days
RUB RUB-18110 Aug 2019 Feb 2020 184 days
SCLP SCLP-6793 Aug 2019 Feb 2020 184 days
IEX IEX-186779 Dec 2019 Feb 2020 56 days
OX OX-540099026 Feb 2020 Feb 2020 3 days
SCLP SCLP-6426 Mar 2020 Mar 2020 3 days
postjung.com postjung.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Sep 2019 55 days
IEX IEX-186779 Jul 2019 Sep 2019 55 days
PUBM PUBM-158039 Jul 2019 Sep 2019 55 days
YUME YUME-102973855 Jul 2019 Sep 2019 55 days
SVRN SVRN-230297 Jul 2019 Sep 2019 55 days
LIJI LIJI-230297 Jul 2019 Sep 2019 55 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 55 days
LOOP LOOP-5918 Aug 2019 Sep 2019 24 days
SCLP SCLP-390 Aug 2019 Sep 2019 24 days
OX OX-539872073 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
psu.com psu.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 231 days
PUBM PUBM-158039 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
LIJI LIJI-230297 Jul 2019 Jan 2020 205 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
YUME YUME-102973855 Sep 2019 Mar 2020 175 days
SCLP SCLP-390 Nov 2019 Mar 2020 110 days
SCLP SCLP-6793 Jul 2019 Sep 2019 75 days
animemojo.com animemojo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 288 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 288 days
PUBM PUBM-158039 Jul 2019 Apr 2020 288 days
YUME YUME-102973855 Jul 2019 Apr 2020 264 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 253 days
LOOP LOOP-5918 Aug 2019 Apr 2020 237 days
RUB RUB-18110 Aug 2019 Apr 2020 237 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
LIJI LIJI-230297 Jul 2019 Jan 2020 211 days
SVRN SVRN-230297 Jul 2019 Jul 2019 24 days
SCLP SCLP-6426 Mar 2020 Apr 2020 17 days
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
sooperboy.com sooperboy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 278 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 278 days
SCLP SCLP-6793 Jul 2019 Apr 2020 278 days
LIJI LIJI-230297 Jul 2019 Apr 2020 278 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 278 days
SVRN SVRN-230297 Jul 2019 Mar 2020 244 days
LOOP LOOP-5918 Aug 2019 Mar 2020 193 days
OX OX-539872073 Aug 2019 Jan 2020 141 days
IEX IEX-186779 Sep 2019 Jan 2020 129 days
SCLP SCLP-390 Sep 2019 Jan 2020 129 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
techno.id techno.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 150 days
LOOP LOOP-5918 Nov 2019 Apr 2020 150 days
SCLP SCLP-390 Nov 2019 Apr 2020 150 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 150 days
IEX IEX-186266 Nov 2019 Mar 2020 116 days
SVRN SVRN-230297 Jan 2020 Apr 2020 84 days
YUME YUME-102973855 Nov 2019 Jan 2020 66 days
LOOP LOOP-S-2411 Jan 2020 Mar 2020 50 days
OX OX-540099026 Feb 2020 Apr 2020 43 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
thcosmo.space thcosmo.space
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Sep 2019 Apr 2020 214 days
FWHL FWHL-897697 Sep 2019 Apr 2020 214 days
IEX IEX-186266 Sep 2019 Apr 2020 214 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 214 days
SVRN SVRN-230297 Sep 2019 Apr 2020 214 days
LIJI LIJI-230297 Sep 2019 Apr 2020 214 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 214 days
YUME YUME-102973855 Sep 2019 Mar 2020 179 days
SCLP SCLP-6426 Mar 2020 Apr 2020 9 days
OX OX-540099026 Feb 2020 Mar 2020 9 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
baeblemusic.com baeblemusic.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Nov 2020 1 year, 134 days
LIJI LIJI-230297 Jul 2019 Nov 2020 1 year, 134 days
FWHL FWHL-897697 Jul 2019 Nov 2020 1 year, 134 days
YIMO YIMO-2073946213921227802 Jul 2019 Nov 2020 1 year, 134 days
IEX IEX-186779 Jul 2019 Sep 2020 1 year, 88 days
IEX IEX-186266 Aug 2019 Nov 2020 1 year, 83 days
SCLP SCLP-6426 Mar 2020 Nov 2020 228 days
LOOP LOOP-5918 May 2020 Nov 2020 194 days
PUBM PUBM-158039 May 2020 Nov 2020 194 days
YUME YUME-102973855 May 2020 Sep 2020 148 days
SCLP SCLP-6793 May 2020 Sep 2020 148 days
OX OX-540553856 May 2020 Jul 2020 78 days
RUB RUB-18110 Sep 2020 Nov 2020 46 days
LOOP LOOP-S-2411 Jul 2020 Jul 2020 One Off
tiin.com.vn tiin.com.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 150 days
IEX IEX-186779 Nov 2019 Apr 2020 150 days
YUME YUME-102973855 Nov 2019 Apr 2020 150 days
SVRN SVRN-230297 Nov 2019 Apr 2020 150 days
LIJI LIJI-230297 Nov 2019 Apr 2020 150 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 150 days
SCLP SCLP-6793 Nov 2019 Mar 2020 115 days
LOOP LOOP-S-2411 Jan 2020 Apr 2020 84 days
SCLP SCLP-6426 Mar 2020 Apr 2020 9 days
RUB RUB-18110 Nov 2019 Nov 2019 One Off
LOOP LOOP-5918 Nov 2019 Nov 2019 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
bolgegundem.com bolgegundem.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 229 days
YUME YUME-102973855 Jul 2019 Mar 2020 229 days
SVRN SVRN-230297 Jul 2019 Mar 2020 229 days
LIJI LIJI-230297 Jul 2019 Mar 2020 229 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 229 days
SCLP SCLP-390 Aug 2019 Feb 2020 165 days
IEX IEX-186779 Jul 2019 Nov 2019 123 days
LOOP LOOP-5918 Nov 2019 Mar 2020 106 days
OX OX-540099026 Feb 2020 Mar 2020 20 days
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
femaledaily.com femaledaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 34 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 34 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 34 days
SCLP SCLP-6426 May 2020 Jun 2021 1 year, 34 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 34 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 34 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 34 days
PUBM PUBM-158039 Jun 2020 Jun 2021 1 year, 9 days
OX OX-540099026 Jul 2020 Jun 2021 329 days
LOOP LOOP-S-2411 Jun 2020 Apr 2021 314 days
OX OX-540553856 May 2020 Feb 2021 277 days
IEX IEX-186779 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Jul 2020 Dec 2020 164 days
RUB RUB-18110 Feb 2021 Jun 2021 122 days
fishki.net fishki.net
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 262 days
FWHL FWHL-897697 Jul 2019 Mar 2020 262 days
YUME YUME-102973855 Jul 2019 Mar 2020 262 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 262 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 227 days
SCLP SCLP-6793 Jul 2019 Feb 2020 227 days
OX OX-539872073 Aug 2019 Mar 2020 211 days
IEX IEX-186266 Aug 2019 Feb 2020 176 days
IEX IEX-186779 Oct 2019 Mar 2020 166 days
SCLP SCLP-390 Oct 2019 Mar 2020 166 days
LOOP LOOP-5918 Dec 2019 Mar 2020 101 days
RUB RUB-18110 Aug 2019 Oct 2019 45 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
fwurbansugar.com fwurbansugar.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Feb 2020 190 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 190 days
SVRN SVRN-230297 Aug 2019 Feb 2020 190 days
LIJI LIJI-230297 Aug 2019 Feb 2020 190 days
YIMO YIMO-2073946213921227802 Aug 2019 Feb 2020 190 days
IEX IEX-186266 Oct 2019 Feb 2020 131 days
RUB RUB-18110 Oct 2019 Feb 2020 131 days
IEX IEX-186779 Aug 2019 Dec 2019 124 days
PUBM PUBM-158039 Aug 2019 Dec 2019 124 days
YUME YUME-102973855 Aug 2019 Dec 2019 124 days
SCLP SCLP-6793 Aug 2019 Oct 2019 59 days
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
game8.com.vn game8.com.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 May 2020 86 days
RUB RUB-18110 May 2020 May 2020 One Off
CA CA-PUB-1738284215641521 May 2020 May 2020 One Off
OX OX-540099026 May 2020 May 2020 One Off
OX OX-540553856 May 2020 May 2020 One Off
IEX IEX-186266 May 2020 May 2020 One Off
IEX IEX-186779 May 2020 May 2020 One Off
SCLP SCLP-6793 May 2020 May 2020 One Off
SVRN SVRN-230297 May 2020 May 2020 One Off
LIJI LIJI-230297 May 2020 May 2020 One Off
YIMO YIMO-2073946213921227802 May 2020 May 2020 One Off
FWHL FWHL-897697 May 2020 May 2020 One Off
LOOP LOOP-5918 May 2020 May 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
gridoto.com gridoto.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Mar 2020 224 days
IEX IEX-186779 Aug 2019 Feb 2020 190 days
LIJI LIJI-230297 Aug 2019 Feb 2020 190 days
YIMO YIMO-2073946213921227802 Aug 2019 Feb 2020 190 days
FWHL FWHL-897697 Oct 2019 Mar 2020 164 days
OX OX-540553856 Oct 2019 Feb 2020 130 days
YUME YUME-102973855 Oct 2019 Feb 2020 130 days
SCLP SCLP-390 Oct 2019 Feb 2020 130 days
SCLP SCLP-6793 Aug 2019 Dec 2019 125 days
OX OX-540099026 Feb 2020 Mar 2020 27 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
hoc247.net hoc247.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2020 348 days
FWHL FWHL-897697 Aug 2019 Mar 2020 223 days
YUME YUME-102973855 Aug 2019 Mar 2020 223 days
SVRN SVRN-230297 Aug 2019 Mar 2020 223 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 223 days
LIJI LIJI-230297 Aug 2019 Feb 2020 189 days
SCLP SCLP-6793 Oct 2019 Mar 2020 162 days
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 150 days
LOOP LOOP-S-2411 Aug 2019 Dec 2019 125 days
LOOP LOOP-5918 Feb 2020 Mar 2020 34 days
OX OX-540553856 Feb 2020 Mar 2020 34 days
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
inafeed.com inafeed.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 32 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 32 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 32 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 32 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 32 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 32 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 32 days
IEX IEX-186779 Jun 2020 Jun 2021 1 year, 4 days
RUB RUB-18110 Jun 2020 Jun 2021 1 year, 4 days
LOOP LOOP-S-2411 Jun 2020 Apr 2021 309 days
SCLP SCLP-390 Jun 2020 Apr 2021 309 days
IEX IEX-186266 May 2020 Feb 2021 275 days
OX OX-540553856 Jun 2020 Feb 2021 247 days
SCLP SCLP-6793 May 2020 Dec 2020 223 days
kkplay3c.net kkplay3c.net
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Jul 2019 Jun 2021 1 year, 347 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 347 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
LOOP LOOP-S-2411 Jul 2019 Apr 2021 1 year, 287 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
OX OX-540553856 Jul 2019 Mar 2020 268 days
FWHL FWHL-897697 Jul 2019 Mar 2020 268 days
IEX IEX-186266 Aug 2019 Mar 2020 217 days
SCLP SCLP-390 Aug 2019 Mar 2020 217 days
LOOP LOOP-5918 Aug 2019 Mar 2020 217 days
SCLP SCLP-6793 Aug 2019 Dec 2019 126 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
konsultank3.com konsultank3.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 268 days
IEX IEX-186779 Jul 2019 Mar 2020 268 days
PUBM PUBM-158039 Jul 2019 Mar 2020 268 days
YUME YUME-102973855 Jul 2019 Mar 2020 268 days
SCLP SCLP-6793 Jul 2019 Mar 2020 268 days
SVRN SVRN-230297 Jul 2019 Mar 2020 268 days
LIJI LIJI-230297 Jul 2019 Mar 2020 268 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 268 days
OX OX-540553856 Aug 2019 Mar 2020 222 days
LOOP LOOP-5918 Aug 2019 Mar 2020 217 days
RUB RUB-18110 Aug 2019 Mar 2020 217 days
OX OX-539872073 Oct 2019 Feb 2020 125 days
LOOP LOOP-S-2411 Dec 2019 Feb 2020 61 days
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
luv2beauty.com luv2beauty.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 298 days
SCLP SCLP-6793 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
OX OX-540553856 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Feb 2020 235 days
LOOP LOOP-S-2411 Aug 2019 Mar 2020 221 days
LOOP LOOP-5918 Aug 2019 Mar 2020 219 days
SCLP SCLP-390 Aug 2019 Mar 2020 219 days
SVRN SVRN-230297 Jul 2019 Dec 2019 176 days
OX OX-539872073 Oct 2019 Mar 2020 159 days
FWHL FWHL-897697 Jul 2019 Aug 2019 49 days
IEX IEX-186266 Feb 2020 Mar 2020 35 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
lyes.tw lyes.tw
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 235 days
SCLP SCLP-390 Aug 2019 Mar 2020 219 days
LOOP LOOP-5918 Aug 2019 Feb 2020 184 days
PUBM PUBM-158039 Jul 2019 Dec 2019 176 days
FWHL FWHL-897697 Jul 2019 Dec 2019 176 days
YUME YUME-102973855 Jul 2019 Dec 2019 176 days
OX OX-540553856 Jul 2019 Oct 2019 111 days
IEX IEX-186779 Jul 2019 Oct 2019 111 days
RUB RUB-18110 Aug 2019 Oct 2019 60 days
IEX IEX-186266 Aug 2019 Oct 2019 60 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
nancybolg.com nancybolg.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Aug 2019 Mar 2020 221 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
FWHL FWHL-897697 Jul 2019 Dec 2019 180 days
SVRN SVRN-230297 Jul 2019 Dec 2019 180 days
LIJI LIJI-230297 Jul 2019 Dec 2019 180 days
YIMO YIMO-2073946213921227802 Jul 2019 Dec 2019 180 days
LOOP LOOP-S-2411 Jul 2019 Oct 2019 115 days
RUB RUB-18110 Aug 2019 Oct 2019 64 days
IEX IEX-186266 Aug 2019 Oct 2019 64 days
OX OX-540553856 Jul 2019 Aug 2019 51 days
SCLP SCLP-390 Aug 2019 Aug 2019 1 day
OX OX-540099026 Feb 2020 Feb 2020 1 day
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
saostar.vn saostar.vn
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Apr 2020 277 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 277 days
OX OX-540553856 Jul 2019 Feb 2020 233 days
YUME YUME-102973855 Jul 2019 Feb 2020 233 days
LOOP LOOP-5918 Aug 2019 Apr 2020 226 days
SCLP SCLP-390 Aug 2019 Feb 2020 181 days
LOOP LOOP-S-2411 Aug 2019 Jan 2020 129 days
FWHL FWHL-897697 Jul 2019 Nov 2019 124 days
SVRN SVRN-230297 Jul 2019 Nov 2019 124 days
PUBM PUBM-158039 Jul 2019 Aug 2019 61 days
LIJI LIJI-230297 Jul 2019 Aug 2019 61 days
IEX IEX-186779 Jul 2019 Jul 2019 9 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Aug 2019 Aug 2019 One Off
wingzero.tw srw.wingzero.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jun 2021 1 year, 336 days
IEX IEX-186779 Jul 2019 Jun 2021 1 year, 336 days
PUBM PUBM-158039 Jul 2019 Jun 2021 1 year, 336 days
YUME YUME-102973855 Jul 2019 Jun 2021 1 year, 336 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 336 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 336 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 336 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 296 days
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
OX OX-540553856 Jul 2019 Feb 2021 1 year, 214 days
RUB RUB-18110 Mar 2020 Jun 2021 1 year, 103 days
IEX IEX-186266 Nov 2019 Feb 2021 1 year, 98 days
SCLP SCLP-6793 Nov 2019 Dec 2020 1 year, 46 days
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 43 days
tafsir-mimpi.com tafsir-mimpi.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 267 days
LIJI LIJI-230297 Jul 2019 Apr 2020 267 days
FWHL FWHL-897697 Jul 2019 Apr 2020 267 days
YUME YUME-102973855 Jul 2019 Apr 2020 267 days
SCLP SCLP-6793 Jul 2019 Apr 2020 267 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 267 days
PUBM PUBM-158039 Jul 2019 Mar 2020 233 days
RUB RUB-18110 Sep 2019 Apr 2020 214 days
IEX IEX-186779 Sep 2019 Apr 2020 214 days
IEX IEX-186266 Aug 2019 Mar 2020 194 days
LOOP LOOP-5918 Aug 2019 Mar 2020 194 days
OX OX-540553856 Nov 2019 Jan 2020 66 days
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
thethaovanhoa.vn thethaovanhoa.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Mar 2020 175 days
YIMO YIMO-2073946213921227802 Sep 2019 Mar 2020 175 days
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 136 days
SCLP SCLP-6793 Nov 2019 Mar 2020 110 days
PUBM PUBM-158039 Nov 2019 Jan 2020 66 days
SVRN SVRN-230297 Nov 2019 Jan 2020 66 days
LIJI LIJI-230297 Sep 2019 Nov 2019 65 days
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
vishvasnews.com vishvasnews.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Jan 2020 Apr 2020 82 days
FWHL FWHL-897697 Jan 2020 Apr 2020 82 days
LIJI LIJI-230297 Jan 2020 Apr 2020 82 days
IEX IEX-186779 Jan 2020 Apr 2020 82 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 82 days
OX OX-540099026 Feb 2020 Apr 2020 45 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
vortexpvp.com vortexpvp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 212 days
LOOP LOOP-5918 Sep 2019 Apr 2020 212 days
OX OX-540553856 Sep 2019 Apr 2020 212 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 212 days
SVRN SVRN-230297 Sep 2019 Mar 2020 177 days
LIJI LIJI-230297 Sep 2019 Mar 2020 177 days
IEX IEX-186266 Nov 2019 Apr 2020 147 days
YUME YUME-102973855 Sep 2019 Nov 2019 65 days
RUB RUB-18110 Nov 2019 Jan 2020 65 days
SCLP SCLP-390 Nov 2019 Jan 2020 65 days
SCLP SCLP-6426 Mar 2020 Apr 2020 11 days
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
bola.net bola.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Apr 2020 205 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 205 days
SCLP SCLP-6793 Sep 2019 Apr 2020 205 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 205 days
SVRN SVRN-230297 Sep 2019 Mar 2020 171 days
FWHL FWHL-897697 Nov 2019 Apr 2020 140 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 19 days
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
watchlakorn.in watchlakorn.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 282 days
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 282 days
YUME YUME-102973855 Jul 2019 Apr 2020 266 days
SCLP SCLP-6793 Jul 2019 Apr 2020 266 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 248 days
PUBM PUBM-158039 Jul 2019 Mar 2020 248 days
IEX IEX-186266 Aug 2019 Nov 2019 85 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
yolk.tech yolk.tech
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 22 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
mb.com.ph mb.com.ph
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 145 days
PUBM PUBM-158039 Nov 2019 Apr 2020 145 days
YUME YUME-102973855 Nov 2019 Apr 2020 145 days
SVRN SVRN-230297 Nov 2019 Apr 2020 145 days
LIJI LIJI-230297 Nov 2019 Apr 2020 145 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 145 days
LOOP LOOP-S-2411 Nov 2019 Mar 2020 110 days
IEX IEX-186779 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 49 days
SCLP SCLP-390 Mar 2020 Apr 2020 35 days
IEX IEX-186266 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
cricketcountry.com cricketcountry.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 38 days
FWHL FWHL-897697 Feb 2020 Mar 2020 38 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 38 days
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
dnaindia.com dnaindia.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
PUBM PUBM-158039 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
OX OX-539872073 Jan 2020 Mar 2020 45 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
doupdeco.com doupdeco.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Mar 2020 36 days
PUBM PUBM-158039 Feb 2020 Mar 2020 36 days
YUME YUME-102973855 Feb 2020 Mar 2020 36 days
SVRN SVRN-230297 Feb 2020 Mar 2020 36 days
LIJI LIJI-230297 Feb 2020 Mar 2020 36 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 36 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
ejan.co ejan.co
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 260 days
LIJI LIJI-230297 Jul 2019 Mar 2020 260 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 260 days
YUME YUME-102973855 Aug 2019 Mar 2020 226 days
PUBM PUBM-158039 Jul 2019 Feb 2020 224 days
LOOP LOOP-5918 Aug 2019 Mar 2020 209 days
RUB RUB-18110 Aug 2019 Feb 2020 173 days
FWHL FWHL-897697 Jul 2019 Dec 2019 158 days
OX OX-540553856 Jul 2019 Dec 2019 158 days
LOOP LOOP-S-2411 Jul 2019 Oct 2019 93 days
IEX IEX-186266 Aug 2019 Oct 2019 42 days
IEX IEX-186779 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
ffxivguild.com ffxivguild.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 174 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
SCLP SCLP-6793 Aug 2019 Mar 2020 226 days
RUB RUB-18110 Aug 2019 Mar 2020 211 days
OX OX-539872073 Aug 2019 Feb 2020 176 days
FWHL FWHL-897697 Dec 2019 Mar 2020 102 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 102 days
SVRN SVRN-230297 Oct 2019 Dec 2019 64 days
LIJI LIJI-230297 Aug 2019 Oct 2019 60 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Aug 2019 Aug 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
flyblog.tw flyblog.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Feb 2020 227 days
YUME YUME-102973855 Jul 2019 Feb 2020 227 days
SVRN SVRN-230297 Jul 2019 Feb 2020 227 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 227 days
SCLP SCLP-390 Aug 2019 Feb 2020 176 days
PUBM PUBM-158039 Jul 2019 Dec 2019 161 days
LIJI LIJI-230297 Jul 2019 Dec 2019 161 days
IEX IEX-186266 Aug 2019 Dec 2019 110 days
RUB RUB-18110 Dec 2019 Feb 2020 66 days
LOOP LOOP-5918 Aug 2019 Oct 2019 46 days
IEX IEX-186779 Jul 2019 Aug 2019 37 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
goingplacesmagazine.com goingplacesmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 224 days
PUBM PUBM-158039 Aug 2019 Mar 2020 224 days
YUME YUME-102973855 Aug 2019 Mar 2020 224 days
SVRN SVRN-230297 Aug 2019 Mar 2020 224 days
LIJI LIJI-230297 Aug 2019 Mar 2020 224 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 224 days
LOOP LOOP-5918 Aug 2019 Mar 2020 212 days
RUB RUB-18110 Aug 2019 Mar 2020 212 days
IEX IEX-186779 Aug 2019 Feb 2020 189 days
SCLP SCLP-390 Aug 2019 Dec 2019 112 days
OX OX-540553856 Dec 2019 Mar 2020 100 days
IEX IEX-186266 Dec 2019 Mar 2020 100 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
haber61.net haber61.net
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Jul 2019 Mar 2020 264 days
SVRN SVRN-230297 Jul 2019 Mar 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 264 days
FWHL FWHL-897697 Jul 2019 Feb 2020 229 days
LIJI LIJI-230297 Jul 2019 Feb 2020 229 days
LOOP LOOP-5918 Aug 2019 Mar 2020 213 days
IEX IEX-186779 Jul 2019 Dec 2019 164 days
OX OX-540553856 Jul 2019 Dec 2019 164 days
RUB RUB-18110 Aug 2019 Dec 2019 113 days
PUBM PUBM-158039 Jul 2019 Oct 2019 100 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
IEX IEX-186266 Oct 2019 Oct 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
india.com india.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
YUME YUME-102973855 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
SCLP SCLP-390 Jan 2020 Apr 2020 79 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 21 days
IEX IEX-186779 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
liputan.co.id jateng.liputan.co.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2020 Mar 2021 228 days
LOOP LOOP-5918 Jul 2020 Mar 2021 228 days
PUBM PUBM-158039 Jul 2020 Mar 2021 228 days
YUME YUME-102973855 Jul 2020 Mar 2021 228 days
SVRN SVRN-230297 Jul 2020 Mar 2021 228 days
LIJI LIJI-230297 Jul 2020 Mar 2021 228 days
YIMO YIMO-2073946213921227802 Jul 2020 Mar 2021 228 days
IEX IEX-186779 Oct 2020 Mar 2021 162 days
SCLP SCLP-390 Oct 2020 Mar 2021 162 days
RUB RUB-18110 Oct 2020 Jan 2021 112 days
IEX IEX-186266 Jul 2020 Jul 2020 One Off
SCLP SCLP-6426 Jul 2020 Jul 2020 One Off
LOOP LOOP-S-2411 Oct 2020 Oct 2020 One Off
OX OX-540553856 Jan 2021 Jan 2021 One Off
jrussofamilydental.com jrussofamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 161 days
SVRN SVRN-230297 Oct 2019 Mar 2020 161 days
LIJI LIJI-230297 Oct 2019 Mar 2020 161 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 161 days
IEX IEX-186779 Oct 2019 Feb 2020 126 days
LOOP LOOP-5918 Oct 2019 Feb 2020 126 days
PUBM PUBM-158039 Oct 2019 Feb 2020 126 days
YUME YUME-102973855 Oct 2019 Feb 2020 126 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
OX OX-540553856 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
komchadluek.net komchadluek.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Mar 2020 222 days
YUME YUME-102973855 Aug 2019 Mar 2020 222 days
SVRN SVRN-230297 Aug 2019 Mar 2020 222 days
LIJI LIJI-230297 Aug 2019 Mar 2020 222 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 222 days
LOOP LOOP-5918 Aug 2019 Mar 2020 217 days
FWHL FWHL-897697 Aug 2019 Feb 2020 187 days
OX OX-540553856 Oct 2019 Mar 2020 160 days
IEX IEX-186266 Aug 2019 Dec 2019 121 days
SCLP SCLP-6793 Oct 2019 Dec 2019 64 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
matichon.co.th matichon.co.th
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
IEX IEX-186266 Jan 2020 Apr 2020 79 days
IEX IEX-186779 Jan 2020 Apr 2020 79 days
OX OX-540553856 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
RUB RUB-18110 Jan 2020 Mar 2020 45 days
FWHL FWHL-897697 Jan 2020 Mar 2020 45 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
objectivist.co objectivist.co
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Aug 2019 Mar 2020 219 days
FWHL FWHL-897697 Aug 2019 Mar 2020 219 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 219 days
LOOP LOOP-S-2411 Dec 2019 Mar 2020 91 days
RUB RUB-18110 Dec 2019 Mar 2020 91 days
SCLP SCLP-6793 Dec 2019 Mar 2020 91 days
LOOP LOOP-5918 Aug 2019 Oct 2019 63 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
IEX IEX-186266 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
obviouslyharith.com obviouslyharith.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 270 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 270 days
PUBM PUBM-158039 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
SCLP SCLP-6793 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
IEX IEX-186779 Aug 2019 Mar 2020 219 days
OX OX-540553856 Aug 2019 Mar 2020 219 days
OX OX-540099026 Feb 2020 Feb 2020 2 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
phunutoday.vn phunutoday.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 250 days
PUBM PUBM-158039 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
OX OX-539872073 Sep 2019 Mar 2020 175 days
OX OX-540553856 Sep 2019 Mar 2020 175 days
SCLP SCLP-6793 Sep 2019 Mar 2020 175 days
LOOP LOOP-5918 Sep 2019 Nov 2019 65 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
poelab.com poelab.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 275 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 275 days
IEX IEX-186779 Jul 2019 Feb 2020 240 days
SVRN SVRN-230297 Jul 2019 Feb 2020 240 days
LIJI LIJI-230297 Jul 2019 Feb 2020 240 days
LOOP LOOP-5918 Aug 2019 Apr 2020 224 days
SCLP SCLP-6793 Aug 2019 Feb 2020 183 days
OX OX-540553856 Oct 2019 Apr 2020 155 days
OX OX-540099026 Feb 2020 Apr 2020 35 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
prachachat.net prachachat.net
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
IEX IEX-186779 Jan 2020 Mar 2020 45 days
YUME YUME-102973855 Jan 2020 Mar 2020 45 days
LOOP LOOP-5918 Jan 2020 Mar 2020 45 days
SCLP SCLP-6793 Jan 2020 Mar 2020 45 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
sina.com.tw sina.com.tw
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
YUME YUME-102973855 Jan 2020 Apr 2020 79 days
LOOP LOOP-S-2411 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
PUBM PUBM-158039 Jan 2020 Mar 2020 45 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
spiceee.net spiceee.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 278 days
PUBM PUBM-158039 Jul 2019 Apr 2020 278 days
SVRN SVRN-230297 Jul 2019 Apr 2020 278 days
LIJI LIJI-230297 Jul 2019 Apr 2020 278 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 278 days
IEX IEX-186779 Jul 2019 Apr 2020 267 days
YUME YUME-102973855 Jul 2019 Apr 2020 267 days
LOOP LOOP-5918 Aug 2019 Apr 2020 227 days
RUB RUB-18110 Aug 2019 Apr 2020 227 days
IEX IEX-186266 Aug 2019 Jan 2020 142 days
SCLP SCLP-390 Aug 2019 Jan 2020 142 days
LOOP LOOP-S-2411 Nov 2019 Mar 2020 117 days
OX OX-540099026 Feb 2020 Apr 2020 42 days
SCLP SCLP-6426 Mar 2020 Apr 2020 7 days
tempo.co tempo.co
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Apr 2020 285 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
LOOP LOOP-5918 Aug 2019 Apr 2020 234 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 230 days
SVRN SVRN-230297 Jul 2019 Jan 2020 186 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 145 days
SCLP SCLP-390 Nov 2019 Mar 2020 110 days
OX OX-539872073 Aug 2019 Nov 2019 89 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
SCLP SCLP-6793 Jul 2019 Sep 2019 55 days
YUME YUME-102973855 Jan 2020 Mar 2020 44 days
LIJI LIJI-230297 Jul 2019 Jul 2019 20 days
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
vietq.vn vietq.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 247 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 247 days
PUBM PUBM-158039 Jul 2019 Mar 2020 247 days
SCLP SCLP-6793 Jul 2019 Mar 2020 247 days
SVRN SVRN-230297 Jul 2019 Mar 2020 247 days
LIJI LIJI-230297 Jul 2019 Mar 2020 247 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 247 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
IEX IEX-186779 Jul 2019 Jan 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 196 days
OX OX-540553856 Jul 2019 Jan 2020 183 days
RUB RUB-18110 Aug 2019 Jan 2020 148 days
CA CA-PUB-1738284215641521 Mar 2019 Jul 2019 134 days
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
cmmedia.com.tw cmmedia.com.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Mar 2020 227 days
SVRN SVRN-230297 Jul 2019 Mar 2020 227 days
YUME YUME-102973855 Jul 2019 Mar 2020 227 days
LIJI LIJI-230297 Jul 2019 Mar 2020 227 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 227 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 189 days
IEX IEX-186779 Jul 2019 Dec 2019 123 days
IEX IEX-186266 Feb 2020 Mar 2020 38 days
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
datpiff.com datpiff.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Apr 2020 284 days
OX OX-540553856 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
RUB RUB-18110 Aug 2019 Apr 2020 233 days
IEX IEX-186266 Aug 2019 Apr 2020 233 days
PUBM PUBM-158039 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
YUME YUME-102973855 Sep 2019 Apr 2020 209 days
SCLP SCLP-390 Aug 2019 Jan 2020 154 days
SCLP SCLP-6793 Nov 2019 Apr 2020 144 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
hardaway.com.tw hardaway.com.tw
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 264 days
YUME YUME-102973855 Jul 2019 Feb 2020 229 days
SCLP SCLP-6793 Jul 2019 Feb 2020 229 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 229 days
LOOP LOOP-5918 Aug 2019 Mar 2020 213 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 189 days
IEX IEX-186266 Aug 2019 Feb 2020 178 days
SVRN SVRN-230297 Jul 2019 Dec 2019 165 days
LIJI LIJI-230297 Jul 2019 Dec 2019 165 days
FWHL FWHL-897697 Oct 2019 Dec 2019 65 days
IEX IEX-186779 Oct 2019 Dec 2019 65 days
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
hellhorror.com hellhorror.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
OX OX-540553856 Jul 2019 Mar 2020 231 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
PUBM PUBM-158039 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
LOOP LOOP-5918 Aug 2019 Mar 2020 199 days
IEX IEX-186779 Jul 2019 Jan 2020 186 days
RUB RUB-18110 Aug 2019 Jan 2020 154 days
SCLP SCLP-390 Aug 2019 Jan 2020 154 days
SVRN SVRN-230297 Jul 2019 Nov 2019 140 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
inkuiri.com inkuiri.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Feb 2021 Jun 2021 122 days
FWHL FWHL-897697 Feb 2021 Jun 2021 122 days
IEX IEX-186779 Feb 2021 Jun 2021 122 days
LOOP LOOP-5918 Feb 2021 Jun 2021 122 days
PUBM PUBM-158039 Feb 2021 Jun 2021 122 days
YUME YUME-102973855 Feb 2021 Jun 2021 122 days
RUB RUB-18110 Feb 2021 Jun 2021 122 days
SCLP SCLP-6426 Feb 2021 Jun 2021 122 days
SVRN SVRN-230297 Feb 2021 Jun 2021 122 days
LIJI LIJI-230297 Feb 2021 Jun 2021 122 days
YIMO YIMO-2073946213921227802 Feb 2021 Jun 2021 122 days
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
SCLP SCLP-390 Apr 2021 Apr 2021 One Off
LOOP LOOP-S-2411 Apr 2021 Apr 2021 One Off
ltsports.com.tw ltsports.com.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 298 days
YUME YUME-102973855 Aug 2019 Jun 2021 1 year, 298 days
LIJI LIJI-230297 Aug 2019 Jun 2021 1 year, 298 days
YIMO YIMO-2073946213921227802 Aug 2019 Jun 2021 1 year, 298 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 296 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 174 days
SCLP SCLP-6793 Aug 2019 Dec 2020 1 year, 124 days
OX OX-540553856 Feb 2020 Feb 2021 355 days
PUBM PUBM-158039 Aug 2019 Feb 2020 186 days
SVRN SVRN-230297 Aug 2019 Feb 2020 186 days
IEX IEX-186779 Oct 2019 Feb 2020 124 days
RUB RUB-18110 Oct 2019 Feb 2020 124 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Oct 2019 Oct 2019 One Off
malaysia-chronicle.com malaysia-chronicle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 231 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Jul 2019 Jan 2020 186 days
RUB RUB-18110 Sep 2019 Mar 2020 175 days
LOOP LOOP-5918 Sep 2019 Jan 2020 130 days
PUBM PUBM-158039 Jul 2019 Nov 2019 121 days
OX OX-540553856 Nov 2019 Mar 2020 110 days
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
nownews.com nownews.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 347 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 296 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 174 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
PUBM PUBM-158039 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 205 days
OX OX-540553856 Jul 2019 Jan 2020 205 days
YUME YUME-102973855 Jul 2019 Jan 2020 186 days
IEX IEX-186779 Jul 2019 Sep 2019 75 days
FWHL FWHL-897697 Jul 2019 Jul 2019 19 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
pepperrr.net pepperrr.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 274 days
PUBM PUBM-158039 Jul 2019 Mar 2020 274 days
SVRN SVRN-230297 Jul 2019 Mar 2020 274 days
LIJI LIJI-230297 Jul 2019 Mar 2020 274 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 274 days
IEX IEX-186779 Jul 2019 Mar 2020 269 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 269 days
YUME YUME-102973855 Jul 2019 Mar 2020 269 days
SCLP SCLP-390 Aug 2019 Mar 2020 223 days
OX OX-539872073 Aug 2019 Feb 2020 188 days
SCLP SCLP-6793 Oct 2019 Feb 2020 120 days
IEX IEX-186266 Aug 2019 Oct 2019 68 days
RUB RUB-18110 Oct 2019 Oct 2019 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
picsee.co picsee.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jun 2020 Nov 2020 143 days
IEX IEX-186779 Jun 2020 Nov 2020 143 days
PUBM PUBM-158039 Jun 2020 Nov 2020 143 days
YUME YUME-102973855 Jun 2020 Nov 2020 143 days
SCLP SCLP-6793 Jun 2020 Nov 2020 143 days
SVRN SVRN-230297 Jun 2020 Nov 2020 143 days
LIJI LIJI-230297 Jun 2020 Nov 2020 143 days
YIMO YIMO-2073946213921227802 Jun 2020 Nov 2020 143 days
RUB RUB-18110 Jul 2020 Nov 2020 116 days
LOOP LOOP-5918 Sep 2020 Nov 2020 63 days
LOOP LOOP-S-2411 Jun 2020 Jul 2020 27 days
OX OX-540553856 Jul 2020 Jul 2020 One Off
SCLP SCLP-390 Jul 2020 Jul 2020 One Off
OX OX-540099026 Sep 2020 Sep 2020 One Off
tel3c.tw tel3c.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jun 2021 1 year, 152 days
PUBM PUBM-158039 Jan 2020 Jun 2021 1 year, 152 days
SVRN SVRN-230297 Jan 2020 Jun 2021 1 year, 152 days
YIMO YIMO-2073946213921227802 Jan 2020 Jun 2021 1 year, 152 days
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 102 days
LOOP LOOP-S-2411 Jan 2020 Apr 2021 1 year, 92 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SCLP SCLP-390 Mar 2020 Apr 2021 1 year, 42 days
OX OX-540553856 Apr 2020 Feb 2021 311 days
SCLP SCLP-6793 Apr 2020 Dec 2020 259 days
YUME YUME-102973855 Jan 2020 Apr 2020 84 days
LIJI LIJI-230297 Jan 2020 Apr 2020 84 days
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
titotu.io titotu.io
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jun 2021 1 year, 347 days
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 280 days
SCLP SCLP-6793 Jul 2019 Apr 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 245 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
SVRN SVRN-230297 Nov 2019 Mar 2020 115 days
IEX IEX-186266 Nov 2019 Mar 2020 115 days
OX OX-540099026 Feb 2020 Apr 2020 44 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
becteroradio.com becteroradio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 263 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 263 days
YUME YUME-102973855 Jul 2019 Apr 2020 263 days
SVRN SVRN-230297 Jul 2019 Apr 2020 263 days
LIJI LIJI-230297 Jul 2019 Apr 2020 263 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 263 days
PUBM PUBM-158039 Sep 2019 Jan 2020 131 days
IEX IEX-186779 Sep 2019 Jan 2020 131 days
SCLP SCLP-390 Sep 2019 Jan 2020 131 days
OX OX-540099026 Feb 2020 Apr 2020 53 days
RUB RUB-18110 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 18 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
udargol.com udargol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 213 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 213 days
YUME YUME-102973855 Sep 2019 Apr 2020 213 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 213 days
IEX IEX-186266 Jan 2020 Apr 2020 83 days
SCLP SCLP-6793 Jan 2020 Apr 2020 83 days
LIJI LIJI-230297 Jan 2020 Mar 2020 48 days
PUBM PUBM-158039 Mar 2020 Apr 2020 35 days
IEX IEX-186779 Sep 2019 Sep 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
detik.com detik.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
FWHL FWHL-897697 Jul 2019 Jan 2020 205 days
LOOP LOOP-5918 Aug 2019 Mar 2020 199 days
SCLP SCLP-390 Aug 2019 Mar 2020 199 days
PUBM PUBM-158039 Sep 2019 Mar 2020 175 days
IEX IEX-186266 Aug 2019 Nov 2019 89 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
OX OX-540553856 Jul 2019 Sep 2019 75 days
SCLP SCLP-6793 Sep 2019 Nov 2019 65 days
LOOP LOOP-S-2411 Nov 2019 Jan 2020 65 days
IEX IEX-186779 Jul 2019 Sep 2019 56 days
dotahut.com dotahut.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 259 days
FWHL FWHL-897697 Jul 2019 Feb 2020 223 days
IEX IEX-186266 Aug 2019 Mar 2020 208 days
RUB RUB-18110 Aug 2019 Mar 2020 208 days
LIJI LIJI-230297 Aug 2019 Feb 2020 190 days
SVRN SVRN-230297 Oct 2019 Mar 2020 167 days
OX OX-539872073 Dec 2019 Mar 2020 103 days
OX OX-540553856 Dec 2019 Mar 2020 103 days
IEX IEX-186779 Dec 2019 Mar 2020 103 days
SCLP SCLP-390 Oct 2019 Dec 2019 64 days
LOOP LOOP-5918 Feb 2020 Mar 2020 36 days
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
favforward.com favforward.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Aug 2019 Mar 2020 225 days
SVRN SVRN-230297 Aug 2019 Mar 2020 225 days
LIJI LIJI-230297 Aug 2019 Mar 2020 225 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 225 days
RUB RUB-18110 Aug 2019 Feb 2020 176 days
LOOP LOOP-5918 Oct 2019 Mar 2020 165 days
PUBM PUBM-158039 Oct 2019 Mar 2020 165 days
OX OX-540553856 Oct 2019 Feb 2020 131 days
SCLP SCLP-390 Oct 2019 Feb 2020 131 days
FWHL FWHL-897697 Aug 2019 Dec 2019 124 days
LOOP LOOP-S-2411 Aug 2019 Dec 2019 124 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
finduniversity.ph finduniversity.ph
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jan 2020 186 days
PUBM PUBM-158039 Jul 2019 Jan 2020 186 days
SVRN SVRN-230297 Jul 2019 Jan 2020 186 days
LIJI LIJI-230297 Jul 2019 Jan 2020 186 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 186 days
LOOP LOOP-5918 Aug 2019 Jan 2020 155 days
RUB RUB-18110 Aug 2019 Jan 2020 155 days
YUME YUME-102973855 Jul 2019 Nov 2019 120 days
IEX IEX-186779 Nov 2019 Jan 2020 66 days
SCLP SCLP-6793 Nov 2019 Jan 2020 66 days
OX OX-540553856 Sep 2019 Nov 2019 65 days
IEX IEX-186266 Sep 2019 Sep 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
kenalice.tw kenalice.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 May 2020 Jun 2021 1 year, 31 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 31 days
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 31 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 31 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 31 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 31 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 31 days
SCLP SCLP-390 May 2020 Apr 2021 336 days
RUB RUB-18110 Sep 2020 Jun 2021 276 days
IEX IEX-186266 May 2020 Feb 2021 274 days
OX OX-540553856 May 2020 Feb 2021 274 days
FWHL FWHL-897697 May 2020 Sep 2020 120 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
kiss4d.com kiss4d.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
majorcineplex.com majorcineplex.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Oct 2019 Mar 2020 159 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 159 days
YUME YUME-102973855 Oct 2019 Mar 2020 159 days
SVRN SVRN-230297 Oct 2019 Mar 2020 159 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 159 days
FWHL FWHL-897697 Oct 2019 Feb 2020 124 days
SCLP SCLP-6793 Dec 2019 Mar 2020 94 days
IEX IEX-186779 Oct 2019 Dec 2019 65 days
RUB RUB-18110 Oct 2019 Dec 2019 65 days
OX OX-540099026 Feb 2020 Mar 2020 34 days
PUBM PUBM-158039 Oct 2019 Oct 2019 One Off
OX OX-539872073 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
oldcryptiansrfc.co.uk oldcryptiansrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Mar 2020 91 days
LOOP LOOP-S-2411 Dec 2019 Mar 2020 91 days
OX OX-540553856 Dec 2019 Mar 2020 91 days
PUBM PUBM-158039 Dec 2019 Mar 2020 91 days
SCLP SCLP-390 Dec 2019 Mar 2020 91 days
OX OX-539872073 Dec 2019 Mar 2020 89 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
RUB RUB-18110 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
oomph.co.id oomph.co.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 270 days
OX OX-540553856 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
RUB RUB-18110 Aug 2019 Feb 2020 187 days
SCLP SCLP-6793 Aug 2019 Feb 2020 183 days
LOOP LOOP-S-2411 Jul 2019 Dec 2019 180 days
PUBM PUBM-158039 Aug 2019 Dec 2019 128 days
IEX IEX-186779 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
afcsudbury.co.uk afcsudbury.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Mar 2020 Apr 2020 42 days
OX OX-540553856 Mar 2020 Apr 2020 42 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 18 days
SCLP SCLP-6426 Mar 2020 Apr 2020 16 days
LOOP LOOP-S-2411 Apr 2020 Apr 2020 8 days
SCLP SCLP-390 Apr 2020 Apr 2020 8 days
RUB RUB-18110 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
thansettakij.com thansettakij.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 267 days
LOOP LOOP-S-2411 Jul 2019 Apr 2020 267 days
YUME YUME-102973855 Jul 2019 Apr 2020 267 days
SVRN SVRN-230297 Jul 2019 Apr 2020 267 days
LIJI LIJI-230297 Jul 2019 Apr 2020 267 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 267 days
PUBM PUBM-158039 Jul 2019 Mar 2020 232 days
IEX IEX-186266 Aug 2019 Jan 2020 144 days
RUB RUB-18110 Jan 2020 Apr 2020 85 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
thetechgame.com thetechgame.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
IEX IEX-186266 Nov 2019 Feb 2021 1 year, 85 days
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
LOOP LOOP-5918 Nov 2019 Apr 2020 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Mar 2020 110 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Nov 2019 Jan 2020 65 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
bossmurmur.com bossmurmur.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Mar 2020 228 days
PUBM PUBM-158039 Jul 2019 Mar 2020 228 days
YUME YUME-102973855 Jul 2019 Mar 2020 228 days
SVRN SVRN-230297 Jul 2019 Mar 2020 228 days
LIJI LIJI-230297 Jul 2019 Mar 2020 228 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 228 days
FWHL FWHL-897697 Jul 2019 Feb 2020 188 days
LOOP LOOP-5918 Sep 2019 Mar 2020 171 days
RUB RUB-18110 Aug 2019 Nov 2019 99 days
SCLP SCLP-390 Aug 2019 Sep 2019 34 days
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
cnnindonesia.com cnnindonesia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Feb 2020 131 days
YUME YUME-102973855 Sep 2019 Feb 2020 131 days
SCLP SCLP-390 Sep 2019 Feb 2020 131 days
SVRN SVRN-230297 Sep 2019 Feb 2020 131 days
YIMO YIMO-2073946213921227802 Sep 2019 Feb 2020 131 days
LOOP LOOP-S-2411 Dec 2019 Feb 2020 66 days
OX OX-540553856 Dec 2019 Feb 2020 66 days
IEX IEX-186779 Sep 2019 Dec 2019 65 days
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
egg.network egg.network
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2020 Dec 2020 37 days
LOOP LOOP-5918 Nov 2020 Dec 2020 37 days
OX OX-540553856 Nov 2020 Dec 2020 37 days
PUBM PUBM-158039 Nov 2020 Dec 2020 37 days
YUME YUME-102973855 Nov 2020 Dec 2020 37 days
SVRN SVRN-230297 Nov 2020 Dec 2020 37 days
LIJI LIJI-230297 Nov 2020 Dec 2020 37 days
YIMO YIMO-2073946213921227802 Nov 2020 Dec 2020 37 days
RUB RUB-18110 Nov 2020 Nov 2020 One Off
IEX IEX-186266 Nov 2020 Nov 2020 One Off
SCLP SCLP-6426 Nov 2020 Nov 2020 One Off
IEX IEX-186779 Dec 2020 Dec 2020 One Off
SCLP SCLP-390 Dec 2020 Dec 2020 One Off
fimela.com fimela.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 262 days
FWHL FWHL-897697 Jul 2019 Mar 2020 262 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 262 days
LIJI LIJI-230297 Jul 2019 Mar 2020 262 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 227 days
LOOP LOOP-5918 Aug 2019 Mar 2020 211 days
OX OX-539872073 Aug 2019 Mar 2020 211 days
SCLP SCLP-390 Aug 2019 Feb 2020 176 days
SCLP SCLP-6793 Jul 2019 Dec 2019 161 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
gamebanshee.com gamebanshee.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
hoc24.vn hoc24.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 264 days
YUME YUME-102973855 Jul 2019 Mar 2020 264 days
LIJI LIJI-230297 Jul 2019 Mar 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 264 days
IEX IEX-186779 Jul 2019 Feb 2020 230 days
RUB RUB-18110 Aug 2019 Feb 2020 179 days
SVRN SVRN-230297 Jul 2019 Dec 2019 166 days
OX OX-539872073 Oct 2019 Mar 2020 162 days
SCLP SCLP-6793 Oct 2019 Mar 2020 162 days
IEX IEX-186266 Dec 2019 Mar 2020 98 days
LOOP LOOP-S-2411 Dec 2019 Mar 2020 98 days
LOOP LOOP-5918 Aug 2019 Oct 2019 51 days
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
idntimes.com idntimes.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 265 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 265 days
YUME YUME-102973855 Jul 2019 Mar 2020 265 days
OX OX-540553856 Jul 2019 Feb 2020 230 days
LIJI LIJI-230297 Jul 2019 Feb 2020 230 days
LOOP LOOP-S-2411 Aug 2019 Mar 2020 223 days
LOOP LOOP-5918 Aug 2019 Feb 2020 179 days
IEX IEX-186779 Jul 2019 Dec 2019 167 days
SCLP SCLP-390 Aug 2019 Dec 2019 116 days
SCLP SCLP-6793 Jul 2019 Oct 2019 103 days
FWHL FWHL-897697 Dec 2019 Mar 2020 98 days
RUB RUB-18110 Aug 2019 Oct 2019 52 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
lordsofpain.net lordsofpain.net
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Aug 2019 Mar 2020 199 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
mavikadin.com mavikadin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 270 days
PUBM PUBM-158039 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Feb 2020 235 days
IEX IEX-186779 Aug 2019 Mar 2020 220 days
IEX IEX-186266 Aug 2019 Mar 2020 219 days
LOOP LOOP-5918 Aug 2019 Mar 2020 219 days
SCLP SCLP-390 Oct 2019 Feb 2020 123 days
SCLP SCLP-6793 Dec 2019 Mar 2020 94 days
LOOP LOOP-S-2411 Aug 2019 Oct 2019 62 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
oldamplefordianrfc.com oldamplefordianrfc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Dec 2019 Mar 2020 91 days
RUB RUB-18110 Dec 2019 Mar 2020 91 days
OX OX-539872073 Dec 2019 Mar 2020 89 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
IEX IEX-186779 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
ondu.ru ondu.ru
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
FWHL FWHL-897697 Jul 2019 Apr 2020 284 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
YUME YUME-102973855 Jul 2019 Apr 2020 265 days
LOOP LOOP-5918 Aug 2019 Apr 2020 233 days
IEX IEX-186779 Sep 2019 Apr 2020 209 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 205 days
OX OX-539872073 Sep 2019 Mar 2020 196 days
IEX IEX-186266 Aug 2019 Jan 2020 154 days
SVRN SVRN-230297 Jul 2019 Jul 2019 19 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
sindonews.com sindonews.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Apr 2020 268 days
FWHL FWHL-897697 Jul 2019 Apr 2020 268 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 268 days
LIJI LIJI-230297 Jul 2019 Feb 2020 233 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 216 days
OX OX-539872073 Sep 2019 Mar 2020 209 days
SCLP SCLP-390 Aug 2019 Nov 2019 75 days
OX OX-540099026 Feb 2020 Apr 2020 42 days
IEX IEX-186266 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 7 days
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
sparknotes.com sparknotes.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jun 2021 1 year, 347 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
OX OX-540553856 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
SCLP SCLP-6793 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
LIJI LIJI-230297 Jul 2019 Nov 2019 121 days
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
suportepjfp.com suportepjfp.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Nov 2019 Apr 2020 151 days
RUB RUB-18110 Nov 2019 Apr 2020 151 days
FWHL FWHL-897697 Nov 2019 Apr 2020 151 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 151 days
OX OX-539872073 Nov 2019 Mar 2020 116 days
YUME YUME-102973855 Jan 2020 Apr 2020 85 days
OX OX-540553856 Mar 2020 Apr 2020 35 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
arax.site arax.site
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2019 Jan 2020 66 days
FWHL FWHL-897697 Nov 2019 Jan 2020 66 days
YIMO YIMO-2073946213921227802 Nov 2019 Jan 2020 66 days
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
teepr.com teepr.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
thedeadbolt.com thedeadbolt.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Apr 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 264 days
RUB RUB-18110 Aug 2019 Apr 2020 233 days
FWHL FWHL-897697 Jul 2019 Mar 2020 230 days
SCLP SCLP-6793 Sep 2019 Mar 2020 175 days
YUME YUME-102973855 Sep 2019 Jan 2020 130 days
LOOP LOOP-5918 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
bella-hadid.org bella-hadid.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 140 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 140 days
OX OX-540553856 Nov 2019 Mar 2020 106 days
IEX IEX-186779 Nov 2019 Mar 2020 106 days
LIJI LIJI-230297 Feb 2020 Mar 2020 40 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Nov 2019 Nov 2019 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
0rz.tw blog.0rz.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Mar 2020 256 days
OX OX-540553856 Jul 2019 Mar 2020 256 days
LIJI LIJI-230297 Jul 2019 Mar 2020 256 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 256 days
FWHL FWHL-897697 Jul 2019 Feb 2020 215 days
PUBM PUBM-158039 Jul 2019 Feb 2020 215 days
SVRN SVRN-230297 Jul 2019 Feb 2020 215 days
LOOP LOOP-5918 Aug 2019 Mar 2020 205 days
LOOP LOOP-S-2411 Sep 2019 Nov 2019 66 days
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
wargabiz.com.my wargabiz.com.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2020 Jun 2021 228 days
IEX IEX-186779 Oct 2020 Jun 2021 228 days
LOOP LOOP-5918 Oct 2020 Jun 2021 228 days
PUBM PUBM-158039 Oct 2020 Jun 2021 228 days
YUME YUME-102973855 Oct 2020 Jun 2021 228 days
RUB RUB-18110 Oct 2020 Jun 2021 228 days
SCLP SCLP-6426 Oct 2020 Jun 2021 228 days
SVRN SVRN-230297 Oct 2020 Jun 2021 228 days
LIJI LIJI-230297 Oct 2020 Jun 2021 228 days
YIMO YIMO-2073946213921227802 Oct 2020 Jun 2021 228 days
OX OX-540553856 Oct 2020 Feb 2021 106 days
OX OX-540099026 Apr 2021 Jun 2021 64 days
SCLP SCLP-6793 Oct 2020 Dec 2020 54 days
weieats.me weieats.me
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Apr 2020 282 days
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
SCLP SCLP-6793 Jul 2019 Mar 2020 248 days
YUME YUME-102973855 Jul 2019 Mar 2020 231 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
PUBM PUBM-158039 Jul 2019 Jan 2020 201 days
LIJI LIJI-230297 Jul 2019 Jan 2020 201 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 201 days
FWHL FWHL-897697 Jul 2019 Nov 2019 136 days
LOOP LOOP-5918 Aug 2019 Nov 2019 85 days
SCLP SCLP-390 Nov 2019 Jan 2020 65 days
IEX IEX-186266 Aug 2019 Sep 2019 20 days
IEX IEX-186779 Nov 2019 Nov 2019 One Off
cocidaho.com cocidaho.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Feb 2020 219 days
SVRN SVRN-230297 Jul 2019 Feb 2020 219 days
LIJI LIJI-230297 Jul 2019 Feb 2020 219 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 219 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 189 days
YUME YUME-102973855 Jul 2019 Feb 2020 189 days
FWHL FWHL-897697 Jul 2019 Dec 2019 153 days
IEX IEX-186779 Jul 2019 Dec 2019 123 days
LOOP LOOP-5918 Aug 2019 Dec 2019 102 days
RUB RUB-18110 Aug 2019 Dec 2019 102 days
OX OX-540553856 Jul 2019 Sep 2019 88 days
SCLP SCLP-6793 Jul 2019 Sep 2019 88 days
IEX IEX-186266 Aug 2019 Sep 2019 37 days
flyblog.cc flyblog.cc
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Feb 2020 227 days
SVRN SVRN-230297 Jul 2019 Feb 2020 227 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 227 days
PUBM PUBM-158039 Aug 2019 Feb 2020 190 days
RUB RUB-18110 Aug 2019 Feb 2020 176 days
LOOP LOOP-5918 Aug 2019 Feb 2020 176 days
SCLP SCLP-390 Aug 2019 Feb 2020 176 days
LIJI LIJI-230297 Jul 2019 Dec 2019 161 days
IEX IEX-186266 Aug 2019 Dec 2019 110 days
IEX IEX-186779 Jul 2019 Oct 2019 97 days
YUME YUME-102973855 Jul 2019 Oct 2019 97 days
LOOP LOOP-S-2411 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
fraghero.com fraghero.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Mar 2020 262 days
SVRN SVRN-230297 Jul 2019 Mar 2020 262 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 262 days
SCLP SCLP-390 Aug 2019 Mar 2020 211 days
IEX IEX-186266 Aug 2019 Mar 2020 211 days
PUBM PUBM-158039 Oct 2019 Mar 2020 165 days
YUME YUME-102973855 Oct 2019 Mar 2020 165 days
LIJI LIJI-230297 Jul 2019 Dec 2019 161 days
OX OX-540553856 Oct 2019 Feb 2020 130 days
RUB RUB-18110 Aug 2019 Oct 2019 46 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
game8.vn game8.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Mar 2020 1 year, 15 days
CA CA-PUB-2186101008500724 Oct 2019 May 2020 200 days
YIMO YIMO-2073946213921227802 Mar 2020 May 2020 52 days
SCLP SCLP-6426 Mar 2020 May 2020 43 days
OX OX-539872073 Mar 2020 Mar 2020 9 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
RUB RUB-18110 May 2020 May 2020 One Off
PUBM PUBM-158039 May 2020 May 2020 One Off
OX OX-540099026 May 2020 May 2020 One Off
OX OX-540553856 May 2020 May 2020 One Off
SCLP SCLP-390 May 2020 May 2020 One Off
LIJI LIJI-230297 May 2020 May 2020 One Off
FWHL FWHL-897697 May 2020 May 2020 One Off
gbatemp.net gbatemp.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Nov 2019 140 days
OX OX-540553856 Jul 2019 Nov 2019 140 days
PUBM PUBM-158039 Jul 2019 Nov 2019 140 days
SVRN SVRN-230297 Jul 2019 Nov 2019 140 days
LIJI LIJI-230297 Jul 2019 Nov 2019 140 days
SCLP SCLP-6793 Jul 2019 Nov 2019 140 days
FWHL FWHL-897697 Jul 2019 Nov 2019 140 days
YIMO YIMO-2073946213921227802 Jul 2019 Nov 2019 140 days
OX OX-539872073 Aug 2019 Nov 2019 89 days
IEX IEX-186266 Aug 2019 Nov 2019 89 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
YUME YUME-102973855 Sep 2019 Nov 2019 65 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
gcube.id gcube.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Dec 2019 280 days
FWHL FWHL-897697 Aug 2019 Mar 2020 225 days
SVRN SVRN-230297 Aug 2019 Mar 2020 225 days
LIJI LIJI-230297 Aug 2019 Mar 2020 225 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 225 days
OX OX-540553856 Aug 2019 Feb 2020 190 days
RUB RUB-18110 Aug 2019 Feb 2020 177 days
LOOP LOOP-5918 Dec 2019 Mar 2020 101 days
LOOP LOOP-S-2411 Aug 2019 Oct 2019 60 days
SCLP SCLP-390 Aug 2019 Oct 2019 47 days
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
goody25.com goody25.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 164 days
LIJI LIJI-230297 Oct 2019 Mar 2020 164 days
YUME YUME-102973855 Oct 2019 Mar 2020 164 days
SVRN SVRN-230297 Oct 2019 Mar 2020 164 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 164 days
LOOP LOOP-5918 Oct 2019 Feb 2020 129 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
RUB RUB-18110 Oct 2019 Oct 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
hijabista.com.my hijabista.com.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 264 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 264 days
PUBM PUBM-158039 Jul 2019 Mar 2020 264 days
YUME YUME-102973855 Jul 2019 Mar 2020 264 days
SVRN SVRN-230297 Jul 2019 Mar 2020 264 days
LIJI LIJI-230297 Jul 2019 Mar 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 264 days
SCLP SCLP-6793 Jul 2019 Feb 2020 229 days
IEX IEX-186266 Aug 2019 Mar 2020 213 days
IEX IEX-186779 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
merdeka.com merdeka.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Mar 2020 271 days
FWHL FWHL-897697 Jul 2019 Mar 2020 271 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 271 days
LIJI LIJI-230297 Jul 2019 Mar 2020 271 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 271 days
SCLP SCLP-6793 Jul 2019 Feb 2020 235 days
SVRN SVRN-230297 Jul 2019 Feb 2020 235 days
OX OX-540553856 Aug 2019 Mar 2020 221 days
LOOP LOOP-5918 Aug 2019 Feb 2020 184 days
YUME YUME-102973855 Jul 2019 Oct 2019 112 days
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
overeasy.club overeasy.club
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 32 days
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
redbridgeunitedboysfc.com redbridgeunitedboysfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 5 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
akkinews.net akkinews.net
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Jan 2020 Apr 2020 77 days
SVRN SVRN-230297 Jan 2020 Apr 2020 77 days
FWHL FWHL-897697 Jan 2020 Apr 2020 77 days
SCLP SCLP-6793 Jan 2020 Apr 2020 77 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 77 days
LIJI LIJI-230297 Jan 2020 Mar 2020 43 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
OX OX-539872073 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
thaiticketmajor.com thaiticketmajor.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Jan 2020 Jun 2021 1 year, 142 days
FWHL FWHL-897697 Jan 2020 Jun 2021 1 year, 142 days
LOOP LOOP-5918 Jan 2020 Jun 2021 1 year, 142 days
YUME YUME-102973855 Jan 2020 Jun 2021 1 year, 142 days
SVRN SVRN-230297 Jan 2020 Jun 2021 1 year, 142 days
LIJI LIJI-230297 Jan 2020 Jun 2021 1 year, 142 days
YIMO YIMO-2073946213921227802 Jan 2020 Jun 2021 1 year, 142 days
SCLP SCLP-390 Mar 2020 Apr 2021 1 year, 37 days
SCLP SCLP-6793 Jan 2020 Dec 2020 333 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
OX OX-539872073 Jan 2020 Mar 2020 66 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
tinngan.vn tinngan.vn
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 79 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
YUME YUME-102973855 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
LOOP LOOP-5918 Jan 2020 Apr 2020 79 days
SCLP SCLP-390 Jan 2020 Apr 2020 79 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
titotu.ru titotu.ru
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jun 2021 1 year, 347 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 347 days
SVRN SVRN-230297 Sep 2019 Jun 2021 1 year, 281 days
RUB RUB-18110 Sep 2019 Jun 2021 1 year, 281 days
SCLP SCLP-390 Sep 2019 Apr 2021 1 year, 221 days
SCLP SCLP-6793 Sep 2019 Dec 2020 1 year, 107 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186779 Sep 2019 Mar 2020 179 days
OX OX-540099026 Feb 2020 Apr 2020 44 days
IEX IEX-186266 Mar 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 9 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
vnex.tv vnex.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jan 2020 Apr 2020 81 days
FWHL FWHL-897697 Jan 2020 Apr 2020 81 days
LOOP LOOP-5918 Jan 2020 Apr 2020 81 days
YUME YUME-102973855 Jan 2020 Apr 2020 81 days
SVRN SVRN-230297 Jan 2020 Apr 2020 81 days
LIJI LIJI-230297 Jan 2020 Apr 2020 81 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 81 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
weibo.com weibo.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Mar 2020 Apr 2020 34 days
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
yjg66qf.cn yjg66qf.cn
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
yshanxuxu.com yshanxuxu.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 283 days
SVRN SVRN-230297 Jul 2019 Apr 2020 283 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 249 days
LOOP LOOP-5918 Aug 2019 Apr 2020 232 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
OX OX-540553856 Sep 2019 Apr 2020 210 days
FWHL FWHL-897697 Jul 2019 Jan 2020 203 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 203 days
SCLP SCLP-6793 Jul 2019 Jan 2020 203 days
LIJI LIJI-230297 Jul 2019 Jan 2020 203 days
YUME YUME-102973855 Sep 2019 Jan 2020 130 days
OX OX-540099026 Feb 2020 Apr 2020 47 days
IEX IEX-186266 Aug 2019 Sep 2019 22 days
comicbookherald.com comicbookherald.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
FWHL FWHL-897697 Jul 2019 May 2020 325 days
YIMO YIMO-2073946213921227802 Jul 2019 May 2020 325 days
IEX IEX-186266 Sep 2019 Mar 2020 175 days
SVRN SVRN-230297 Jul 2019 Sep 2019 75 days
LOOP LOOP-5918 Mar 2020 May 2020 75 days
YUME YUME-102973855 Sep 2019 Nov 2019 65 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Jul 2019 Jul 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
OX OX-540099026 May 2020 May 2020 One Off
SCLP SCLP-6793 May 2020 May 2020 One Off
dreamersradio.com dreamersradio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2020 Jun 2021 264 days
LOOP LOOP-5918 Sep 2020 Jun 2021 264 days
PUBM PUBM-158039 Sep 2020 Jun 2021 264 days
YUME YUME-102973855 Sep 2020 Jun 2021 264 days
SVRN SVRN-230297 Sep 2020 Jun 2021 264 days
LIJI LIJI-230297 Sep 2020 Jun 2021 264 days
YIMO YIMO-2073946213921227802 Sep 2020 Jun 2021 264 days
RUB RUB-18110 Sep 2020 May 2021 225 days
IEX IEX-186779 Nov 2020 Jun 2021 197 days
IEX IEX-186266 Sep 2020 Jan 2021 106 days
SCLP SCLP-6793 Sep 2020 Dec 2020 90 days
LOOP LOOP-S-2411 Nov 2020 Feb 2021 89 days
OX OX-540553856 Nov 2020 Feb 2021 75 days
dualshockers.com dualshockers.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Sep 2019 Apr 2020 209 days
PUBM PUBM-158039 Sep 2019 Apr 2020 209 days
SVRN SVRN-230297 Sep 2019 Apr 2020 209 days
LIJI LIJI-230297 Sep 2019 Apr 2020 209 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 209 days
FWHL FWHL-897697 Sep 2019 Apr 2020 209 days
OX OX-539872073 Sep 2019 Mar 2020 196 days
IEX IEX-186779 Sep 2019 Mar 2020 175 days
IEX IEX-186266 Nov 2019 Apr 2020 144 days
RUB RUB-18110 Jan 2020 Apr 2020 79 days
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
eramuslim.com eramuslim.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 102 days
LOOP LOOP-5918 Dec 2019 Mar 2020 102 days
YUME YUME-102973855 Dec 2019 Mar 2020 102 days
SVRN SVRN-230297 Dec 2019 Mar 2020 102 days
LIJI LIJI-230297 Dec 2019 Mar 2020 102 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 102 days
SCLP SCLP-6793 Feb 2020 Mar 2020 36 days
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Dec 2019 Dec 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
hazardlab.jp hazardlab.jp
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 99 days
YUME YUME-102973855 Dec 2019 Mar 2020 99 days
SVRN SVRN-230297 Dec 2019 Mar 2020 99 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 99 days
SCLP SCLP-390 Dec 2019 Feb 2020 64 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 28 days
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
homeschoolmath.net homeschoolmath.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Mar 2020 Apr 2020 34 days
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 21 days
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
hqcelebrity.org hqcelebrity.org
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Nov 2019 Jan 2020 65 days
OX OX-540553856 Nov 2019 Jan 2020 65 days
RUB RUB-18110 Nov 2019 Jan 2020 65 days
PUBM PUBM-158039 Nov 2019 Jan 2020 65 days
SVRN SVRN-230297 Nov 2019 Jan 2020 65 days
IEX IEX-186266 Nov 2019 Jan 2020 65 days
YIMO YIMO-2073946213921227802 Nov 2019 Jan 2020 65 days
FWHL FWHL-897697 Nov 2019 Jan 2020 65 days
IEX IEX-186779 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
investasi.web.id investasi.web.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 223 days
LOOP LOOP-S-2411 Aug 2019 Mar 2020 223 days
PUBM PUBM-158039 Aug 2019 Mar 2020 223 days
YUME YUME-102973855 Aug 2019 Mar 2020 223 days
SVRN SVRN-230297 Aug 2019 Mar 2020 223 days
LIJI LIJI-230297 Aug 2019 Mar 2020 223 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 223 days
IEX IEX-186266 Aug 2019 Feb 2020 180 days
IEX IEX-186779 Oct 2019 Mar 2020 162 days
RUB RUB-18110 Oct 2019 Mar 2020 162 days
OX OX-540553856 Dec 2019 Mar 2020 98 days
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
jabx.net jabx.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 266 days
IEX IEX-186266 Aug 2019 Feb 2020 180 days
OX OX-540553856 Dec 2019 Mar 2020 97 days
FWHL FWHL-897697 Dec 2019 Mar 2020 97 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 97 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
RUB RUB-18110 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 30 days
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
lfgcomic.com lfgcomic.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
mababy.com mababy.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Aug 2019 Feb 2020 186 days
PUBM PUBM-158039 Aug 2019 Feb 2020 186 days
YUME YUME-102973855 Aug 2019 Feb 2020 186 days
SVRN SVRN-230297 Aug 2019 Feb 2020 186 days
LIJI LIJI-230297 Aug 2019 Feb 2020 186 days
YIMO YIMO-2073946213921227802 Aug 2019 Feb 2020 186 days
FWHL FWHL-897697 Aug 2019 Dec 2019 127 days
SCLP SCLP-390 Oct 2019 Dec 2019 65 days
IEX IEX-186266 Aug 2019 Oct 2019 60 days
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Dec 2019 Dec 2019 One Off
OX OX-539872073 Dec 2019 Dec 2019 One Off
RUB RUB-18110 Dec 2019 Dec 2019 One Off
malaymail.com malaymail.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Mar 2020 270 days
PUBM PUBM-158039 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
IEX IEX-186266 Aug 2019 Mar 2020 219 days
OX OX-540553856 Aug 2019 Feb 2020 186 days
SCLP SCLP-6793 Oct 2019 Mar 2020 158 days
SCLP SCLP-390 Aug 2019 Dec 2019 125 days
FWHL FWHL-897697 Aug 2019 Oct 2019 63 days
LOOP LOOP-5918 Aug 2019 Oct 2019 61 days
IEX IEX-186779 Jul 2019 Aug 2019 49 days
SVRN SVRN-230297 Jul 2019 Aug 2019 49 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
onmsft.com onmsft.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Aug 2019 Mar 2020 218 days
FWHL FWHL-897697 Aug 2019 Mar 2020 218 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 183 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 90 days
SCLP SCLP-390 Aug 2019 Oct 2019 63 days
RUB RUB-18110 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 35 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
panlasangpinoy.com panlasangpinoy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 144 days
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
OX OX-540553856 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Nov 2019 Nov 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
racingweb.site racingweb.site
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2020 Jul 2020 One Off
FWHL FWHL-897697 Jul 2020 Jul 2020 One Off
RUB RUB-18110 Jul 2020 Jul 2020 One Off
OX OX-540099026 Jul 2020 Jul 2020 One Off
OX OX-540553856 Jul 2020 Jul 2020 One Off
IEX IEX-186266 Jul 2020 Jul 2020 One Off
IEX IEX-186779 Jul 2020 Jul 2020 One Off
SVRN SVRN-230297 Jul 2020 Jul 2020 One Off
LIJI LIJI-230297 Jul 2020 Jul 2020 One Off
YIMO YIMO-2073946213921227802 Jul 2020 Jul 2020 One Off
YUME YUME-102973855 Jul 2020 Jul 2020 One Off
LOOP LOOP-S-2411 Jul 2020 Jul 2020 One Off
SCLP SCLP-390 Jul 2020 Jul 2020 One Off
haluan.co riaumandiri.haluan.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2020 Nov 2020 64 days
CA CA-PUB-2186101008500724 Sep 2020 Nov 2020 64 days
PUBM PUBM-158039 Sep 2020 Nov 2020 64 days
YUME YUME-102973855 Sep 2020 Nov 2020 64 days
RUB RUB-18110 Sep 2020 Nov 2020 64 days
SCLP SCLP-6793 Sep 2020 Nov 2020 64 days
SVRN SVRN-230297 Sep 2020 Nov 2020 64 days
LIJI LIJI-230297 Sep 2020 Nov 2020 64 days
YIMO YIMO-2073946213921227802 Sep 2020 Nov 2020 64 days
IEX IEX-186266 Sep 2020 Sep 2020 One Off
LOOP LOOP-5918 Sep 2020 Sep 2020 One Off
IEX IEX-186779 Nov 2020 Nov 2020 One Off
LOOP LOOP-S-2411 Nov 2020 Nov 2020 One Off
applianceinsight.com.tw applianceinsight.com.tw
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 93 days
PUBM PUBM-158039 Mar 2020 Jun 2021 1 year, 93 days
SVRN SVRN-230297 Mar 2020 Jun 2021 1 year, 93 days
YIMO YIMO-2073946213921227802 Mar 2020 Jun 2021 1 year, 93 days
LOOP LOOP-S-2411 Apr 2020 Apr 2021 364 days
SCLP SCLP-6793 Mar 2020 Dec 2020 284 days
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 17 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
redcarrufc.co.uk redcarrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 30 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
southnewtonfc.co.uk southnewtonfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 27 days
SCLP SCLP-6426 Mar 2020 Apr 2020 7 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
014438.com 014438.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
stalbansladiesfc.com stalbansladiesfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Apr 2020 35 days
OX OX-540099026 Mar 2020 Apr 2020 35 days
OX OX-540553856 Mar 2020 Apr 2020 35 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
bajenny.com bajenny.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 229 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 229 days
SVRN SVRN-230297 Jul 2019 Jan 2020 188 days
LIJI LIJI-230297 Jul 2019 Jan 2020 188 days
LOOP LOOP-5918 Aug 2019 Jan 2020 163 days
OX OX-540099026 Feb 2020 Apr 2020 53 days
RUB RUB-18110 Sep 2019 Sep 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
uberhumor.com uberhumor.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Nov 2019 121 days
OX OX-540553856 Jul 2019 Nov 2019 121 days
YIMO YIMO-2073946213921227802 Jul 2019 Nov 2019 121 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
LIJI LIJI-230297 Sep 2019 Nov 2019 65 days
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Nov 2019 Nov 2019 One Off
worldpopulationreview.com worldpopulationreview.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Nov 2019 Mar 2020 110 days
OX OX-540553856 Nov 2019 Mar 2020 110 days
YIMO YIMO-2073946213921227802 Nov 2019 Mar 2020 110 days
RUB RUB-18110 Nov 2019 Mar 2020 110 days
FWHL FWHL-897697 Nov 2019 Mar 2020 110 days
SCLP SCLP-6793 Nov 2019 Jan 2020 66 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
edwardmovieclub.com edwardmovieclub.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Mar 2020 226 days
YUME YUME-102973855 Aug 2019 Mar 2020 226 days
SVRN SVRN-230297 Aug 2019 Mar 2020 226 days
LIJI LIJI-230297 Aug 2019 Mar 2020 226 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 226 days
FWHL FWHL-897697 Aug 2019 Feb 2020 190 days
LOOP LOOP-S-2411 Aug 2019 Feb 2020 190 days
IEX IEX-186266 Aug 2019 Feb 2020 173 days
RUB RUB-18110 Aug 2019 Feb 2020 173 days
LOOP LOOP-5918 Oct 2019 Mar 2020 167 days
OX OX-539872073 Oct 2019 Feb 2020 131 days
OX OX-540553856 Mar 2020 Mar 2020 One Off
fstoppers.com fstoppers.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
goal.com goal.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Apr 2020 264 days
SCLP SCLP-6793 Jul 2019 Apr 2020 264 days
OX OX-540553856 Jul 2019 Mar 2020 230 days
PUBM PUBM-158039 Jul 2019 Mar 2020 230 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
LOOP LOOP-5918 Sep 2019 Mar 2020 175 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 144 days
SCLP SCLP-390 Sep 2019 Jan 2020 130 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
gujaratimidday.com gujaratimidday.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Oct 2019 Mar 2020 163 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 163 days
YIMO YIMO-2073946213921227802 Aug 2019 Dec 2019 125 days
LOOP LOOP-5918 Aug 2019 Dec 2019 113 days
RUB RUB-18110 Aug 2019 Oct 2019 49 days
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
horrornews.net horrornews.net
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
OX OX-540099026 Feb 2020 Jun 2021 1 year, 111 days
FWHL FWHL-897697 Jul 2019 Feb 2020 230 days
OX OX-540553856 Jul 2019 Feb 2020 230 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 230 days
OX OX-539872073 Aug 2019 Feb 2020 179 days
IEX IEX-186266 Aug 2019 Feb 2020 179 days
SVRN SVRN-230297 Jul 2019 Oct 2019 102 days
LIJI LIJI-230297 Jul 2019 Oct 2019 102 days
SCLP SCLP-6793 Jul 2019 Oct 2019 102 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
ihorror.com ihorror.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 162 days
SVRN SVRN-230297 Oct 2019 Mar 2020 162 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 162 days
SCLP SCLP-390 Dec 2019 Mar 2020 98 days
OX OX-540553856 Oct 2019 Dec 2019 64 days
RUB RUB-18110 Oct 2019 Dec 2019 64 days
LIJI LIJI-230297 Oct 2019 Dec 2019 64 days
PUBM PUBM-158039 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
myphoneclub.com myphoneclub.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
ohztv.com ohztv.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Feb 2020 56 days
RUB RUB-18110 Dec 2019 Feb 2020 56 days
SVRN SVRN-230297 Dec 2019 Feb 2020 56 days
LIJI LIJI-230297 Dec 2019 Feb 2020 56 days
YIMO YIMO-2073946213921227802 Dec 2019 Feb 2020 56 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
oldcooperiansrfc.com oldcooperiansrfc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 91 days
IEX IEX-186266 Dec 2019 Mar 2020 91 days
LOOP LOOP-5918 Dec 2019 Mar 2020 91 days
PUBM PUBM-158039 Dec 2019 Mar 2020 91 days
SCLP SCLP-6793 Dec 2019 Mar 2020 91 days
SCLP SCLP-390 Dec 2019 Mar 2020 91 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
purinkonbayashi.com purinkonbayashi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Oct 2019 115 days
FWHL FWHL-897697 Jul 2019 Oct 2019 115 days
SVRN SVRN-230297 Jul 2019 Oct 2019 115 days
LIJI LIJI-230297 Jul 2019 Oct 2019 115 days
YIMO YIMO-2073946213921227802 Jul 2019 Oct 2019 115 days
IEX IEX-186779 Aug 2019 Oct 2019 63 days
RUB RUB-18110 Aug 2019 Aug 2019 7 days
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
saucemonsters.com saucemonsters.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
sportingnews.com sportingnews.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Mar 2020 231 days
OX OX-540553856 Jul 2019 Mar 2020 231 days
PUBM PUBM-158039 Jul 2019 Mar 2020 231 days
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
SCLP SCLP-6793 Jul 2019 Mar 2020 231 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 231 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Nov 2019 Mar 2020 110 days
OX OX-539872073 Nov 2019 Mar 2020 110 days
LOOP LOOP-5918 Nov 2019 Mar 2020 110 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
stonehavenfc.co.uk stonehavenfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
teepr.cc teepr.cc
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
tgrthaber.com.tr tgrthaber.com.tr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 214 days
LOOP LOOP-S-2411 Sep 2019 Apr 2020 214 days
YUME YUME-102973855 Sep 2019 Apr 2020 214 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 214 days
PUBM PUBM-158039 Sep 2019 Mar 2020 179 days
SVRN SVRN-230297 Nov 2019 Mar 2020 116 days
SCLP SCLP-6793 Jan 2020 Apr 2020 85 days
LOOP LOOP-5918 Jan 2020 Mar 2020 50 days
IEX IEX-186779 Sep 2019 Sep 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
theweekdaytimes.com theweekdaytimes.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2020 Jun 2021 329 days
FWHL FWHL-897697 Jul 2020 Jun 2021 329 days
SVRN SVRN-230297 Jul 2020 Jun 2021 329 days
LOOP LOOP-S-2411 Jul 2020 Apr 2021 269 days
YUME YUME-102973855 Jul 2020 Jul 2020 One Off
RUB RUB-18110 Jul 2020 Jul 2020 One Off
IEX IEX-186266 Jul 2020 Jul 2020 One Off
PUBM PUBM-158039 Jul 2020 Jul 2020 One Off
OX OX-540099026 Jul 2020 Jul 2020 One Off
YIMO YIMO-2073946213921227802 Jul 2020 Jul 2020 One Off
LOOP LOOP-5918 Jul 2020 Jul 2020 One Off
SCLP SCLP-6426 Jul 2020 Jul 2020 One Off
hops.id beta.hops.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2020 Apr 2021 215 days
IEX IEX-186779 Sep 2020 Apr 2021 215 days
PUBM PUBM-158039 Sep 2020 Apr 2021 215 days
YUME YUME-102973855 Sep 2020 Apr 2021 215 days
RUB RUB-18110 Sep 2020 Apr 2021 215 days
SVRN SVRN-230297 Sep 2020 Apr 2021 215 days
LIJI LIJI-230297 Sep 2020 Apr 2021 215 days
YIMO YIMO-2073946213921227802 Sep 2020 Apr 2021 215 days
LOOP LOOP-S-2411 Sep 2020 Sep 2020 One Off
SCLP SCLP-6793 Sep 2020 Sep 2020 One Off
LOOP LOOP-5918 Apr 2021 Apr 2021 One Off
SCLP SCLP-390 Apr 2021 Apr 2021 One Off
bgr.in bgr.in
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 289 days
FWHL FWHL-897697 Jul 2019 Apr 2020 289 days
SCLP SCLP-6793 Jul 2019 Apr 2020 289 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 289 days
SVRN SVRN-230297 Jul 2019 Mar 2020 255 days
RUB RUB-18110 Aug 2019 Apr 2020 238 days
YUME YUME-102973855 Jul 2019 Mar 2020 228 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Jul 2019 Jul 2019 27 days
OX OX-540553856 Jul 2019 Jul 2019 27 days
LOOP LOOP-S-2411 Jul 2019 Jul 2019 27 days
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
bleedingcool.com bleedingcool.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jun 2021 1 year, 328 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 328 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
YUME YUME-102973855 Sep 2019 Jun 2021 1 year, 272 days
IEX IEX-186266 Sep 2019 Feb 2021 1 year, 150 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
OX OX-540553856 Jul 2019 Jan 2020 205 days
FWHL FWHL-897697 Jul 2019 Jan 2020 186 days
SVRN SVRN-230297 Jul 2019 Nov 2019 121 days
LIJI LIJI-230297 Jul 2019 Nov 2019 121 days
SCLP SCLP-390 Aug 2019 Nov 2019 89 days
PUBM PUBM-158039 Sep 2019 Nov 2019 65 days
bowdoncricketclub.com bowdoncricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Mar 2020 40 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
wowkeren.com wowkeren.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Sep 2019 75 days
OX OX-540553856 Jul 2019 Sep 2019 75 days
SVRN SVRN-230297 Jul 2019 Sep 2019 75 days
FWHL FWHL-897697 Jul 2019 Sep 2019 75 days
SCLP SCLP-6793 Jul 2019 Sep 2019 75 days
LIJI LIJI-230297 Jul 2019 Sep 2019 75 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 75 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 55 days
YUME YUME-102973855 Jul 2019 Sep 2019 55 days
IEX IEX-186266 Aug 2019 Sep 2019 24 days
RUB RUB-18110 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
zdtf.icu zdtf.icu
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Mar 2020 Apr 2020 33 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 33 days
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
dongtw.com dongtw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Oct 2019 92 days
PUBM PUBM-158039 Jul 2019 Oct 2019 92 days
SVRN SVRN-230297 Jul 2019 Oct 2019 92 days
LIJI LIJI-230297 Jul 2019 Oct 2019 92 days
YIMO YIMO-2073946213921227802 Jul 2019 Oct 2019 92 days
IEX IEX-186779 Aug 2019 Oct 2019 59 days
YUME YUME-102973855 Aug 2019 Oct 2019 59 days
RUB RUB-18110 Aug 2019 Oct 2019 41 days
LOOP LOOP-5918 Aug 2019 Oct 2019 41 days
OX OX-539872073 Aug 2019 Oct 2019 41 days
LOOP LOOP-S-2411 Jul 2019 Aug 2019 33 days
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
ksubthai.co ksubthai.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Dec 2019 173 days
LIJI LIJI-230297 Jul 2019 Dec 2019 173 days
YIMO YIMO-2073946213921227802 Jul 2019 Dec 2019 173 days
PUBM PUBM-158039 Aug 2019 Dec 2019 126 days
YUME YUME-102973855 Aug 2019 Dec 2019 126 days
SVRN SVRN-230297 Aug 2019 Dec 2019 126 days
LOOP LOOP-5918 Aug 2019 Dec 2019 122 days
IEX IEX-186266 Aug 2019 Dec 2019 122 days
RUB RUB-18110 Aug 2019 Dec 2019 122 days
SCLP SCLP-6793 Jul 2019 Aug 2019 47 days
OX OX-540553856 Aug 2019 Aug 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
lolcounter.com lolcounter.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Dec 2019 Mar 2020 94 days
OX OX-540553856 Dec 2019 Mar 2020 94 days
IEX IEX-186779 Dec 2019 Mar 2020 94 days
PUBM PUBM-158039 Dec 2019 Feb 2020 59 days
YIMO YIMO-2073946213921227802 Dec 2019 Feb 2020 59 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 33 days
IEX IEX-186266 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
mook.com.tw mook.com.tw
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Feb 2020 Jun 2021 1 year, 111 days
YIMO YIMO-2073946213921227802 Feb 2020 Jun 2021 1 year, 111 days
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 76 days
LOOP LOOP-S-2411 Feb 2020 Apr 2021 1 year, 51 days
OX OX-540553856 Mar 2020 Feb 2021 319 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
nonilo.com nonilo.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Feb 2020 236 days
LIJI LIJI-230297 Jul 2019 Feb 2020 236 days
PUBM PUBM-158039 Jul 2019 Feb 2020 236 days
FWHL FWHL-897697 Jul 2019 Feb 2020 236 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 236 days
IEX IEX-186266 Aug 2019 Feb 2020 187 days
LOOP LOOP-5918 Aug 2019 Feb 2020 187 days
YUME YUME-102973855 Jul 2019 Dec 2019 179 days
RUB RUB-18110 Aug 2019 Dec 2019 130 days
OX OX-540553856 Jul 2019 Oct 2019 114 days
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
oldwilsoniansfc.com oldwilsoniansfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Mar 2020 91 days
LOOP LOOP-5918 Dec 2019 Mar 2020 91 days
OX OX-540553856 Dec 2019 Mar 2020 91 days
SCLP SCLP-390 Dec 2019 Mar 2020 91 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
planetminecraft.com planetminecraft.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Nov 2019 140 days
OX OX-539872073 Aug 2019 Nov 2019 89 days
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
IEX IEX-186266 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
inmap.tw inmap.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Jun 2021 1 year, 179 days
PUBM PUBM-158039 Dec 2019 Jun 2021 1 year, 179 days
YUME YUME-102973855 Dec 2019 Jun 2021 1 year, 179 days
RUB RUB-18110 Dec 2019 Jun 2021 1 year, 179 days
SVRN SVRN-230297 Dec 2019 Jun 2021 1 year, 179 days
LIJI LIJI-230297 Dec 2019 Jun 2021 1 year, 179 days
YIMO YIMO-2073946213921227802 Dec 2019 Jun 2021 1 year, 179 days
LOOP LOOP-S-2411 Dec 2019 Apr 2021 1 year, 119 days
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 81 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
OX OX-540553856 Dec 2019 Feb 2021 1 year, 57 days
SCLP SCLP-390 Feb 2020 Apr 2021 1 year, 56 days
alphingtonafc.com alphingtonafc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Apr 2020 76 days
IEX IEX-186266 Jan 2020 Apr 2020 76 days
OX OX-540553856 Jan 2020 Apr 2020 76 days
RUB RUB-18110 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
ssbworld.com ssbworld.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 152 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 152 days
SCLP SCLP-390 Nov 2019 Mar 2020 117 days
LIJI LIJI-230297 Nov 2019 Jan 2020 66 days
LOOP LOOP-S-2411 Jan 2020 Mar 2020 51 days
LOOP LOOP-5918 Mar 2020 Apr 2020 35 days
RUB RUB-18110 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Nov 2019 Nov 2019 One Off
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
staplegroveyfc.com staplegroveyfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
teamplayergaming.com teamplayergaming.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jan 2020 205 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 205 days
OX OX-540553856 Jul 2019 Jan 2020 205 days
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
FWHL FWHL-897697 Jul 2019 Jan 2020 205 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 205 days
IEX IEX-186266 Aug 2019 Jan 2020 154 days
RUB RUB-18110 Sep 2019 Jan 2020 130 days
LIJI LIJI-230297 Jul 2019 Sep 2019 75 days
OX OX-539872073 Sep 2019 Nov 2019 65 days
LOOP LOOP-5918 Aug 2019 Sep 2019 24 days
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
utusan.my utusan.my
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Sep 2019 69 days
LIJI LIJI-230297 Jul 2019 Sep 2019 69 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 69 days
SCLP SCLP-6793 Jul 2019 Sep 2019 54 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 54 days
FWHL FWHL-897697 Jul 2019 Jul 2019 15 days
PUBM PUBM-158039 Jul 2019 Jul 2019 15 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
blackenterprise.com blackenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Mar 2020 45 days
OX OX-539872073 Jan 2020 Mar 2020 45 days
OX OX-540553856 Jan 2020 Mar 2020 45 days
FWHL FWHL-897697 Jan 2020 Mar 2020 45 days
YIMO YIMO-2073946213921227802 Jan 2020 Mar 2020 45 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
RUB RUB-18110 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
bnext.com.tw bnext.com.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 290 days
LIJI LIJI-230297 Jul 2019 Apr 2020 290 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 290 days
OX OX-540553856 Jul 2019 Mar 2020 256 days
PUBM PUBM-158039 Jul 2019 Mar 2020 256 days
SVRN SVRN-230297 Jul 2019 Mar 2020 256 days
IEX IEX-186266 Aug 2019 Mar 2020 205 days
LOOP LOOP-5918 Aug 2019 Mar 2020 205 days
SCLP SCLP-6793 Jul 2019 Nov 2019 150 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 140 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
coastguardnews.com coastguardnews.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 97 days
YIMO YIMO-2073946213921227802 Mar 2020 Jun 2021 1 year, 97 days
RUB RUB-18110 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 21 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
ggwp.id ggwp.id
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
YUME YUME-102973855 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
grid.id grid.id
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Aug 2019 Mar 2020 224 days
FWHL FWHL-897697 Aug 2019 Feb 2020 190 days
YIMO YIMO-2073946213921227802 Aug 2019 Feb 2020 190 days
LOOP LOOP-5918 Aug 2019 Feb 2020 178 days
YUME YUME-102973855 Aug 2019 Oct 2019 60 days
RUB RUB-18110 Aug 2019 Oct 2019 48 days
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
jagranjosh.com jagranjosh.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 231 days
RUB RUB-18110 Aug 2019 Mar 2020 215 days
SCLP SCLP-390 Aug 2019 Feb 2020 180 days
OX OX-539872073 Aug 2019 Feb 2020 180 days
OX OX-540553856 Jul 2019 Dec 2019 169 days
LOOP LOOP-5918 Aug 2019 Dec 2019 118 days
SVRN SVRN-230297 Jul 2019 Oct 2019 105 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Dec 2019 Dec 2019 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
khaosod.co.th khaosod.co.th
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Mar 2020 96 days
SCLP SCLP-390 Dec 2019 Mar 2020 96 days
FWHL FWHL-897697 Dec 2019 Mar 2020 96 days
LOOP LOOP-5918 Dec 2019 Mar 2020 96 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 96 days
SVRN SVRN-230297 Dec 2019 Feb 2020 61 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 32 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
kidlingtonyouthfc.co.uk kidlingtonyouthfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Dec 2019 Mar 2020 96 days
SCLP SCLP-390 Dec 2019 Mar 2020 96 days
SCLP SCLP-6793 Dec 2019 Mar 2020 96 days
IEX IEX-186266 Dec 2019 Feb 2020 61 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 32 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
majalahpama.my majalahpama.my
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Mar 2020 270 days
FWHL FWHL-897697 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
IEX IEX-186779 Jul 2019 Mar 2020 270 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Mar 2020 270 days
RUB RUB-18110 Aug 2019 Mar 2020 219 days
OX OX-539872073 Oct 2019 Mar 2020 159 days
SCLP SCLP-6793 Jul 2019 Oct 2019 111 days
IEX IEX-186266 Aug 2019 Oct 2019 60 days
recipepair.com recipepair.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 269 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 269 days
FWHL FWHL-897697 Jul 2019 Feb 2020 234 days
OX OX-540553856 Jul 2019 Feb 2020 234 days
SCLP SCLP-6793 Jul 2019 Feb 2020 234 days
LOOP LOOP-5918 Aug 2019 Apr 2020 225 days
RUB RUB-18110 Aug 2019 Feb 2020 190 days
SCLP SCLP-390 Aug 2019 Feb 2020 190 days
YUME YUME-102973855 Aug 2019 Jan 2020 128 days
IEX IEX-186779 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
repeat.tw repeat.tw
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Feb 2020 241 days
RUB RUB-18110 Aug 2019 Apr 2020 225 days
FWHL FWHL-897697 Jul 2019 Jan 2020 188 days
SVRN SVRN-230297 Jul 2019 Jan 2020 188 days
LIJI LIJI-230297 Jul 2019 Jan 2020 188 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 188 days
YUME YUME-102973855 Jul 2019 Jan 2020 181 days
PUBM PUBM-158039 Jul 2019 Oct 2019 122 days
LOOP LOOP-5918 Aug 2019 Aug 2019 8 days
IEX IEX-186779 Jul 2019 Jul 2019 7 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
rossingtonmainfc.co.uk rossingtonmainfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Feb 2020 53 days
LOOP LOOP-5918 Jan 2020 Feb 2020 53 days
OX OX-540553856 Jan 2020 Feb 2020 53 days
SCLP SCLP-390 Jan 2020 Feb 2020 53 days
RUB RUB-18110 Jan 2020 Feb 2020 53 days
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
baomoi.com baomoi.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 347 days
LOOP LOOP-S-2411 Jul 2019 Apr 2021 1 year, 287 days
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SCLP SCLP-6793 Mar 2020 Dec 2020 283 days
LOOP LOOP-5918 Aug 2019 Mar 2020 204 days
YUME YUME-102973855 Sep 2019 Mar 2020 172 days
CA CA-PUB-1738284215641521 Mar 2019 Jun 2019 95 days
FWHL FWHL-897697 Jul 2019 Sep 2019 83 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
vitalegria.com vitalegria.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 10 days
OX OX-540099026 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
welcomehomeblog.com welcomehomeblog.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
zambsroyale.com zambsroyale.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 283 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 283 days
LOOP LOOP-5918 Aug 2019 Apr 2020 232 days
SCLP SCLP-390 Aug 2019 Apr 2020 232 days
OX OX-540553856 Jul 2019 Mar 2020 230 days
IEX IEX-186266 Nov 2019 Apr 2020 144 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 55 days
PUBM PUBM-158039 Jul 2019 Sep 2019 55 days
YUME YUME-102973855 Jul 2019 Sep 2019 55 days
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
evinyolu.net evinyolu.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Apr 2020 196 days
PUBM PUBM-158039 Oct 2019 Apr 2020 196 days
YUME YUME-102973855 Oct 2019 Apr 2020 196 days
RUB RUB-18110 Oct 2019 Apr 2020 196 days
SVRN SVRN-230297 Oct 2019 Apr 2020 196 days
LIJI LIJI-230297 Oct 2019 Apr 2020 196 days
YIMO YIMO-2073946213921227802 Oct 2019 Apr 2020 196 days
LOOP LOOP-5918 Oct 2019 Mar 2020 166 days
SCLP SCLP-6793 Dec 2019 Apr 2020 132 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 65 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
foodnext.net foodnext.net
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Jun 2021 1 year, 120 days
YUME YUME-102973855 Feb 2020 Jun 2021 1 year, 120 days
SVRN SVRN-230297 Feb 2020 Jun 2021 1 year, 120 days
LIJI LIJI-230297 Feb 2020 Jun 2021 1 year, 120 days
YIMO YIMO-2073946213921227802 Feb 2020 Jun 2021 1 year, 120 days
IEX IEX-186779 Mar 2020 Jun 2021 1 year, 85 days
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 25 days
SCLP SCLP-390 Mar 2020 Apr 2021 1 year, 25 days
SCLP SCLP-6793 Feb 2020 Dec 2020 311 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
horrorfreaknews.com horrorfreaknews.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Feb 2020 230 days
OX OX-539872073 Aug 2019 Feb 2020 179 days
IEX IEX-186266 Aug 2019 Feb 2020 179 days
RUB RUB-18110 Aug 2019 Feb 2020 179 days
SCLP SCLP-390 Aug 2019 Feb 2020 179 days
FWHL FWHL-897697 Oct 2019 Feb 2020 128 days
OX OX-540553856 Oct 2019 Feb 2020 128 days
YUME YUME-102973855 Oct 2019 Feb 2020 128 days
YIMO YIMO-2073946213921227802 Oct 2019 Feb 2020 128 days
SVRN SVRN-230297 Jul 2019 Oct 2019 102 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
iha.com.tr iha.com.tr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 230 days
PUBM PUBM-158039 Jul 2019 Mar 2020 230 days
YUME YUME-102973855 Jul 2019 Mar 2020 230 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 230 days
SCLP SCLP-6793 Sep 2019 Mar 2020 175 days
SVRN SVRN-230297 Jul 2019 Sep 2019 55 days
OX OX-540553856 Jul 2019 Sep 2019 55 days
IEX IEX-186266 Aug 2019 Sep 2019 24 days
LOOP LOOP-5918 Aug 2019 Sep 2019 24 days
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
inquilab.com inquilab.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Oct 2019 Mar 2020 162 days
RUB RUB-18110 Dec 2019 Mar 2020 98 days
OX OX-540553856 Dec 2019 Mar 2020 98 days
LOOP LOOP-S-2411 Oct 2019 Dec 2019 64 days
YIMO YIMO-2073946213921227802 Oct 2019 Dec 2019 64 days
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
khan.co.kr khan.co.kr
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Apr 2020 79 days
IEX IEX-186266 Jan 2020 Apr 2020 79 days
OX OX-540553856 Jan 2020 Apr 2020 79 days
PUBM PUBM-158039 Jan 2020 Apr 2020 79 days
YUME YUME-102973855 Jan 2020 Apr 2020 79 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
LOOP LOOP-5918 Jan 2020 Mar 2020 45 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
mensxp.com mensxp.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Sep 2019 Nov 2019 65 days
PUBM PUBM-158039 Sep 2019 Nov 2019 65 days
SVRN SVRN-230297 Sep 2019 Nov 2019 65 days
LIJI LIJI-230297 Sep 2019 Nov 2019 65 days
YIMO YIMO-2073946213921227802 Sep 2019 Nov 2019 65 days
LOOP LOOP-5918 Sep 2019 Nov 2019 65 days
IEX IEX-186779 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
momotrip.tw momotrip.tw
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 236 days
LOOP LOOP-5918 Aug 2019 Mar 2020 220 days
PUBM PUBM-158039 Jul 2019 Dec 2019 178 days
SVRN SVRN-230297 Jul 2019 Dec 2019 178 days
LIJI LIJI-230297 Jul 2019 Dec 2019 178 days
YUME YUME-102973855 Jul 2019 Dec 2019 178 days
FWHL FWHL-897697 Jul 2019 Oct 2019 113 days
IEX IEX-186779 Jul 2019 Aug 2019 51 days
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
olm.vn olm.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Feb 2020 238 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 238 days
LIJI LIJI-230297 Jul 2019 Feb 2020 238 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 238 days
PUBM PUBM-158039 Aug 2019 Feb 2020 183 days
IEX IEX-186779 Aug 2019 Feb 2020 183 days
YUME YUME-102973855 Aug 2019 Feb 2020 183 days
SCLP SCLP-6793 Aug 2019 Feb 2020 183 days
SVRN SVRN-230297 Jul 2019 Dec 2019 182 days
IEX IEX-186266 Aug 2019 Dec 2019 131 days
LOOP LOOP-5918 Aug 2019 Oct 2019 62 days
RUB RUB-18110 Dec 2019 Feb 2020 56 days
redhillfc.com redhillfc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 5 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
sukansinar.com sukansinar.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Sep 2019 53 days
FWHL FWHL-897697 Jul 2019 Sep 2019 53 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 53 days
PUBM PUBM-158039 Jul 2019 Sep 2019 53 days
YUME YUME-102973855 Jul 2019 Sep 2019 53 days
SVRN SVRN-230297 Jul 2019 Sep 2019 53 days
LIJI LIJI-230297 Jul 2019 Sep 2019 53 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 53 days
IEX IEX-186266 Aug 2019 Sep 2019 13 days
RUB RUB-18110 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
tfc.tv tfc.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Jul 2019 Apr 2020 265 days
SCLP SCLP-6793 Jul 2019 Apr 2020 265 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 265 days
LOOP LOOP-5918 Aug 2019 Apr 2020 234 days
OX OX-540553856 Nov 2019 Apr 2020 145 days
YUME YUME-102973855 Nov 2019 Apr 2020 145 days
LIJI LIJI-230297 Jul 2019 Nov 2019 120 days
OX OX-539872073 Jan 2020 Mar 2020 44 days
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
winscombeafc.co.uk winscombeafc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jan 2020 Mar 2020 47 days
RUB RUB-18110 Jan 2020 Mar 2020 47 days
OX OX-539872073 Jan 2020 Mar 2020 47 days
OX OX-540553856 Jan 2020 Mar 2020 47 days
IEX IEX-186266 Jan 2020 Mar 2020 47 days
IEX IEX-186779 Jan 2020 Mar 2020 47 days
SCLP SCLP-6793 Jan 2020 Mar 2020 47 days
OX OX-540099026 Feb 2020 Mar 2020 12 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
zmescience.com zmescience.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Nov 2019 120 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
IEX IEX-186266 Aug 2019 Nov 2019 89 days
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Nov 2019 Nov 2019 One Off
LOOP LOOP-5918 Nov 2019 Nov 2019 One Off
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
haroldwoodathleticfc.com haroldwoodathleticfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 28 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
kidsgroveathleticfc.com kidsgroveathleticfc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Dec 2019 Mar 2020 96 days
IEX IEX-186779 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
RUB RUB-18110 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
kilwinningrangers2004.com kilwinningrangers2004.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 32 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
liphookripsleycricketclub.com liphookripsleycricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 33 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
liputan6.com liputan6.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 269 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 269 days
PUBM PUBM-158039 Jul 2019 Feb 2020 234 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 234 days
SCLP SCLP-6793 Jul 2019 Feb 2020 234 days
LOOP LOOP-5918 Aug 2019 Mar 2020 218 days
IEX IEX-186266 Aug 2019 Mar 2020 218 days
SVRN SVRN-230297 Jul 2019 Dec 2019 175 days
SCLP SCLP-390 Aug 2019 Dec 2019 124 days
OX OX-540553856 Dec 2019 Mar 2020 94 days
RUB RUB-18110 Dec 2019 Feb 2020 59 days
oldemanuelrfc.co.uk oldemanuelrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 91 days
IEX IEX-186266 Dec 2019 Mar 2020 91 days
OX OX-540553856 Dec 2019 Mar 2020 91 days
SCLP SCLP-6793 Dec 2019 Mar 2020 91 days
OX OX-539872073 Dec 2019 Mar 2020 89 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
poki.by poki.by
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
prowrestling.com prowrestling.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Sep 2019 75 days
LIJI LIJI-230297 Jul 2019 Sep 2019 75 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 75 days
FWHL FWHL-897697 Jul 2019 Sep 2019 75 days
SCLP SCLP-6793 Jul 2019 Sep 2019 75 days
YUME YUME-102973855 Jul 2019 Sep 2019 56 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 56 days
IEX IEX-186266 Aug 2019 Sep 2019 24 days
RUB RUB-18110 Aug 2019 Sep 2019 24 days
SVRN SVRN-230297 Jul 2019 Jul 2019 19 days
OX OX-540553856 Jul 2019 Jul 2019 One Off
redruthalbanyrfc.co.uk redruthalbanyrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
aboluowang.com aboluowang.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Nov 2019 Apr 2020 150 days
FWHL FWHL-897697 Nov 2019 Apr 2020 150 days
SVRN SVRN-230297 Nov 2019 Apr 2020 142 days
PUBM PUBM-158039 Nov 2019 Jan 2020 65 days
SCLP SCLP-6793 Apr 2020 Apr 2020 8 days
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
abs-cbn.com abs-cbn.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Nov 2019 121 days
SCLP SCLP-6793 Jul 2019 Nov 2019 121 days
SVRN SVRN-230297 Jul 2019 Nov 2019 121 days
YIMO YIMO-2073946213921227802 Jul 2019 Nov 2019 121 days
IEX IEX-186779 Jul 2019 Nov 2019 121 days
OX OX-540553856 Jul 2019 Nov 2019 121 days
LOOP LOOP-S-2411 Jul 2019 Nov 2019 121 days
SCLP SCLP-390 Aug 2019 Nov 2019 89 days
PUBM PUBM-158039 Jul 2019 Sep 2019 56 days
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
rossendalerufc.com rossendalerufc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Feb 2020 53 days
OX OX-539872073 Jan 2020 Feb 2020 53 days
OX OX-540553856 Jan 2020 Feb 2020 53 days
PUBM PUBM-158039 Jan 2020 Feb 2020 53 days
SCLP SCLP-390 Jan 2020 Feb 2020 53 days
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
al-anni.com al-anni.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Sep 2019 Apr 2020 207 days
IEX IEX-186266 Sep 2019 Apr 2020 207 days
SCLP SCLP-390 Sep 2019 Mar 2020 173 days
LOOP LOOP-S-2411 Jan 2020 Apr 2020 76 days
LIJI LIJI-230297 Jan 2020 Apr 2020 76 days
SCLP SCLP-6793 Jan 2020 Apr 2020 76 days
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
smmsport.com smmsport.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 215 days
PUBM PUBM-158039 Sep 2019 Apr 2020 215 days
YUME YUME-102973855 Sep 2019 Apr 2020 215 days
SVRN SVRN-230297 Sep 2019 Apr 2020 215 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 215 days
LOOP LOOP-5918 Sep 2019 Feb 2020 180 days
LOOP LOOP-S-2411 Jan 2020 Apr 2020 86 days
SCLP SCLP-6793 Jan 2020 Feb 2020 51 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
aol-ii.com aol-ii.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Apr 2020 207 days
YIMO YIMO-2073946213921227802 Sep 2019 Apr 2020 207 days
FWHL FWHL-897697 Sep 2019 Apr 2020 207 days
LOOP LOOP-5918 Sep 2019 Apr 2020 207 days
SVRN SVRN-230297 Sep 2019 Apr 2020 207 days
PUBM PUBM-158039 Sep 2019 Mar 2020 173 days
OX OX-539872073 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
southernlionsrufc.com southernlionsrufc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 7 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
vdaily.news vdaily.news
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
clickanitta.com clickanitta.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Apr 2020 137 days
SVRN SVRN-230297 Dec 2019 Apr 2020 137 days
FWHL FWHL-897697 Dec 2019 Apr 2020 137 days
YIMO YIMO-2073946213921227802 Dec 2019 Apr 2020 137 days
RUB RUB-18110 Feb 2020 Apr 2020 71 days
LIJI LIJI-230297 Dec 2019 Feb 2020 66 days
LOOP LOOP-5918 Mar 2020 Apr 2020 33 days
IEX IEX-186266 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
cnnphilippines.com cnnphilippines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 257 days
OX OX-540553856 Jul 2019 Mar 2020 257 days
SVRN SVRN-230297 Jul 2019 Mar 2020 257 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 257 days
SCLP SCLP-6793 Jul 2019 Mar 2020 227 days
LIJI LIJI-230297 Jul 2019 Feb 2020 219 days
LOOP LOOP-5918 Aug 2019 Mar 2020 206 days
IEX IEX-186266 Aug 2019 Mar 2020 206 days
YUME YUME-102973855 Jul 2019 Feb 2020 189 days
SCLP SCLP-390 Aug 2019 Sep 2019 37 days
PUBM PUBM-158039 Jul 2019 Jul 2019 30 days
firefightingnews.com firefightingnews.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 21 days
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
gnav.top gnav.top
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Oct 2019 60 days
PUBM PUBM-158039 Aug 2019 Oct 2019 60 days
YUME YUME-102973855 Aug 2019 Oct 2019 60 days
SVRN SVRN-230297 Aug 2019 Oct 2019 60 days
LIJI LIJI-230297 Aug 2019 Oct 2019 60 days
YIMO YIMO-2073946213921227802 Aug 2019 Oct 2019 60 days
LOOP LOOP-5918 Aug 2019 Oct 2019 48 days
IEX IEX-186779 Aug 2019 Aug 2019 One Off
IEX IEX-186266 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
herzindagi.com herzindagi.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Dec 2019 125 days
YIMO YIMO-2073946213921227802 Aug 2019 Dec 2019 125 days
FWHL FWHL-897697 Oct 2019 Dec 2019 64 days
LOOP LOOP-S-2411 Oct 2019 Dec 2019 64 days
RUB RUB-18110 Aug 2019 Oct 2019 50 days
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Oct 2019 Oct 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
jbdailyphotos.com jbdailyphotos.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Mar 2020 97 days
RUB RUB-18110 Dec 2019 Mar 2020 97 days
FWHL FWHL-897697 Dec 2019 Mar 2020 97 days
LIJI LIJI-230297 Dec 2019 Mar 2020 97 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 97 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 34 days
IEX IEX-186779 Dec 2019 Dec 2019 One Off
OX OX-539872073 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
kolambil.com kolambil.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Dec 2019 126 days
LOOP LOOP-S-2411 Aug 2019 Dec 2019 126 days
PUBM PUBM-158039 Aug 2019 Dec 2019 126 days
YUME YUME-102973855 Aug 2019 Dec 2019 126 days
SVRN SVRN-230297 Aug 2019 Dec 2019 126 days
LIJI LIJI-230297 Aug 2019 Dec 2019 126 days
YIMO YIMO-2073946213921227802 Aug 2019 Dec 2019 126 days
RUB RUB-18110 Aug 2019 Dec 2019 121 days
SCLP SCLP-390 Aug 2019 Dec 2019 121 days
IEX IEX-186779 Aug 2019 Aug 2019 One Off
IEX IEX-186266 Dec 2019 Dec 2019 One Off
ksk.tw ksk.tw
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Dec 2019 126 days
LIJI LIJI-230297 Aug 2019 Dec 2019 126 days
YIMO YIMO-2073946213921227802 Aug 2019 Dec 2019 126 days
FWHL FWHL-897697 Oct 2019 Dec 2019 65 days
OX OX-540553856 Aug 2019 Aug 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
pargolf.my pargolf.my
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Mar 2020 90 days
OX OX-540553856 Jan 2020 Mar 2020 90 days
PUBM PUBM-158039 Jan 2020 Mar 2020 90 days
YUME YUME-102973855 Jan 2020 Mar 2020 90 days
YIMO YIMO-2073946213921227802 Jan 2020 Mar 2020 90 days
OX OX-540099026 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
popularmilitary.com popularmilitary.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 21 days
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
projekmm.com projekmm.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Oct 2019 Apr 2020 154 days
PUBM PUBM-158039 Oct 2019 Apr 2020 154 days
YUME YUME-102973855 Oct 2019 Apr 2020 154 days
YIMO YIMO-2073946213921227802 Oct 2019 Apr 2020 154 days
SCLP SCLP-390 Oct 2019 Feb 2020 119 days
SVRN SVRN-230297 Oct 2019 Feb 2020 119 days
SCLP SCLP-6793 Jan 2020 Apr 2020 89 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 35 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
ravensyouthfc.co.uk ravensyouthfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 May 2020 133 days
PUBM PUBM-158039 Jan 2020 May 2020 133 days
SCLP SCLP-6793 Jan 2020 Apr 2020 89 days
LOOP LOOP-S-2411 Apr 2020 May 2020 44 days
OX OX-540099026 Apr 2020 May 2020 44 days
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 May 2020 May 2020 One Off
RUB RUB-18110 May 2020 May 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
aphoneweb.com aphoneweb.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
southparkrangersfc.co.uk southparkrangersfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 85 days
SCLP SCLP-6793 Jan 2020 Apr 2020 85 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
OX OX-540099026 Feb 2020 Mar 2020 8 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
barbara-palvin.com barbara-palvin.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 75 days
FWHL FWHL-897697 Jan 2020 Apr 2020 75 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 75 days
SCLP SCLP-6793 Jan 2020 Mar 2020 41 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
cavemancircus.com cavemancircus.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
SCLP SCLP-390 Aug 2019 Mar 2020 199 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
YIMO YIMO-2073946213921227802 Jan 2020 Jan 2020 One Off
dreadcentral.com dreadcentral.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Dec 2019 Mar 2020 103 days
OX OX-540553856 Dec 2019 Feb 2020 67 days
SCLP SCLP-6793 Dec 2019 Feb 2020 67 days
LIJI LIJI-230297 Feb 2020 Mar 2020 36 days
FWHL FWHL-897697 Feb 2020 Mar 2020 36 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 36 days
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
egmeadsfc.co.uk egmeadsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 May 2020 88 days
OX OX-540099026 Feb 2020 May 2020 76 days
IEX IEX-186779 May 2020 May 2020 One Off
LOOP LOOP-5918 May 2020 May 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
OX OX-540553856 May 2020 May 2020 One Off
PUBM PUBM-158039 May 2020 May 2020 One Off
RUB RUB-18110 May 2020 May 2020 One Off
SCLP SCLP-390 May 2020 May 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
FWHL FWHL-897697 May 2020 May 2020 One Off
ekonomirakyat.com.my ekonomirakyat.com.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2020 Jun 2021 263 days
IEX IEX-186779 Sep 2020 Jun 2021 263 days
PUBM PUBM-158039 Sep 2020 Jun 2021 263 days
YUME YUME-102973855 Sep 2020 Jun 2021 263 days
RUB RUB-18110 Sep 2020 Jun 2021 263 days
SCLP SCLP-6426 Sep 2020 Jun 2021 263 days
SVRN SVRN-230297 Sep 2020 Jun 2021 263 days
LIJI LIJI-230297 Sep 2020 Jun 2021 263 days
YIMO YIMO-2073946213921227802 Sep 2020 Jun 2021 263 days
LOOP LOOP-S-2411 Sep 2020 Apr 2021 203 days
LOOP LOOP-5918 May 2021 Jun 2021 38 days
freebrushs.com freebrushs.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
harlestontownfc.com harlestontownfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
kinhtedothi.vn kinhtedothi.vn
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
kontan.co.id kontan.co.id
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 230 days
SVRN SVRN-230297 Jul 2019 Mar 2020 230 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 230 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 185 days
FWHL FWHL-897697 Nov 2019 Mar 2020 110 days
SCLP SCLP-390 Nov 2019 Mar 2020 110 days
PUBM PUBM-158039 Jul 2019 Sep 2019 55 days
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
ksubtv.co ksubtv.co
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Dec 2019 Mar 2020 95 days
SVRN SVRN-230297 Dec 2019 Mar 2020 95 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 95 days
FWHL FWHL-897697 Dec 2019 Feb 2020 60 days
YUME YUME-102973855 Dec 2019 Feb 2020 60 days
LIJI LIJI-230297 Dec 2019 Feb 2020 60 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
IEX IEX-186779 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
netnews.vn netnews.vn
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Dec 2019 Mar 2020 92 days
LIJI LIJI-230297 Dec 2019 Mar 2020 92 days
FWHL FWHL-897697 Dec 2019 Mar 2020 92 days
LOOP LOOP-5918 Dec 2019 Mar 2020 92 days
YUME YUME-102973855 Dec 2019 Mar 2020 92 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 92 days
OX OX-540553856 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
ngoisao.vn ngoisao.vn
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
SCLP SCLP-390 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
LIJI LIJI-230297 Jul 2019 Sep 2019 75 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 75 days
YUME YUME-102973855 Jul 2019 Sep 2019 55 days
RUB RUB-18110 Aug 2019 Sep 2019 24 days
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
paghamfootballclub.co.uk paghamfootballclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Mar 2020 90 days
LOOP LOOP-S-2411 Jan 2020 Feb 2020 55 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 32 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
prsekolah.web.id prsekolah.web.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Aug 2019 51 days
IEX IEX-186779 Jul 2019 Aug 2019 51 days
LOOP LOOP-S-2411 Jul 2019 Aug 2019 51 days
PUBM PUBM-158039 Jul 2019 Aug 2019 51 days
YUME YUME-102973855 Jul 2019 Aug 2019 51 days
SVRN SVRN-230297 Jul 2019 Aug 2019 51 days
LIJI LIJI-230297 Jul 2019 Aug 2019 51 days
YIMO YIMO-2073946213921227802 Jul 2019 Aug 2019 51 days
OX OX-540553856 Aug 2019 Aug 2019 One Off
RUB RUB-18110 Aug 2019 Aug 2019 One Off
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
nciscbs.com nciscbs.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Oct 2019 Mar 2020 157 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 157 days
PUBM PUBM-158039 Oct 2019 Mar 2020 157 days
SVRN SVRN-230297 Oct 2019 Mar 2020 157 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 157 days
LIJI LIJI-230297 Oct 2019 Feb 2020 122 days
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
slant.co slant.co
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 28 days
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
tiin.vn tiin.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 144 days
LOOP LOOP-S-2411 Nov 2019 Apr 2020 144 days
YUME YUME-102973855 Nov 2019 Apr 2020 144 days
SCLP SCLP-390 Nov 2019 Apr 2020 144 days
SVRN SVRN-230297 Nov 2019 Apr 2020 144 days
LIJI LIJI-230297 Nov 2019 Apr 2020 144 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 144 days
IEX IEX-186266 Nov 2019 Mar 2020 110 days
PUBM PUBM-158039 Nov 2019 Jan 2020 65 days
RUB RUB-18110 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
belpertownfc.co.uk belpertownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Apr 2020 74 days
OX OX-540553856 Feb 2020 Apr 2020 74 days
SCLP SCLP-6793 Feb 2020 Apr 2020 74 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
belstonefc.com belstonefc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Apr 2020 74 days
OX OX-540553856 Feb 2020 Apr 2020 74 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 18 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
upliftingtoday.com upliftingtoday.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Apr 2020 266 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 266 days
OX OX-540553856 Jul 2019 Mar 2020 232 days
FWHL FWHL-897697 Nov 2019 Apr 2020 148 days
OX OX-539872073 Nov 2019 Mar 2020 138 days
SVRN SVRN-230297 Jul 2019 Nov 2019 118 days
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
willow.tv willow.tv
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Nov 2019 Mar 2020 110 days
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
OX OX-540553856 Nov 2019 Mar 2020 110 days
FWHL FWHL-897697 Nov 2019 Mar 2020 110 days
YIMO YIMO-2073946213921227802 Nov 2019 Mar 2020 110 days
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
epicstream.com epicstream.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 261 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 261 days
IEX IEX-186266 Aug 2019 Feb 2020 174 days
RUB RUB-18110 Aug 2019 Feb 2020 174 days
PUBM PUBM-158039 Jul 2019 Dec 2019 159 days
SVRN SVRN-230297 Jul 2019 Dec 2019 159 days
LIJI LIJI-230297 Jul 2019 Oct 2019 94 days
IEX IEX-186779 Jul 2019 Aug 2019 35 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
feq4k.com feq4k.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
fohc.co.uk fohc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
healthprep.com healthprep.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Feb 2020 Jun 2020 113 days
FWHL FWHL-897697 Feb 2020 Jun 2020 113 days
SCLP SCLP-390 Mar 2020 Jun 2020 78 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
IEX IEX-186779 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
OX OX-540099026 Jun 2020 Jun 2020 One Off
YIMO YIMO-2073946213921227802 Jun 2020 Jun 2020 One Off
hemat.id hemat.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Oct 2019 101 days
PUBM PUBM-158039 Jul 2019 Oct 2019 101 days
YUME YUME-102973855 Jul 2019 Oct 2019 101 days
SVRN SVRN-230297 Jul 2019 Oct 2019 101 days
LIJI LIJI-230297 Jul 2019 Oct 2019 101 days
YIMO YIMO-2073946213921227802 Jul 2019 Oct 2019 101 days
LOOP LOOP-5918 Aug 2019 Oct 2019 50 days
IEX IEX-186266 Aug 2019 Oct 2019 50 days
OX OX-540553856 Jul 2019 Aug 2019 40 days
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
jawapos.com jawapos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 266 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 266 days
YUME YUME-102973855 Jul 2019 Feb 2020 231 days
SVRN SVRN-230297 Jul 2019 Feb 2020 231 days
RUB RUB-18110 Aug 2019 Mar 2020 215 days
SCLP SCLP-390 Aug 2019 Mar 2020 215 days
LOOP LOOP-5918 Aug 2019 Mar 2020 215 days
LOOP LOOP-S-2411 Jul 2019 Dec 2019 169 days
IEX IEX-186266 Aug 2019 Dec 2019 118 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
liarfc.co.uk liarfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 2 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
lionfun.tw lionfun.tw
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Mar 2020 269 days
IEX IEX-186779 Jul 2019 Feb 2020 234 days
SVRN SVRN-230297 Jul 2019 Feb 2020 234 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 234 days
SCLP SCLP-390 Aug 2019 Mar 2020 218 days
FWHL FWHL-897697 Jul 2019 Dec 2019 175 days
LIJI LIJI-230297 Jul 2019 Dec 2019 175 days
LOOP LOOP-S-2411 Aug 2019 Dec 2019 127 days
YUME YUME-102973855 Jul 2019 Oct 2019 110 days
RUB RUB-18110 Aug 2019 Oct 2019 59 days
IEX IEX-186266 Oct 2019 Oct 2019 One Off
oldedsfc.com oldedsfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Mar 2020 91 days
PUBM PUBM-158039 Dec 2019 Mar 2020 91 days
SCLP SCLP-6793 Dec 2019 Mar 2020 91 days
SCLP SCLP-390 Dec 2019 Mar 2020 91 days
OX OX-539872073 Dec 2019 Mar 2020 89 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
oldwalcountiansrfc.com oldwalcountiansrfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Dec 2019 Mar 2020 91 days
LOOP LOOP-5918 Dec 2019 Mar 2020 91 days
SCLP SCLP-6793 Dec 2019 Mar 2020 91 days
SCLP SCLP-390 Dec 2019 Mar 2020 91 days
RUB RUB-18110 Dec 2019 Mar 2020 91 days
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
pewpewboy.com pewpewboy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 269 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 269 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 234 days
SVRN SVRN-230297 Aug 2019 Mar 2020 218 days
YUME YUME-102973855 Jul 2019 Jan 2020 179 days
OX OX-540099026 Feb 2020 Mar 2020 38 days
SCLP SCLP-6426 Mar 2020 Mar 2020 3 days
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
stanwayroversfc.co.uk stanwayroversfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
swagly.net swagly.net
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 35 days
OX OX-539872073 Mar 2020 Mar 2020 27 days
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
teambrg.com teambrg.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Jan 2020 Jun 2021 1 year, 152 days
FWHL FWHL-897697 Jan 2020 Apr 2020 84 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 84 days
OX OX-539872073 Jan 2020 Mar 2020 76 days
SVRN SVRN-230297 Jul 2019 Jul 2019 12 days
SCLP SCLP-6426 Mar 2020 Apr 2020 8 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
twickenhamcc.net twickenhamcc.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Apr 2020 83 days
SCLP SCLP-6793 Jan 2020 Apr 2020 83 days
OX OX-539872073 Jan 2020 Mar 2020 74 days
OX OX-540099026 Feb 2020 Apr 2020 44 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
unpuzzlefinance.com unpuzzlefinance.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Nov 2019 Jul 2020 233 days
YUME YUME-102973855 Jan 2020 Jul 2020 168 days
SCLP SCLP-390 Mar 2020 Jul 2020 120 days
SCLP SCLP-6793 Nov 2019 Jan 2020 65 days
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Jul 2020 Jul 2020 One Off
IEX IEX-186779 Jul 2020 Jul 2020 One Off
FWHL FWHL-897697 Jul 2020 Jul 2020 One Off
OX OX-540099026 Jul 2020 Jul 2020 One Off
yzc122.com yzc122.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
zombsroyale.io zombsroyale.io
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 145 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 145 days
SVRN SVRN-230297 Nov 2019 Mar 2020 111 days
OX OX-540553856 Jan 2020 Apr 2020 80 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
OX OX-539872073 Nov 2019 Nov 2019 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
decibo.com decibo.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Feb 2020 Mar 2020 37 days
PUBM PUBM-158039 Feb 2020 Mar 2020 37 days
FWHL FWHL-897697 Feb 2020 Mar 2020 37 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 37 days
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
handlebay.com handlebay.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
haveanice.com haveanice.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
IEX IEX-186779 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
OX OX-540553856 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
hcrufc.com hcrufc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
hokiyu.tw hokiyu.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 264 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 264 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 264 days
SVRN SVRN-230297 Jul 2019 Oct 2019 102 days
LIJI LIJI-230297 Jul 2019 Oct 2019 102 days
RUB RUB-18110 Aug 2019 Oct 2019 51 days
OX OX-539872073 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
jessalba.net jessalba.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
lowerbreckfc.co.uk lowerbreckfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Dec 2019 Mar 2020 95 days
OX OX-540553856 Dec 2019 Mar 2020 95 days
SCLP SCLP-390 Dec 2019 Mar 2020 95 days
SCLP SCLP-6793 Dec 2019 Mar 2020 95 days
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
mrmad.com.tw mrmad.com.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2020 Nov 2020 63 days
IEX IEX-186779 Sep 2020 Nov 2020 63 days
PUBM PUBM-158039 Sep 2020 Nov 2020 63 days
YUME YUME-102973855 Sep 2020 Nov 2020 63 days
SCLP SCLP-6793 Sep 2020 Nov 2020 63 days
SVRN SVRN-230297 Sep 2020 Nov 2020 63 days
LIJI LIJI-230297 Sep 2020 Nov 2020 63 days
YIMO YIMO-2073946213921227802 Sep 2020 Nov 2020 63 days
LOOP LOOP-S-2411 Sep 2020 Sep 2020 One Off
LOOP LOOP-5918 Nov 2020 Nov 2020 One Off
oneloveunitedfc.com oneloveunitedfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Dec 2019 Mar 2020 90 days
LOOP LOOP-5918 Dec 2019 Mar 2020 90 days
SCLP SCLP-6793 Dec 2019 Mar 2020 90 days
FWHL FWHL-897697 Dec 2019 Feb 2020 55 days
IEX IEX-186779 Dec 2019 Feb 2020 55 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
OX OX-539872073 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
pandit.id pandit.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Aug 2019 52 days
LOOP LOOP-S-2411 Jul 2019 Aug 2019 52 days
PUBM PUBM-158039 Jul 2019 Aug 2019 52 days
YUME YUME-102973855 Jul 2019 Aug 2019 52 days
SVRN SVRN-230297 Jul 2019 Aug 2019 52 days
LIJI LIJI-230297 Jul 2019 Aug 2019 52 days
YIMO YIMO-2073946213921227802 Jul 2019 Aug 2019 52 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
IEX IEX-186266 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
pixlr.com pixlr.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
racingweb.net racingweb.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2020 Jul 2020 One Off
FWHL FWHL-897697 Jul 2020 Jul 2020 One Off
OX OX-540553856 Jul 2020 Jul 2020 One Off
IEX IEX-186779 Jul 2020 Jul 2020 One Off
SVRN SVRN-230297 Jul 2020 Jul 2020 One Off
LIJI LIJI-230297 Jul 2020 Jul 2020 One Off
YIMO YIMO-2073946213921227802 Jul 2020 Jul 2020 One Off
YUME YUME-102973855 Jul 2020 Jul 2020 One Off
LOOP LOOP-5918 Jul 2020 Jul 2020 One Off
SCLP SCLP-390 Jul 2020 Jul 2020 One Off
saucyrecipes.com saucyrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Jun 2020 118 days
RUB RUB-18110 Feb 2020 Jun 2020 118 days
LOOP LOOP-5918 Feb 2020 Jun 2020 118 days
IEX IEX-186266 Apr 2020 Jun 2020 83 days
OX OX-540099026 Apr 2020 Jun 2020 83 days
OX OX-540553856 Apr 2020 Jun 2020 83 days
IEX IEX-186779 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Jun 2020 Jun 2020 One Off
tcincubator.com sharing.tcincubator.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2020 Sep 2020 One Off
IEX IEX-186779 Sep 2020 Sep 2020 One Off
LOOP LOOP-S-2411 Sep 2020 Sep 2020 One Off
PUBM PUBM-158039 Sep 2020 Sep 2020 One Off
YUME YUME-102973855 Sep 2020 Sep 2020 One Off
RUB RUB-18110 Sep 2020 Sep 2020 One Off
SCLP SCLP-390 Sep 2020 Sep 2020 One Off
SVRN SVRN-230297 Sep 2020 Sep 2020 One Off
LIJI LIJI-230297 Sep 2020 Sep 2020 One Off
YIMO YIMO-2073946213921227802 Sep 2020 Sep 2020 One Off
sujfc.com sujfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 85 days
SCLP SCLP-6793 Jan 2020 Apr 2020 85 days
OX OX-540099026 Feb 2020 Apr 2020 43 days
OX OX-540553856 Mar 2020 Apr 2020 35 days
OX OX-539872073 Mar 2020 Mar 2020 27 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
tsarizm.com tsarizm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Apr 2020 83 days
LOOP LOOP-5918 Jan 2020 Mar 2020 49 days
SCLP SCLP-390 Jan 2020 Mar 2020 49 days
OX OX-540099026 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
wallingfordtownafc.com wallingfordtownafc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Mar 2020 48 days
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
walsallwoodfc.com walsallwoodfc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Jan 2020 Mar 2020 48 days
SCLP SCLP-6793 Jan 2020 Mar 2020 48 days
RUB RUB-18110 Jan 2020 Mar 2020 48 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
braintreehc.co.uk braintreehc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 40 days
SCLP SCLP-6793 Feb 2020 Mar 2020 40 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
windleshamutdfc.co.uk windleshamutdfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Mar 2020 47 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
olm.vn chat.olm.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2020 Sep 2020 One Off
IEX IEX-186779 Sep 2020 Sep 2020 One Off
LOOP LOOP-5918 Sep 2020 Sep 2020 One Off
PUBM PUBM-158039 Sep 2020 Sep 2020 One Off
YUME YUME-102973855 Sep 2020 Sep 2020 One Off
RUB RUB-18110 Sep 2020 Sep 2020 One Off
SCLP SCLP-390 Sep 2020 Sep 2020 One Off
SVRN SVRN-230297 Sep 2020 Sep 2020 One Off
LIJI LIJI-230297 Sep 2020 Sep 2020 One Off
YIMO YIMO-2073946213921227802 Sep 2020 Sep 2020 One Off
chicksonright.com chicksonright.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Mar 2020 169 days
FWHL FWHL-897697 Sep 2019 Mar 2020 169 days
LOOP LOOP-5918 Sep 2019 Mar 2020 169 days
YIMO YIMO-2073946213921227802 Sep 2019 Mar 2020 169 days
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
dooserieshd.com dooserieshd.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Feb 2020 190 days
YUME YUME-102973855 Aug 2019 Feb 2020 190 days
SVRN SVRN-230297 Aug 2019 Feb 2020 190 days
LIJI LIJI-230297 Aug 2019 Feb 2020 190 days
YIMO YIMO-2073946213921227802 Aug 2019 Feb 2020 190 days
RUB RUB-18110 Aug 2019 Feb 2020 172 days
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
IEX IEX-186779 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
garforthvillajfc.co.uk garforthvillajfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
girlsaskguys.com girlsaskguys.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
harworthcollieryfc.co.uk harworthcollieryfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
kapanlagi.com kapanlagi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 250 days
LOOP LOOP-S-2411 Jul 2019 Mar 2020 230 days
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
SCLP SCLP-390 Sep 2019 Mar 2020 175 days
LOOP LOOP-5918 Aug 2019 Nov 2019 89 days
PUBM PUBM-158039 Jul 2019 Sep 2019 75 days
YUME YUME-102973855 Jan 2020 Mar 2020 45 days
kingstontownfc.com kingstontownfc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
olsmj.com olsmj.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Dec 2019 Mar 2020 91 days
OX OX-540553856 Dec 2019 Mar 2020 91 days
SCLP SCLP-6793 Dec 2019 Mar 2020 91 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
SCLP SCLP-6426 Mar 2020 Mar 2020 2 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
armorgames.com armorgames.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Nov 2019 140 days
SVRN SVRN-230297 Jul 2019 Nov 2019 140 days
LIJI LIJI-230297 Jul 2019 Nov 2019 140 days
IEX IEX-186779 Jul 2019 Nov 2019 140 days
FWHL FWHL-897697 Jul 2019 Nov 2019 140 days
YIMO YIMO-2073946213921227802 Jul 2019 Nov 2019 140 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
IEX IEX-186266 Aug 2019 Nov 2019 89 days
SCLP SCLP-390 Aug 2019 Nov 2019 89 days
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
1001oyun.com 1001oyun.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Apr 2020 42 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 42 days
OX OX-540553856 Apr 2020 Apr 2020 8 days
LOOP LOOP-S-2411 Apr 2020 Apr 2020 8 days
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
baanlaesuan.com baanlaesuan.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 May 2020 May 2020 One Off
OX OX-540553856 May 2020 May 2020 One Off
YUME YUME-102973855 May 2020 May 2020 One Off
IEX IEX-186779 May 2020 May 2020 One Off
RUB RUB-18110 May 2020 May 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
SCLP SCLP-6793 May 2020 May 2020 One Off
SVRN SVRN-230297 May 2020 May 2020 One Off
LIJI LIJI-230297 May 2020 May 2020 One Off
YIMO YIMO-2073946213921227802 May 2020 May 2020 One Off
barntgreencc.com barntgreencc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
usfmensrugby.org usfmensrugby.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 83 days
OX OX-540553856 Jan 2020 Apr 2020 83 days
IEX IEX-186266 Jan 2020 Mar 2020 49 days
LOOP LOOP-5918 Jan 2020 Mar 2020 49 days
SCLP SCLP-6793 Jan 2020 Mar 2020 49 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
usmclife.com usmclife.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
workingtonrfc.co.uk workingtonrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
xboxclips.co xboxclips.co
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Apr 2020 35 days
PUBM PUBM-158039 Mar 2020 Apr 2020 35 days
FWHL FWHL-897697 Mar 2020 Apr 2020 35 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 35 days
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
crazyppt.com crazyppt.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Jun 2021 1 year, 127 days
RUB RUB-18110 Mar 2020 Jun 2021 1 year, 89 days
SCLP SCLP-6793 Mar 2020 Dec 2020 280 days
IEX IEX-186266 Feb 2020 Mar 2020 38 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 38 days
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
immay.tw immay.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 265 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 265 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 231 days
LIJI LIJI-230297 Jul 2019 Feb 2020 231 days
RUB RUB-18110 Aug 2019 Mar 2020 214 days
PUBM PUBM-158039 Jul 2019 Oct 2019 103 days
SVRN SVRN-230297 Jul 2019 Oct 2019 103 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
keresleyrfc.co.uk keresleyrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Mar 2020 96 days
LOOP LOOP-5918 Dec 2019 Feb 2020 61 days
IEX IEX-186779 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
littlehamptonunitedfc.co.uk littlehamptonunitedfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
movietvtechgeeks.com movietvtechgeeks.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 265 days
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
RUB RUB-18110 Aug 2019 Apr 2020 233 days
IEX IEX-186779 Jul 2019 Mar 2020 231 days
SCLP SCLP-6793 Jul 2019 Mar 2020 231 days
IEX IEX-186266 Sep 2019 Apr 2020 209 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
muaythaiauthority.com muaythaiauthority.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 270 days
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
SCLP SCLP-6793 Aug 2019 Feb 2020 184 days
IEX IEX-186266 Oct 2019 Mar 2020 157 days
IEX IEX-186779 Jul 2019 Aug 2019 51 days
OX OX-540099026 Feb 2020 Mar 2020 35 days
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
naidunia.com naidunia.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Dec 2019 Mar 2020 92 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
SCLP SCLP-6426 Mar 2020 Mar 2020 1 day
IEX IEX-186266 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
pitcheroplay.com pitcheroplay.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 90 days
LOOP LOOP-5918 Jan 2020 Apr 2020 90 days
SCLP SCLP-6793 Jan 2020 Apr 2020 90 days
OX OX-539872073 Jan 2020 Mar 2020 86 days
OX OX-540099026 Feb 2020 Apr 2020 39 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 4 days
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
abplive.in abplive.in
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Sep 2019 79 days
FWHL FWHL-897697 Jul 2019 Sep 2019 79 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 79 days
SVRN SVRN-230297 Jul 2019 Sep 2019 79 days
LIJI LIJI-230297 Jul 2019 Sep 2019 79 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 79 days
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
aberdeenshirerfc.com aberdeenshirerfc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Apr 2020 Apr 2020 8 days
OX OX-540099026 Apr 2020 Apr 2020 8 days
SCLP SCLP-6426 Apr 2020 Apr 2020 8 days
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
sarawakcrocs.com sarawakcrocs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 May 2020 One Off
IEX IEX-186779 May 2020 May 2020 One Off
LOOP LOOP-5918 May 2020 May 2020 One Off
PUBM PUBM-158039 May 2020 May 2020 One Off
YUME YUME-102973855 May 2020 May 2020 One Off
RUB RUB-18110 May 2020 May 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
SVRN SVRN-230297 May 2020 May 2020 One Off
LIJI LIJI-230297 May 2020 May 2020 One Off
YIMO YIMO-2073946213921227802 May 2020 May 2020 One Off
scientology-chinese.com scientology-chinese.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jan 2020 Apr 2020 87 days
LIJI LIJI-230297 Jan 2020 Apr 2020 87 days
YIMO YIMO-2073946213921227802 Jan 2020 Feb 2020 52 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
YUME YUME-102973855 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
altoncc.co.uk altoncc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Apr 2020 76 days
OX OX-540553856 Jan 2020 Apr 2020 76 days
LOOP LOOP-S-2411 Jan 2020 Mar 2020 42 days
SCLP SCLP-6426 Mar 2020 Apr 2020 16 days
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
alison.com alison.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
creon.my stagingeggnetwork.creon.my
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Dec 2020 Dec 2020 One Off
FWHL FWHL-897697 Dec 2020 Dec 2020 One Off
IEX IEX-186779 Dec 2020 Dec 2020 One Off
LOOP LOOP-S-2411 Dec 2020 Dec 2020 One Off
PUBM PUBM-158039 Dec 2020 Dec 2020 One Off
YUME YUME-102973855 Dec 2020 Dec 2020 One Off
SCLP SCLP-6426 Dec 2020 Dec 2020 One Off
SVRN SVRN-230297 Dec 2020 Dec 2020 One Off
LIJI LIJI-230297 Dec 2020 Dec 2020 One Off
YIMO YIMO-2073946213921227802 Dec 2020 Dec 2020 One Off
014718.com 014718.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
stcolumbas.club stcolumbas.club
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 86 days
SCLP SCLP-390 Jan 2020 Apr 2020 86 days
SCLP SCLP-6793 Jan 2020 Apr 2020 86 days
IEX IEX-186266 Mar 2020 Apr 2020 35 days
OX OX-540099026 Mar 2020 Apr 2020 35 days
OX OX-539872073 Mar 2020 Mar 2020 27 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
stocksfieldfc.com stocksfieldfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
tdshipleyfc.co.uk tdshipleyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
thenewslens.com thenewslens.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
uxbridgefc.com uxbridgefc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2020 83 days
PUBM PUBM-158039 Jan 2020 Apr 2020 83 days
SCLP SCLP-6793 Jan 2020 Apr 2020 83 days
FWHL FWHL-897697 Jan 2020 Apr 2020 83 days
OX OX-540099026 Feb 2020 Apr 2020 45 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Jan 2020 Jan 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
blitz.gg blitz.gg
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
wingzero.tw blog.wingzero.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 May 2020 Jun 2021 1 year, 17 days
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 17 days
IEX IEX-186779 May 2020 Jun 2021 1 year, 17 days
LOOP LOOP-5918 May 2020 Jun 2021 1 year, 17 days
YUME YUME-102973855 May 2020 Jun 2021 1 year, 17 days
RUB RUB-18110 May 2020 Jun 2021 1 year, 17 days
SVRN SVRN-230297 May 2020 Jun 2021 1 year, 17 days
LIJI LIJI-230297 May 2020 Jun 2021 1 year, 17 days
YIMO YIMO-2073946213921227802 May 2020 Jun 2021 1 year, 17 days
SCLP SCLP-6793 May 2020 Dec 2020 208 days
vrsz.icu vrsz.icu
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Apr 2020 35 days
FWHL FWHL-897697 Mar 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 35 days
OX OX-539872073 Mar 2020 Mar 2020 24 days
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
bollywoodlife.com bollywoodlife.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
YIMO YIMO-2073946213921227802 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
winscomberfc.co.uk winscomberfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Jan 2020 Mar 2020 47 days
OX OX-539872073 Jan 2020 Mar 2020 47 days
OX OX-540553856 Jan 2020 Mar 2020 47 days
LOOP LOOP-5918 Jan 2020 Mar 2020 47 days
SCLP SCLP-6793 Jan 2020 Mar 2020 47 days
OX OX-540099026 Feb 2020 Mar 2020 12 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
wjpy555.com wjpy555.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
wyvernfc.co.uk wyvernfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 80 days
SCLP SCLP-6793 Jan 2020 Apr 2020 80 days
FWHL FWHL-897697 Jan 2020 Mar 2020 46 days
LOOP LOOP-S-2411 Jan 2020 Mar 2020 46 days
SCLP SCLP-390 Jan 2020 Mar 2020 46 days
IEX IEX-186779 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
yomayo21.ru yomayo21.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
creepypasta.com creepypasta.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 205 days
SCLP SCLP-6793 Jul 2019 Jan 2020 205 days
IEX IEX-186266 Aug 2019 Jan 2020 154 days
IEX IEX-186779 Jul 2019 Nov 2019 140 days
OX OX-540553856 Jul 2019 Nov 2019 140 days
FWHL FWHL-897697 Jul 2019 Nov 2019 140 days
SVRN SVRN-230297 Jul 2019 Sep 2019 75 days
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
ealingcc.co.uk ealingcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Mar 2020 36 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 36 days
OX OX-539872073 Feb 2020 Mar 2020 36 days
OX OX-540553856 Feb 2020 Mar 2020 36 days
PUBM PUBM-158039 Feb 2020 Mar 2020 36 days
SCLP SCLP-6793 Feb 2020 Mar 2020 36 days
OX OX-540099026 Feb 2020 Mar 2020 24 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
eliteprospects.com eliteprospects.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
OX OX-539872073 Nov 2019 Mar 2020 110 days
FWHL FWHL-897697 Nov 2019 Mar 2020 110 days
YIMO YIMO-2073946213921227802 Nov 2019 Mar 2020 110 days
LOOP LOOP-5918 Jan 2020 Mar 2020 45 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
IEX IEX-186266 Nov 2019 Nov 2019 One Off
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
haroldwoodcougarsjfc.co.uk haroldwoodcougarsjfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
incar.tw incar.tw
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Dec 2019 Jun 2021 1 year, 179 days
PUBM PUBM-158039 Dec 2019 Jun 2021 1 year, 179 days
SVRN SVRN-230297 Dec 2019 Jun 2021 1 year, 179 days
LIJI LIJI-230297 Dec 2019 Jun 2021 1 year, 179 days
YIMO YIMO-2073946213921227802 Dec 2019 Jun 2021 1 year, 179 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
OX OX-540553856 Dec 2019 Feb 2021 1 year, 57 days
LOOP LOOP-S-2411 Feb 2020 Apr 2021 1 year, 56 days
IEX IEX-186779 Dec 2019 Mar 2020 97 days
YUME YUME-102973855 Dec 2019 Mar 2020 97 days
lamchame.com lamchame.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
laxss.com laxss.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
RUB RUB-18110 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
LIJI LIJI-230297 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
neathcricketclub.co.uk neathcricketclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Dec 2019 Mar 2020 92 days
IEX IEX-186779 Dec 2019 Mar 2020 92 days
LOOP LOOP-S-2411 Dec 2019 Mar 2020 92 days
OX OX-540553856 Dec 2019 Mar 2020 92 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
mojok.co mojok.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Feb 2020 58 days
IEX IEX-186266 Dec 2019 Feb 2020 58 days
PUBM PUBM-158039 Dec 2019 Feb 2020 58 days
YUME YUME-102973855 Dec 2019 Feb 2020 58 days
SVRN SVRN-230297 Dec 2019 Feb 2020 58 days
LIJI LIJI-230297 Dec 2019 Feb 2020 58 days
YIMO YIMO-2073946213921227802 Dec 2019 Feb 2020 58 days
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
motoweb.net motoweb.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Jun 2021 1 year, 76 days
LIJI LIJI-230297 Mar 2020 Jun 2021 1 year, 76 days
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 76 days
YUME YUME-102973855 Mar 2020 Jun 2021 1 year, 76 days
RUB RUB-18110 Mar 2020 Jun 2021 1 year, 76 days
SVRN SVRN-230297 Mar 2020 Jun 2021 1 year, 76 days
YIMO YIMO-2073946213921227802 Mar 2020 Jun 2021 1 year, 76 days
SCLP SCLP-6793 Mar 2020 Dec 2020 267 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
policerugby.com policerugby.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jan 2020 Feb 2020 55 days
SCLP SCLP-6793 Jan 2020 Feb 2020 55 days
RUB RUB-18110 Jan 2020 Feb 2020 55 days
OX OX-540099026 Feb 2020 Feb 2020 4 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
riaumandiri.id riaumandiri.id
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
sddbih.com sddbih.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 152 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 152 days
IEX IEX-186779 Jan 2020 Apr 2020 87 days
OX OX-540553856 Jan 2020 Apr 2020 87 days
SVRN SVRN-230297 Jan 2020 Apr 2020 87 days
LOOP LOOP-S-2411 Nov 2019 Jan 2020 65 days
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
sevenoakshockey.club sevenoakshockey.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Feb 2020 52 days
OX OX-539872073 Jan 2020 Feb 2020 52 days
OX OX-540553856 Jan 2020 Feb 2020 52 days
PUBM PUBM-158039 Jan 2020 Feb 2020 52 days
SCLP SCLP-6793 Jan 2020 Feb 2020 52 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
anselmiansrufc.com anselmiansrufc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Jan 2020 Mar 2020 41 days
PUBM PUBM-158039 Jan 2020 Mar 2020 41 days
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
spenac.co.uk spenac.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
spielyeti.ch spielyeti.ch
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
tfcnetball.com tfcnetball.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Apr 2020 85 days
OX OX-540553856 Jan 2020 Apr 2020 85 days
SCLP SCLP-6793 Jan 2020 Apr 2020 85 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
batleyboysarlfc.com batleyboysarlfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 16 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
utusan.com.my utusan.com.my
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Sep 2019 69 days
SCLP SCLP-6793 Jul 2019 Sep 2019 69 days
SVRN SVRN-230297 Jul 2019 Sep 2019 69 days
LIJI LIJI-230297 Jul 2019 Sep 2019 69 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 69 days
YUME YUME-102973855 Jul 2019 Sep 2019 54 days
IEX IEX-186779 Jul 2019 Jul 2019 15 days
OX OX-540553856 Jul 2019 Jul 2019 15 days
PUBM PUBM-158039 Jul 2019 Jul 2019 15 days
wandsworthboroughfootballclub.co.uk wandsworthboroughfootballclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
OX OX-539872073 Mar 2020 Mar 2020 23 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
chinatimes.com chinatimes.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 265 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
OX OX-540553856 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
farnhamrugby.org farnhamrugby.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Mar 2020 34 days
OX OX-540553856 Feb 2020 Mar 2020 34 days
SCLP SCLP-6793 Feb 2020 Mar 2020 34 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
guelphrugby.com guelphrugby.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 34 days
SCLP SCLP-6793 Feb 2020 Mar 2020 34 days
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
jilinhaoda.com jilinhaoda.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
IEX IEX-186779 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
kissthemgoodbye.net kissthemgoodbye.net
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Mar 2020 96 days
FWHL FWHL-897697 Dec 2019 Mar 2020 96 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 96 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
mbow.tw mbow.tw
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
SCLP SCLP-6793 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Jul 2019 Feb 2020 235 days
SCLP SCLP-390 Aug 2019 Feb 2020 184 days
FWHL FWHL-897697 Jul 2019 Dec 2019 177 days
SVRN SVRN-230297 Jul 2019 Dec 2019 177 days
YIMO YIMO-2073946213921227802 Jul 2019 Dec 2019 177 days
LOOP LOOP-5918 Aug 2019 Dec 2019 126 days
LOOP LOOP-S-2411 Jul 2019 Aug 2019 50 days
nono41920.com nono41920.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Dec 2019 179 days
SVRN SVRN-230297 Jul 2019 Dec 2019 179 days
LIJI LIJI-230297 Jul 2019 Dec 2019 179 days
YIMO YIMO-2073946213921227802 Jul 2019 Dec 2019 179 days
FWHL FWHL-897697 Jul 2019 Aug 2019 51 days
YUME YUME-102973855 Jul 2019 Aug 2019 51 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
nycitymvp.com nycitymvp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
IEX IEX-186266 Aug 2019 Aug 2019 One Off
LOOP LOOP-5918 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
pesquiseaqui.com pesquiseaqui.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
PUBM PUBM-158039 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
play4.games play4.games
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
pmfc1.com pmfc1.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Feb 2020 55 days
OX OX-540553856 Jan 2020 Feb 2020 55 days
PUBM PUBM-158039 Jan 2020 Feb 2020 55 days
OX OX-540099026 Feb 2020 Feb 2020 4 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
arianapictures.com arianapictures.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Mar 2020 108 days
YIMO YIMO-2073946213921227802 Nov 2019 Mar 2020 108 days
OX OX-540553856 Nov 2019 Jan 2020 66 days
SCLP SCLP-6793 Jan 2020 Mar 2020 42 days
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
021dy.com 021dy.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
teepr.org teepr.org
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
readtheory.org readtheory.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Mar 2020 45 days
YIMO YIMO-2073946213921227802 Jan 2020 Mar 2020 45 days
OX OX-540099026 Feb 2020 Mar 2020 14 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
tsionizm.com tsionizm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Apr 2020 83 days
RUB RUB-18110 Jan 2020 Apr 2020 83 days
LOOP LOOP-S-2411 Jan 2020 Mar 2020 49 days
SCLP SCLP-6426 Mar 2020 Apr 2020 9 days
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
tytheringtonrocksfc.co.uk tytheringtonrocksfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
wombwelltownfc.com wombwelltownfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Mar 2020 47 days
PUBM PUBM-158039 Jan 2020 Mar 2020 47 days
SCLP SCLP-6793 Jan 2020 Mar 2020 47 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
wortonandcheverellfc.com wortonandcheverellfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
yolk.life yolk.life
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Apr 2020 34 days
YUME YUME-102973855 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
chelmsfordcc.co.uk chelmsfordcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2020 Mar 2020 39 days
SCLP SCLP-6793 Feb 2020 Mar 2020 39 days
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
fader.id fader.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
fightersweep.com fightersweep.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 328 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
SCLP SCLP-390 Sep 2019 Apr 2021 1 year, 212 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186779 Sep 2019 Apr 2020 209 days
IEX IEX-186266 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
hatfieldathleticfc.com hatfieldathleticfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
ivsvs.com ivsvs.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Oct 2019 Feb 2020 126 days
FWHL FWHL-897697 Oct 2019 Feb 2020 126 days
LOOP LOOP-5918 Oct 2019 Feb 2020 126 days
SVRN SVRN-230297 Oct 2019 Feb 2020 126 days
LIJI LIJI-230297 Oct 2019 Feb 2020 126 days
YIMO YIMO-2073946213921227802 Oct 2019 Feb 2020 126 days
YUME YUME-102973855 Dec 2019 Feb 2020 62 days
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
kemel.fun kemel.fun
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
kendallkeek.com kendallkeek.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Dec 2019 Mar 2020 96 days
FWHL FWHL-897697 Dec 2019 Mar 2020 96 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 96 days
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
ledburytownfootballclub.co.uk ledburytownfootballclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Mar 2020 95 days
SCLP SCLP-390 Dec 2019 Mar 2020 95 days
SCLP SCLP-6793 Dec 2019 Mar 2020 95 days
OX OX-539872073 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
littleoakleyfc.co.uk littleoakleyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
mdl3etarekoreia.ir mdl3etarekoreia.ir
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Dec 2019 Feb 2020 58 days
OX OX-540553856 Dec 2019 Feb 2020 58 days
LIJI LIJI-230297 Dec 2019 Feb 2020 58 days
FWHL FWHL-897697 Dec 2019 Feb 2020 58 days
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
megagames.com megagames.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
SCLP SCLP-6793 Jul 2019 Mar 2020 250 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Sep 2019 Mar 2020 175 days
SCLP SCLP-390 Sep 2019 Mar 2020 175 days
SVRN SVRN-230297 Nov 2019 Mar 2020 110 days
IEX IEX-186266 Jan 2020 Mar 2020 45 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
ndas.cn ndas.cn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
oann.com oann.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
pexhilljfc.com pexhilljfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Feb 2020 55 days
OX OX-540553856 Jan 2020 Feb 2020 55 days
SCLP SCLP-6793 Jan 2020 Feb 2020 55 days
OX OX-540099026 Feb 2020 Feb 2020 3 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
pirbrightyc.com pirbrightyc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Feb 2020 55 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
polycount.com polycount.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Jun 2021 1 year, 63 days
OX OX-540099026 Apr 2020 Jun 2021 1 year, 63 days
SVRN SVRN-230297 Apr 2020 Jun 2021 1 year, 63 days
YIMO YIMO-2073946213921227802 Apr 2020 Jun 2021 1 year, 63 days
LOOP LOOP-S-2411 Apr 2020 Apr 2021 1 year, 3 days
RUB RUB-18110 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
abertillerybgrfc.com abertillerybgrfc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Apr 2020 Apr 2020 8 days
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
afckingstonyouth.co.uk afckingstonyouth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Mar 2020 Apr 2020 42 days
OX OX-540553856 Mar 2020 Apr 2020 42 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 16 days
IEX IEX-186779 Apr 2020 Apr 2020 8 days
OX OX-540099026 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
sleafordtownfc.co.uk sleafordtownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
resepkoki.id resepkoki.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2020 359 days
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
twistity.com twistity.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 79 days
SCLP SCLP-6793 Jan 2020 Apr 2020 79 days
OX OX-540099026 Feb 2020 Apr 2020 48 days
LOOP LOOP-5918 Jan 2020 Mar 2020 45 days
OX OX-539872073 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
uhbmn.com uhbmn.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
brymbofc.co.uk brymbofc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Feb 2020 Mar 2020 20 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
camberleycc.co.uk camberleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Mar 2020 39 days
OX OX-540553856 Feb 2020 Mar 2020 39 days
SCLP SCLP-6793 Feb 2020 Mar 2020 39 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
zingnews.vn zingnews.vn
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
chuanyusport.com.tw chuanyusport.com.tw
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Jun 2021 1 year, 90 days
YIMO YIMO-2073946213921227802 Mar 2020 Jun 2021 1 year, 90 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 30 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
desitelugu.net desitelugu.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Feb 2020 130 days
SVRN SVRN-230297 Sep 2019 Feb 2020 130 days
LIJI LIJI-230297 Sep 2019 Feb 2020 130 days
YIMO YIMO-2073946213921227802 Sep 2019 Feb 2020 130 days
RUB RUB-18110 Dec 2019 Feb 2020 66 days
IEX IEX-186779 Sep 2019 Dec 2019 64 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
dream.co.id dream.co.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 259 days
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 259 days
LOOP LOOP-S-2411 Jul 2019 Feb 2020 223 days
SVRN SVRN-230297 Jul 2019 Feb 2020 223 days
IEX IEX-186266 Aug 2019 Mar 2020 208 days
SCLP SCLP-390 Aug 2019 Feb 2020 172 days
OX OX-540553856 Jul 2019 Dec 2019 156 days
LIJI LIJI-230297 Jul 2019 Aug 2019 33 days
YUME YUME-102973855 Feb 2020 Feb 2020 One Off
hamptonyouthfc.com hamptonyouthfc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
jamja.vn jamja.vn
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Dec 2019 Mar 2020 97 days
LIJI LIJI-230297 Dec 2019 Mar 2020 97 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 97 days
YUME YUME-102973855 Dec 2019 Mar 2020 97 days
PUBM PUBM-158039 Dec 2019 Feb 2020 62 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
koventh.club koventh.club
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Oct 2019 Mar 2020 160 days
FWHL FWHL-897697 Oct 2019 Mar 2020 160 days
LOOP LOOP-S-2411 Oct 2019 Mar 2020 160 days
SVRN SVRN-230297 Oct 2019 Mar 2020 160 days
LIJI LIJI-230297 Oct 2019 Mar 2020 160 days
YIMO YIMO-2073946213921227802 Oct 2019 Mar 2020 160 days
OX OX-540553856 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
leonafunlife.com leonafunlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 269 days
LIJI LIJI-230297 Jul 2019 Feb 2020 234 days
YUME YUME-102973855 Jul 2019 Feb 2020 234 days
LOOP LOOP-5918 Aug 2019 Mar 2020 218 days
SCLP SCLP-6793 Jul 2019 Dec 2019 174 days
SVRN SVRN-230297 Jul 2019 Dec 2019 174 days
YIMO YIMO-2073946213921227802 Jul 2019 Dec 2019 174 days
OX OX-540553856 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
maxfoodfun.com maxfoodfun.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Mar 2020 270 days
YUME YUME-102973855 Aug 2019 Mar 2020 220 days
LOOP LOOP-5918 Aug 2019 Feb 2020 184 days
SVRN SVRN-230297 Jul 2019 Dec 2019 177 days
LIJI LIJI-230297 Jul 2019 Dec 2019 177 days
LOOP LOOP-S-2411 Dec 2019 Mar 2020 93 days
OX OX-540099026 Feb 2020 Mar 2020 34 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
melbournerfc.com melbournerfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 36 days
LOOP LOOP-5918 Feb 2020 Mar 2020 36 days
SCLP SCLP-6793 Feb 2020 Mar 2020 36 days
SCLP SCLP-390 Feb 2020 Mar 2020 36 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
ourladyofmercy.ro ourladyofmercy.ro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Feb 2020 235 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 235 days
LOOP LOOP-5918 Aug 2019 Dec 2019 132 days
SVRN SVRN-230297 Oct 2019 Feb 2020 121 days
SCLP SCLP-6793 Oct 2019 Feb 2020 121 days
OX OX-540553856 Jul 2019 Oct 2019 114 days
PUBM PUBM-158039 Oct 2019 Dec 2019 65 days
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
owrjuniors.org.uk owrjuniors.org.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Mar 2020 91 days
IEX IEX-186266 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
soci.vip picsee.soci.vip
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2021 Jun 2021 60 days
PUBM PUBM-158039 Apr 2021 Jun 2021 60 days
YUME YUME-102973855 Apr 2021 Jun 2021 60 days
RUB RUB-18110 Apr 2021 Jun 2021 60 days
SVRN SVRN-230297 Apr 2021 Jun 2021 60 days
LIJI LIJI-230297 Apr 2021 Jun 2021 60 days
YIMO YIMO-2073946213921227802 Apr 2021 Jun 2021 60 days
IEX IEX-186779 Apr 2021 Apr 2021 One Off
LOOP LOOP-S-2411 Apr 2021 Apr 2021 One Off
rastrickcricketclub.co.uk rastrickcricketclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Feb 2020 54 days
OX OX-540099026 Feb 2020 Feb 2020 5 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
sezhan18.com sezhan18.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
ammoniy.com ammoniy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
teepr.net teepr.net
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
thaismf.com thaismf.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Apr 2020 35 days
LOOP LOOP-5918 Mar 2020 Apr 2020 35 days
PUBM PUBM-158039 Mar 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 35 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
updates2020s.com updates2020s.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
vanillakismis.my vanillakismis.my
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 May 2020 May 2020 One Off
FWHL FWHL-897697 May 2020 May 2020 One Off
IEX IEX-186779 May 2020 May 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
YUME YUME-102973855 May 2020 May 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
SVRN SVRN-230297 May 2020 May 2020 One Off
LIJI LIJI-230297 May 2020 May 2020 One Off
YIMO YIMO-2073946213921227802 May 2020 May 2020 One Off
viral.id viral.id
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
violentegg.fun violentegg.fun
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
yorkrufc.co.uk yorkrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 May 2020 76 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
OX OX-540553856 May 2020 May 2020 One Off
PUBM PUBM-158039 May 2020 May 2020 One Off
SCLP SCLP-390 May 2020 May 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
SCLP SCLP-6793 May 2020 May 2020 One Off
zingmp3.vn zingmp3.vn
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 284 days
YUME YUME-102973855 Jul 2019 Apr 2020 265 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 204 days
SCLP SCLP-390 Jan 2020 Apr 2020 80 days
FWHL FWHL-897697 Jul 2019 Sep 2019 74 days
SCLP SCLP-6793 Jul 2019 Sep 2019 55 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
cnbcindonesia.com cnbcindonesia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 104 days
IEX IEX-186779 Dec 2019 Mar 2020 104 days
LOOP LOOP-5918 Dec 2019 Mar 2020 104 days
PUBM PUBM-158039 Dec 2019 Mar 2020 104 days
SVRN SVRN-230297 Dec 2019 Mar 2020 104 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 104 days
OX OX-540553856 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
expbravo.com expbravo.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
YUME YUME-102973855 Feb 2020 Mar 2020 35 days
RUB RUB-18110 Feb 2020 Mar 2020 35 days
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
eynshamnetball.co.uk eynshamnetball.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
fifarosters.com fifarosters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 102 days
OX OX-540553856 Dec 2019 Mar 2020 102 days
RUB RUB-18110 Dec 2019 Mar 2020 102 days
SCLP SCLP-390 Dec 2019 Mar 2020 102 days
LIJI LIJI-230297 Dec 2019 Mar 2020 102 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 102 days
SVRN SVRN-230297 Dec 2019 Feb 2020 67 days
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
finchampsteadcc.co.uk finchampsteadcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
htfuelcell.com htfuelcell.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
imreadygo.com imreadygo.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Jun 2021 1 year, 116 days
PUBM PUBM-158039 Feb 2020 Jun 2021 1 year, 116 days
YUME YUME-102973855 Feb 2020 Jun 2021 1 year, 116 days
SVRN SVRN-230297 Feb 2020 Jun 2021 1 year, 116 days
LIJI LIJI-230297 Feb 2020 Jun 2021 1 year, 116 days
YIMO YIMO-2073946213921227802 Feb 2020 Jun 2021 1 year, 116 days
SCLP SCLP-390 Feb 2020 Apr 2021 1 year, 56 days
RUB RUB-18110 Feb 2020 Mar 2020 34 days
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
kwongwah.com.my kwongwah.com.my
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Dec 2019 126 days
YIMO YIMO-2073946213921227802 Aug 2019 Dec 2019 126 days
RUB RUB-18110 Aug 2019 Dec 2019 122 days
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
melkshamtownfc.com melkshamtownfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Mar 2020 36 days
OX OX-539872073 Feb 2020 Mar 2020 36 days
PUBM PUBM-158039 Feb 2020 Mar 2020 36 days
FWHL FWHL-897697 Feb 2020 Mar 2020 36 days
OX OX-540099026 Feb 2020 Mar 2020 35 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
movieinsider.com movieinsider.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
IEX IEX-186779 Jul 2019 Mar 2020 250 days
SCLP SCLP-6793 Jul 2019 Mar 2020 250 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
RUB RUB-18110 Aug 2019 Mar 2020 199 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
nellydyu.tw nellydyu.tw
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 75 days
PUBM PUBM-158039 Mar 2020 Jun 2021 1 year, 75 days
YIMO YIMO-2073946213921227802 Mar 2020 Jun 2021 1 year, 75 days
SCLP SCLP-390 Mar 2020 Apr 2021 1 year, 15 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
nurseryrhymes.com nurseryrhymes.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
rannochafc.co.uk rannochafc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 May 2020 79 days
OX OX-540553856 Feb 2020 May 2020 79 days
SCLP SCLP-6793 Feb 2020 May 2020 79 days
OX OX-540099026 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
RUB RUB-18110 May 2020 May 2020 One Off
IEX IEX-186779 May 2020 May 2020 One Off
appcrawlr.com appcrawlr.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jan 2020 186 days
SCLP SCLP-6793 Jul 2019 Jan 2020 186 days
YIMO YIMO-2073946213921227802 Nov 2019 Jan 2020 65 days
IEX IEX-186266 Aug 2019 Sep 2019 24 days
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
romseyrugby.club romseyrugby.club
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
scguide07.net scguide07.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
ardsrugby.co.uk ardsrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
setn.com setn.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Jul 2019 Apr 2020 269 days
IEX IEX-186779 Jul 2019 Apr 2020 269 days
FWHL FWHL-897697 Jul 2019 Apr 2020 269 days
PUBM PUBM-158039 Jul 2019 Apr 2020 269 days
LOOP LOOP-5918 Aug 2019 Apr 2020 227 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
IEX IEX-186266 Nov 2019 Jan 2020 66 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
012617.com 012617.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
stchadscc.com stchadscc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 86 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
asikq168.com asikq168.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
tattenhoeyouthfc.co.uk tattenhoeyouthfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Apr 2020 84 days
SCLP SCLP-6793 Jan 2020 Apr 2020 84 days
RUB RUB-18110 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
titi.tw titi.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
blackpoolrangersjfc.club blackpoolrangersjfc.club
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Mar 2020 40 days
SCLP SCLP-6793 Feb 2020 Mar 2020 40 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
blink.com.tw blink.com.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 May 2020 One Off
IEX IEX-186266 May 2020 May 2020 One Off
LIJI LIJI-230297 May 2020 May 2020 One Off
LOOP LOOP-5918 May 2020 May 2020 One Off
OX OX-540553856 May 2020 May 2020 One Off
SCLP SCLP-6793 May 2020 May 2020 One Off
SVRN SVRN-230297 May 2020 May 2020 One Off
YIMO YIMO-2073946213921227802 May 2020 May 2020 One Off
box-manga.com box-manga.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
westleigh.net westleigh.net
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
brooke-photos.com brooke-photos.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
ctwant.com ctwant.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Apr 2020 Jun 2021 1 year, 57 days
LIJI LIJI-230297 Apr 2020 Jun 2021 1 year, 57 days
YIMO YIMO-2073946213921227802 Apr 2020 Jun 2021 1 year, 57 days
LOOP LOOP-S-2411 Apr 2020 Apr 2021 362 days
SCLP SCLP-6793 Apr 2020 Dec 2020 248 days
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
durhamcityhockey.com durhamcityhockey.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Mar 2020 37 days
OX OX-540553856 Feb 2020 Mar 2020 37 days
SCLP SCLP-6793 Feb 2020 Mar 2020 37 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
etafc.com etafc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
fmtmalaysia.info fmtmalaysia.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
haberyuzdeyuz.com haberyuzdeyuz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Aug 2019 40 days
FWHL FWHL-897697 Jul 2019 Aug 2019 40 days
SVRN SVRN-230297 Jul 2019 Aug 2019 40 days
LIJI LIJI-230297 Jul 2019 Aug 2019 40 days
YUME YUME-102973855 Jul 2019 Aug 2019 40 days
SCLP SCLP-6793 Jul 2019 Aug 2019 40 days
YIMO YIMO-2073946213921227802 Jul 2019 Aug 2019 40 days
IEX IEX-186779 Aug 2019 Aug 2019 One Off
hastingsrugby.org hastingsrugby.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 28 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
keluarga.my keluarga.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Aug 2019 46 days
LOOP LOOP-S-2411 Jul 2019 Aug 2019 46 days
PUBM PUBM-158039 Jul 2019 Aug 2019 46 days
SVRN SVRN-230297 Jul 2019 Aug 2019 46 days
LIJI LIJI-230297 Jul 2019 Aug 2019 46 days
YIMO YIMO-2073946213921227802 Jul 2019 Aug 2019 46 days
IEX IEX-186779 Jul 2019 Aug 2019 46 days
YUME YUME-102973855 Jul 2019 Aug 2019 46 days
kilmarnockrfc.com kilmarnockrfc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Dec 2019 Mar 2020 96 days
OX OX-540099026 Feb 2020 Mar 2020 32 days
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
leasticoulddo.com leasticoulddo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
moneycontrol.com moneycontrol.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Nov 2019 121 days
LIJI LIJI-230297 Jul 2019 Nov 2019 121 days
YIMO YIMO-2073946213921227802 Jul 2019 Nov 2019 121 days
LOOP LOOP-S-2411 Jul 2019 Nov 2019 121 days
SCLP SCLP-390 Aug 2019 Nov 2019 89 days
YUME YUME-102973855 Jul 2019 Sep 2019 56 days
FWHL FWHL-897697 Jul 2019 Sep 2019 56 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
ope8.info ope8.info
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
royaleapi.com royaleapi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
IEX IEX-186266 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
RUB RUB-18110 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
amtulsalumni.website amtulsalumni.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
OX OX-540553856 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
014546.com 014546.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
standrewscoltsfc.co.uk standrewscoltsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
suttonhighfc.com suttonhighfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Apr 2020 35 days
OX OX-540553856 Mar 2020 Apr 2020 35 days
SCLP SCLP-6793 Mar 2020 Apr 2020 35 days
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
tattenhoefc.co.uk tattenhoefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 84 days
SCLP SCLP-6793 Jan 2020 Apr 2020 84 days
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
bangorrfc.com bangorrfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
trendsunitedfc.co.uk trendsunitedfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 83 days
LOOP LOOP-5918 Jan 2020 Apr 2020 83 days
OX OX-540553856 Jan 2020 Apr 2020 83 days
SCLP SCLP-6793 Jan 2020 Apr 2020 83 days
OX OX-540099026 Feb 2020 Apr 2020 44 days
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
brockenhurstcc.co.uk brockenhurstcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Mar 2020 40 days
OX OX-540553856 Feb 2020 Mar 2020 40 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
worcesterraidersfc.com worcesterraidersfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
zingnews.com.vn zingnews.com.vn
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Nov 2019 Apr 2020 145 days
SVRN SVRN-230297 Nov 2019 Apr 2020 145 days
LIJI LIJI-230297 Nov 2019 Apr 2020 145 days
YIMO YIMO-2073946213921227802 Nov 2019 Apr 2020 145 days
LOOP LOOP-S-2411 Jan 2020 Apr 2020 80 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
LOOP LOOP-5918 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
cindypark.cc cindypark.cc
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 257 days
FWHL FWHL-897697 Jul 2019 Feb 2020 218 days
LIJI LIJI-230297 Jul 2019 Feb 2020 218 days
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 218 days
LOOP LOOP-5918 Aug 2019 Mar 2020 206 days
IEX IEX-186779 Jul 2019 Feb 2020 188 days
OX OX-540553856 Sep 2019 Nov 2019 64 days
IEX IEX-186266 Aug 2019 Sep 2019 37 days
controlador-090.website controlador-090.website
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
OX OX-540553856 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
crushthat.com crushthat.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Mar 2020 38 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 38 days
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
hannity.com hannity.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
heanortownfc.co.uk heanortownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
kjyfc.org.uk kjyfc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Feb 2020 61 days
OX OX-540553856 Dec 2019 Feb 2020 61 days
SCLP SCLP-6793 Dec 2019 Feb 2020 61 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
littletownfc.com littletownfc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
mayandbakerrufc.com mayandbakerrufc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
moiteigri.com moiteigri.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
nationalinterest.org nationalinterest.org
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2019 Nov 2019 121 days
IEX IEX-186779 Jul 2019 Nov 2019 121 days
FWHL FWHL-897697 Jul 2019 Nov 2019 121 days
OX OX-539872073 Aug 2019 Nov 2019 89 days
IEX IEX-186266 Aug 2019 Nov 2019 89 days
RUB RUB-18110 Aug 2019 Nov 2019 89 days
LOOP LOOP-5918 Aug 2019 Nov 2019 89 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
redmarleyfc.co.uk redmarleyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Apr 2020 35 days
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
SCLP SCLP-390 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
OX OX-540099026 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
allchinacup4.com allchinacup4.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Mar 2020 42 days
SCLP SCLP-390 Jan 2020 Mar 2020 42 days
OX OX-540553856 Jan 2020 Mar 2020 42 days
SCLP SCLP-6793 Jan 2020 Mar 2020 42 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
tekflashlight.com tekflashlight.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
zomacrm.com zomacrm.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Nov 2019 65 days
YIMO YIMO-2073946213921227802 Nov 2019 Jan 2020 65 days
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
edwardstechnology.website edwardstechnology.website
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Aug 2019 Aug 2019 One Off
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
IEX IEX-186779 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
fidralionshc.club fidralionshc.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
filehippo.com filehippo.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LIJI LIJI-230297 Jul 2019 Jan 2020 205 days
OX OX-539872073 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
SCLP SCLP-390 Aug 2019 Nov 2019 89 days
SCLP SCLP-6793 Jul 2019 Jul 2019 19 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
fyviefc.com fyviefc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
huncoatunited.co.uk huncoatunited.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
husbandxwife.com husbandxwife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
RUB RUB-18110 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
hwhc.co.uk hwhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
infonet.vn infonet.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Sep 2019 75 days
FWHL FWHL-897697 Jul 2019 Sep 2019 75 days
SVRN SVRN-230297 Jul 2019 Sep 2019 75 days
LIJI LIJI-230297 Jul 2019 Sep 2019 75 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 75 days
IEX IEX-186779 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
kruchiangrai.net kruchiangrai.net
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Feb 2020 Mar 2020 35 days
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
laodong.vn laodong.vn
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 96 days
OX OX-539872073 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
mcnadinsc.co.uk mcnadinsc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
mydramalist.com mydramalist.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Nov 2019 Jan 2020 65 days
OX OX-540553856 Nov 2019 Jan 2020 65 days
LIJI LIJI-230297 Nov 2019 Jan 2020 65 days
YIMO YIMO-2073946213921227802 Nov 2019 Jan 2020 65 days
FWHL FWHL-897697 Nov 2019 Jan 2020 65 days
SCLP SCLP-390 Nov 2019 Jan 2020 65 days
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
nufuma.com nufuma.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
IEX IEX-186779 Aug 2019 Aug 2019 One Off
LOOP LOOP-5918 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
pilkingtonrecs.org pilkingtonrecs.org
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Apr 2020 90 days
RUB RUB-18110 Jan 2020 Apr 2020 90 days
IEX IEX-186779 Jan 2020 Feb 2020 54 days
OX OX-540099026 Feb 2020 Apr 2020 39 days
LOOP LOOP-S-2411 Feb 2020 Apr 2020 36 days
OX OX-540553856 Feb 2020 Apr 2020 36 days
IEX IEX-186266 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
pixelpushas.shop pixelpushas.shop
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 May 2020 May 2020 One Off
SVRN SVRN-230297 May 2020 May 2020 One Off
LIJI LIJI-230297 May 2020 May 2020 One Off
FWHL FWHL-897697 May 2020 May 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
RUB RUB-18110 May 2020 May 2020 One Off
SCLP SCLP-390 May 2020 May 2020 One Off
YIMO YIMO-2073946213921227802 May 2020 May 2020 One Off
prudhoeycfc.com prudhoeycfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Feb 2020 54 days
LOOP LOOP-S-2411 Jan 2020 Feb 2020 54 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
quizfactory.com quizfactory.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Mar 2020 44 days
YIMO YIMO-2073946213921227802 Jan 2020 Mar 2020 44 days
OX OX-540553856 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
robmaness.com robmaness.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
rosehillyouthfc.com rosehillyouthfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Feb 2020 53 days
OX OX-540553856 Jan 2020 Feb 2020 53 days
PUBM PUBM-158039 Jan 2020 Feb 2020 53 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
ruisliptownfc.co.uk ruisliptownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Apr 2020 88 days
SCLP SCLP-6793 Jan 2020 Apr 2020 88 days
OX OX-540099026 Feb 2020 Apr 2020 41 days
OX OX-540553856 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
alicantecityfc.com alicantecityfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Apr 2020 76 days
SCLP SCLP-6793 Jan 2020 Apr 2020 76 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
OX OX-540099026 Feb 2020 Mar 2020 17 days
SCLP SCLP-6426 Mar 2020 Apr 2020 16 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
alphaomegafc.com alphaomegafc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 76 days
OX OX-540553856 Jan 2020 Apr 2020 76 days
SCLP SCLP-6793 Jan 2020 Apr 2020 76 days
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
sofrep.com sofrep.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Aug 2019 Mar 2020 199 days
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
RUB RUB-18110 Nov 2019 Mar 2020 110 days
IEX IEX-186266 Jan 2020 Mar 2020 45 days
SVRN SVRN-230297 Jan 2020 Mar 2020 45 days
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
sportskeeda.com sportskeeda.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Jan 2020 186 days
LOOP LOOP-S-2411 Jul 2019 Jan 2020 186 days
OX OX-539872073 Aug 2019 Nov 2019 89 days
FWHL FWHL-897697 Sep 2019 Nov 2019 65 days
RUB RUB-18110 Nov 2019 Jan 2020 65 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
014340.com 014340.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
abpfc.co.uk abpfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 8 days
OX OX-540553856 Apr 2020 Apr 2020 8 days
SCLP SCLP-6793 Apr 2020 Apr 2020 8 days
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
armadafc.co.uk armadafc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
avorianscc.co.uk avorianscc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 18 days
RUB RUB-18110 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
waddesdoncricketclub.com waddesdoncricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
zeebiz.com zeebiz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Apr 2020 79 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
SCLP SCLP-390 Jan 2020 Mar 2020 46 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
cheltenhamcc.co.uk cheltenhamcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Mar 2020 39 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
dublinnorthhc.com dublinnorthhc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 37 days
SCLP SCLP-6793 Feb 2020 Mar 2020 37 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
fandom.com fandom.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
guesehat.com guesehat.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Jul 2019 Jun 2021 1 year, 347 days
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021 1 year, 347 days
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
LOOP LOOP-5918 Aug 2019 Jun 2021 1 year, 296 days
SCLP SCLP-6793 Jul 2019 Dec 2020 1 year, 173 days
FWHL FWHL-897697 Jul 2019 Aug 2019 39 days
SVRN SVRN-230297 Jul 2019 Aug 2019 39 days
LIJI LIJI-230297 Jul 2019 Aug 2019 39 days
hambledonfc.com hambledonfc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
hsdgallery.net hsdgallery.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 99 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 99 days
IEX IEX-186779 Dec 2019 Feb 2020 64 days
LOOP LOOP-5918 Feb 2020 Mar 2020 35 days
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
islandmarinefc.com islandmarinefc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
ledongtho.com ledongtho.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Oct 2019 109 days
OX OX-540553856 Jul 2019 Oct 2019 109 days
FWHL FWHL-897697 Jul 2019 Oct 2019 109 days
LOOP LOOP-S-2411 Jul 2019 Oct 2019 109 days
YIMO YIMO-2073946213921227802 Jul 2019 Oct 2019 109 days
IEX IEX-186779 Aug 2019 Oct 2019 61 days
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
portarlingtonrugby.com portarlingtonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Apr 2020 90 days
OX OX-540553856 Jan 2020 Apr 2020 90 days
SCLP SCLP-6793 Jan 2020 Apr 2020 90 days
OX OX-539872073 Jan 2020 Mar 2020 86 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
rudgwickfc.co.uk rudgwickfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Feb 2020 53 days
OX OX-540553856 Jan 2020 Feb 2020 53 days
SCLP SCLP-6793 Jan 2020 Feb 2020 53 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
smcathletic.co.uk smcathletic.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 7 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
snapcraft.net snapcraft.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 192 days
LIJI LIJI-230297 Jul 2019 Jan 2020 192 days
IEX IEX-186266 Aug 2019 Jan 2020 141 days
IEX IEX-186779 Jul 2019 Nov 2019 116 days
OX OX-539872073 Aug 2019 Nov 2019 75 days
RUB RUB-18110 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
014317.com 014317.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
strathendrickrfc.com strathendrickrfc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
techienewsnetwork.com techienewsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
tvpoolonline.com tvpoolonline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Sep 2019 68 days
LOOP LOOP-S-2411 Jul 2019 Sep 2019 68 days
SVRN SVRN-230297 Jul 2019 Sep 2019 68 days
LIJI LIJI-230297 Jul 2019 Sep 2019 68 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 68 days
IEX IEX-186779 Jul 2019 Jul 2019 14 days
IEX IEX-186266 Sep 2019 Sep 2019 One Off
twhc.co.uk twhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
ultimate-rihannas.com ultimate-rihannas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Jan 2020 65 days
SVRN SVRN-230297 Nov 2019 Jan 2020 65 days
YIMO YIMO-2073946213921227802 Nov 2019 Jan 2020 65 days
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
binghamrufc.co.uk binghamrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Mar 2020 Apr 2020 18 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
wnefc.com wnefc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 81 days
SCLP SCLP-390 Jan 2020 Apr 2020 81 days
SCLP SCLP-6793 Jan 2020 Apr 2020 81 days
RUB RUB-18110 Jan 2020 Apr 2020 81 days
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
celeb411.com celeb411.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
cgmagonline.com cgmagonline.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 33 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
cmpanthersfc.com cmpanthersfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 May 2020 76 days
IEX IEX-186266 Feb 2020 Mar 2020 38 days
SCLP SCLP-6793 Feb 2020 Mar 2020 38 days
OX OX-540553856 Feb 2020 Feb 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
RUB RUB-18110 May 2020 May 2020 One Off
cpba.cn cpba.cn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 30 days
PUBM PUBM-158039 Jul 2019 Jul 2019 30 days
SVRN SVRN-230297 Jul 2019 Jul 2019 30 days
LIJI LIJI-230297 Jul 2019 Jul 2019 30 days
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 30 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
deadlyegg.com deadlyegg.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
egg.dance egg.dance
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
hkusandybayrfc.com hkusandybayrfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Jun 2020 112 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Jun 2020 Jun 2020 One Off
OX OX-540099026 Jun 2020 Jun 2020 One Off
julla27.net julla27.net
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Feb 2020 232 days
FWHL FWHL-897697 Jul 2019 Dec 2019 171 days
SVRN SVRN-230297 Jul 2019 Dec 2019 171 days
LIJI LIJI-230297 Jul 2019 Dec 2019 171 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Feb 2020 One Off
langdonunitedyfc.co.uk langdonunitedyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
mayandbakersfc.co.uk mayandbakersfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
okehamptonrfc.com okehamptonrfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Mar 2020 91 days
SCLP SCLP-6793 Dec 2019 Mar 2020 91 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
IEX IEX-186266 Dec 2019 Dec 2019 One Off
OX OX-539872073 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
qujipifu.com qujipifu.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Oct 2019 Oct 2019 One Off
OX OX-539872073 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
arcadianmc.com arcadianmc.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
IEX IEX-186266 Aug 2019 Feb 2021 1 year, 174 days
SCLP SCLP-6793 Jul 2019 Dec 2020 1 year, 148 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SCLP SCLP-390 Apr 2020 Apr 2021 364 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
ronny.wang ronny.wang
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 8 days
LOOP LOOP-S-2411 Jul 2019 Jul 2019 8 days
PUBM PUBM-158039 Jul 2019 Jul 2019 8 days
SVRN SVRN-230297 Jul 2019 Jul 2019 8 days
LIJI LIJI-230297 Jul 2019 Jul 2019 8 days
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 8 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
rtl.de rtl.de
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Aug 2019 Jan 2020 154 days
SCLP SCLP-390 Nov 2019 Mar 2020 110 days
FWHL FWHL-897697 Jan 2020 Apr 2020 79 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
altoftsafc.com altoftsafc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
shnc.co.uk shnc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
almondsburyfc.co.uk almondsburyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
silksworthlionsfc.co.uk silksworthlionsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
sportsv.net sportsv.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
babyhazelgames.com babyhazelgames.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Jun 2021 1 year, 97 days
LIJI LIJI-230297 Mar 2020 Jun 2021 1 year, 97 days
YIMO YIMO-2073946213921227802 Mar 2020 Jun 2021 1 year, 97 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
barwickcc.co.uk barwickcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
waltononthamescc.co.uk waltononthamescc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
cbm.net cbm.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Feb 2020 66 days
SCLP SCLP-390 Nov 2019 Feb 2020 66 days
YIMO YIMO-2073946213921227802 Nov 2019 Feb 2020 66 days
IEX IEX-186779 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
controlador-091.website controlador-091.website
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
daleparkfc.co.uk daleparkfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 37 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
garstonladiesfc.co.uk garstonladiesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
harpersbazaar.co.id harpersbazaar.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Nov 2008 Mar 2020 11 years, 141 days
CA CA-PUB-3746615079893481 Oct 2013 Jul 2020 6 years, 280 days
SPTX SPTX-283632 Jun 2020 Jun 2021 1 year, 6 days
AT AT-RA-54EFF682151B7671 Jun 2015 Apr 2016 308 days
FB FB-1498944493475809 Nov 2017 May 2018 175 days
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
NR NR-4F6641B933 Jul 2018 Jul 2018 5 days
horsforthjfc.org horsforthjfc.org
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
imleagues.com imleagues.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
kosmo.com.my kosmo.com.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Aug 2019 46 days
PUBM PUBM-158039 Jul 2019 Aug 2019 46 days
SVRN SVRN-230297 Jul 2019 Aug 2019 46 days
LIJI LIJI-230297 Jul 2019 Aug 2019 46 days
YIMO YIMO-2073946213921227802 Jul 2019 Aug 2019 46 days
YUME YUME-102973855 Jul 2019 Aug 2019 46 days
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
kpopmap.com kpopmap.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Oct 2019 108 days
SVRN SVRN-230297 Jul 2019 Oct 2019 108 days
LIJI LIJI-230297 Jul 2019 Oct 2019 108 days
YIMO YIMO-2073946213921227802 Jul 2019 Oct 2019 108 days
FWHL FWHL-897697 Aug 2019 Oct 2019 61 days
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
lekhanhthanh.com lekhanhthanh.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Aug 2019 Oct 2019 61 days
SVRN SVRN-230297 Aug 2019 Oct 2019 61 days
LIJI LIJI-230297 Aug 2019 Oct 2019 61 days
FWHL FWHL-897697 Aug 2019 Oct 2019 61 days
YIMO YIMO-2073946213921227802 Aug 2019 Oct 2019 61 days
LOOP LOOP-5918 Aug 2019 Oct 2019 58 days
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
oyunskor.com oyunskor.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Oct 2019 Mar 2020 156 days
LIJI LIJI-230297 Aug 2019 Dec 2019 128 days
FWHL FWHL-897697 Dec 2019 Mar 2020 91 days
SCLP SCLP-6426 Mar 2020 Mar 2020 3 days
IEX IEX-186266 Aug 2019 Aug 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
reefpig.com reefpig.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Apr 2020 35 days
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
probatehelpkitsap.com probatehelpkitsap.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
rcwfc.co.uk rcwfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Apr 2020 35 days
OX OX-539872073 Feb 2020 Mar 2020 30 days
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
rhosafc.com rhosafc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Feb 2020 53 days
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
saddleworthcbtc.co.uk saddleworthcbtc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
afchenley.com afchenley.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Mar 2020 43 days
OX OX-540553856 Jan 2020 Mar 2020 43 days
SCLP SCLP-6793 Jan 2020 Mar 2020 43 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
allaroundhappy.com allaroundhappy.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Jan 2020 Apr 2020 76 days
FWHL FWHL-897697 Jan 2020 Apr 2020 76 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
LOOP LOOP-5918 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
staffordtownfc.co.uk staffordtownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
011681.com 011681.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
swanleyfc.co.uk swanleyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
atternews.website atternews.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
beckenhammanorfc.com beckenhammanorfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Apr 2020 75 days
OX OX-540553856 Jan 2020 Apr 2020 75 days
SCLP SCLP-6793 Jan 2020 Apr 2020 75 days
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
beesrugby.com beesrugby.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
utusanmelayu.com.my utusanmelayu.com.my
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Sep 2019 69 days
SVRN SVRN-230297 Jul 2019 Sep 2019 69 days
LIJI LIJI-230297 Jul 2019 Sep 2019 69 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 69 days
RUB RUB-18110 Aug 2019 Sep 2019 18 days
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
bishopswalthamdynamos.co.uk bishopswalthamdynamos.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Mar 2020 40 days
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
vina.tw vina.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 16 days
OX OX-540553856 Jul 2019 Jul 2019 16 days
PUBM PUBM-158039 Jul 2019 Jul 2019 16 days
SVRN SVRN-230297 Jul 2019 Jul 2019 16 days
LIJI LIJI-230297 Jul 2019 Jul 2019 16 days
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 16 days
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
watersky.net watersky.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
OX OX-539872073 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
webserver-pcstoremx.website webserver-pcstoremx.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
OX OX-540553856 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
wheatleyrufc.com wheatleyrufc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 81 days
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
widnesrufc.com widnesrufc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
wivenhoetownfc.com wivenhoetownfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
worcesterparkfc.co.uk worcesterparkfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
wyreforestphoenixfc.com wyreforestphoenixfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
ynysdduwelfare.co.uk ynysdduwelfare.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 May 2020 122 days
PUBM PUBM-158039 Jan 2020 May 2020 122 days
IEX IEX-186779 Mar 2020 May 2020 76 days
LOOP LOOP-S-2411 Mar 2020 May 2020 76 days
SCLP SCLP-6793 Mar 2020 May 2020 76 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186266 May 2020 May 2020 One Off
zigazig-ha.com zigazig-ha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
YIMO YIMO-2073946213921227802 Jan 2020 Jan 2020 One Off
corringhamathleticfc.co.uk corringhamathleticfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
dfda.cn dfda.cn
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
gomhwi.monster gomhwi.monster
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
hassocksladiesfc.co.uk hassocksladiesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 May 2020 85 days
SCLP SCLP-390 Feb 2020 May 2020 85 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 May 2020 May 2020 One Off
ictnews.vn ictnews.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Aug 2019 42 days
PUBM PUBM-158039 Jul 2019 Aug 2019 42 days
YUME YUME-102973855 Jul 2019 Aug 2019 42 days
SVRN SVRN-230297 Jul 2019 Aug 2019 42 days
LIJI LIJI-230297 Jul 2019 Aug 2019 42 days
YIMO YIMO-2073946213921227802 Jul 2019 Aug 2019 42 days
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
idiva.com idiva.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Sep 2019 Nov 2019 65 days
YIMO YIMO-2073946213921227802 Sep 2019 Nov 2019 65 days
FWHL FWHL-897697 Sep 2019 Nov 2019 65 days
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
jgtst.com jgtst.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
keighleyalbionarlfc.com keighleyalbionarlfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Feb 2020 62 days
OX OX-540553856 Dec 2019 Feb 2020 62 days
SCLP SCLP-390 Dec 2019 Feb 2020 62 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
kipocopys.com kipocopys.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
lamchame.vn lamchame.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Jun 2021 1 year, 238 days
YUME YUME-102973855 Oct 2019 Jun 2021 1 year, 238 days
SVRN SVRN-230297 Oct 2019 Jun 2021 1 year, 238 days
LIJI LIJI-230297 Oct 2019 Jun 2021 1 year, 238 days
YIMO YIMO-2073946213921227802 Oct 2019 Jun 2021 1 year, 238 days
LOOP LOOP-S-2411 Oct 2019 Apr 2021 1 year, 178 days
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
liveplaylist.net liveplaylist.net
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
IEX IEX-186266 Aug 2019 Apr 2020 233 days
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
locheeharpjfc.com locheeharpjfc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
nayatravel.com nayatravel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
riccallunited.com riccallunited.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 88 days
OX OX-540099026 Feb 2020 Apr 2020 40 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
pontnewynyddafc.co.uk pontnewynyddafc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
rathisci.website rathisci.website
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
romfordrugby.co.uk romfordrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
skhid.net skhid.net
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
014327.com 014327.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
suttonvalencehockey.com suttonvalencehockey.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
tarreo.com tarreo.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
IEX IEX-186266 Jan 2020 Feb 2021 1 year, 20 days
IEX IEX-186779 Jul 2019 Apr 2020 264 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
SCLP SCLP-6793 Jul 2019 Sep 2019 75 days
teepr.tv teepr.tv
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
teepr.tw teepr.tw
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
timesnowtamil.com timesnowtamil.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
trochoi.net trochoi.net
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 34 days
RUB RUB-18110 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
trontv.com trontv.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Mar 2020 49 days
LOOP LOOP-5918 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
uncle4d.com uncle4d.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
upcominghorrormovies.com upcominghorrormovies.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
RUB RUB-18110 Aug 2019 Jun 2021 1 year, 296 days
FWHL FWHL-897697 Jul 2019 Nov 2019 133 days
SVRN SVRN-230297 Jul 2019 Nov 2019 133 days
YIMO YIMO-2073946213921227802 Jul 2019 Nov 2019 133 days
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
copthornefc.co.uk copthornefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Mar 2020 39 days
OX OX-540099026 Feb 2020 Mar 2020 22 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
denhamunitedlfc.co.uk denhamunitedlfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
dorchesteronthamescc.com dorchesteronthamescc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
fantraxhq.com fantraxhq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
girlsgogames.ru girlsgogames.ru
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Jan 2020 205 days
SVRN SVRN-230297 Jul 2019 Jan 2020 185 days
IEX IEX-186266 Sep 2019 Jan 2020 130 days
SCLP SCLP-390 Aug 2019 Nov 2019 89 days
FWHL FWHL-897697 Jul 2019 Sep 2019 55 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
hullcityosc.org hullcityosc.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
igvofficial.com igvofficial.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
irinashaykphotos.com irinashaykphotos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 98 days
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 98 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
OX OX-539872073 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
jmtestingagain.com jmtestingagain.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 97 days
OX OX-540553856 Dec 2019 Mar 2020 97 days
SCLP SCLP-6793 Dec 2019 Mar 2020 97 days
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
loadoutroom.com loadoutroom.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Sep 2019 75 days
LIJI LIJI-230297 Jul 2019 Sep 2019 75 days
IEX IEX-186779 Jul 2019 Sep 2019 75 days
RUB RUB-18110 Aug 2019 Sep 2019 24 days
IEX IEX-186266 Aug 2019 Sep 2019 24 days
SCLP SCLP-390 Aug 2019 Sep 2019 24 days
SCLP SCLP-6793 Jul 2019 Jul 2019 19 days
lochaberrfc.co.uk lochaberrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
mope.io mope.io
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
oofu.icu oofu.icu
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
orfordfcjuniors.co.uk orfordfcjuniors.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Feb 2020 Mar 2020 36 days
SCLP SCLP-6793 Feb 2020 Mar 2020 36 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
panthersfc.co.uk panthersfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Mar 2020 90 days
LOOP LOOP-S-2411 Jan 2020 Mar 2020 90 days
SCLP SCLP-6426 Mar 2020 Mar 2020 3 days
OX OX-540553856 Jan 2020 Jan 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
plymouthphoenixgirlsfc.co.uk plymouthphoenixgirlsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
qwacc.org qwacc.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
rawdonoldboys.com rawdonoldboys.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Apr 2020 35 days
OX OX-540553856 Feb 2020 Apr 2020 35 days
PUBM PUBM-158039 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
actoniansrfc.com actoniansrfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
sbobrfc.co.uk sbobrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
sheldonroyalsfc.com sheldonroyalsfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
sidearms.io sidearms.io
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
ambrose-images.net ambrose-images.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Jan 2020 65 days
YIMO YIMO-2073946213921227802 Nov 2019 Jan 2020 65 days
OX OX-540553856 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
014527.com 014527.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
014762.com 014762.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
123pelit.com 123pelit.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Apr 2020 42 days
YIMO YIMO-2073946213921227802 Mar 2020 Apr 2020 42 days
OX OX-540553856 Apr 2020 Apr 2020 8 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
takmp3.com takmp3.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
bernama.com.my bernama.com.my
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
YUME YUME-102973855 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
YIMO YIMO-2073946213921227802 Jan 2020 Jan 2020 One Off
bizcritics.com bizcritics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
wcfc.co.uk wcfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 82 days
SCLP SCLP-6793 Jan 2020 Apr 2020 82 days
IEX IEX-186779 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
bramleycc.co.uk bramleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 40 days
SCLP SCLP-6793 Feb 2020 Mar 2020 40 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
bromsgroverfc.com bromsgroverfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
yanagawaoomachi.website yanagawaoomachi.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
zwzt6666.com zwzt6666.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jan 2020 Apr 2020 79 days
IEX IEX-186779 Jan 2020 Mar 2020 45 days
SCLP SCLP-6793 Jan 2020 Mar 2020 45 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
cpsj3.vip cpsj3.vip
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
erdingtonrfc.com erdingtonrfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
firstpost.com firstpost.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
frjfc.org.uk frjfc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
furosemidelasixbuy.site furosemidelasixbuy.site
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
gameblog.fr gameblog.fr
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
IEX IEX-186266 Aug 2019 Apr 2020 233 days
SCLP SCLP-390 Aug 2019 Mar 2020 199 days
LIJI LIJI-230297 Jan 2020 Mar 2020 45 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
gzhbe.com gzhbe.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Jun 2020 Jun 2020 One Off
OX OX-540553856 Jun 2020 Jun 2020 One Off
PUBM PUBM-158039 Jun 2020 Jun 2020 One Off
SVRN SVRN-230297 Jun 2020 Jun 2020 One Off
SCLP SCLP-390 Jun 2020 Jun 2020 One Off
LOOP LOOP-S-2411 Jun 2020 Jun 2020 One Off
hiphoplately.com hiphoplately.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Jun 2021 1 year, 83 days
FWHL FWHL-897697 Mar 2020 Jun 2021 1 year, 83 days
SCLP SCLP-6793 Mar 2020 Dec 2020 274 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
OX OX-540099026 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
kingsleyolympicfc.co.uk kingsleyolympicfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
langleyburycc.co.uk langleyburycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Dec 2019 Feb 2020 61 days
OX OX-540553856 Dec 2019 Feb 2020 61 days
SCLP SCLP-6793 Dec 2019 Feb 2020 61 days
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
lloydsrfc.co.uk lloydsrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
lordswoodyouthfc.com lordswoodyouthfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Feb 2020 59 days
SCLP SCLP-6793 Dec 2019 Feb 2020 59 days
IEX IEX-186779 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
megajatek.hu megajatek.hu
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
LOOP LOOP-S-2411 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
merciajfc.co.uk merciajfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
newsoflegends.com newsoflegends.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Sep 2019 55 days
LIJI LIJI-230297 Jul 2019 Sep 2019 55 days
YIMO YIMO-2073946213921227802 Jul 2019 Sep 2019 55 days
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
OX OX-540553856 Sep 2019 Sep 2019 One Off
oswaldtwistlestmarysfc.co.uk oswaldtwistlestmarysfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Feb 2020 56 days
LOOP LOOP-S-2411 Dec 2019 Feb 2020 56 days
OX OX-540553856 Dec 2019 Feb 2020 56 days
PUBM PUBM-158039 Dec 2019 Feb 2020 56 days
SCLP SCLP-6793 Dec 2019 Feb 2020 56 days
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
penrithcc.co.uk penrithcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Mar 2020 90 days
SCLP SCLP-6426 Mar 2020 Mar 2020 3 days
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
amblesidejfc.org amblesidejfc.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
aldridgecricketclub.co.uk aldridgecricketclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Mar 2020 42 days
OX OX-539872073 Jan 2020 Mar 2020 42 days
LOOP LOOP-S-2411 Jan 2020 Mar 2020 42 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
spelthornesportsfc.com spelthornesportsfc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Apr 2020 85 days
OX OX-540553856 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
014490.com 014490.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Sep 2019 Sep 2019 One Off
RUB RUB-18110 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
aaqn.top aaqn.top
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
LOOP LOOP-5918 Nov 2019 Nov 2019 One Off
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
athleticopitchero.com athleticopitchero.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 May 2020 May 2020 One Off
OX OX-540553856 May 2020 May 2020 One Off
IEX IEX-186266 May 2020 May 2020 One Off
IEX IEX-186779 May 2020 May 2020 One Off
SCLP SCLP-390 May 2020 May 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
ticehurstfc.co.uk ticehurstfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Apr 2020 84 days
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
tjtwgy1000.com tjtwgy1000.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
bipik.site bipik.site
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
britney-galaxy.com britney-galaxy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Mar 2020 40 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 40 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
bwltir.com bwltir.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
wycombehousecc.com wycombehousecc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
ynsadzdpgu.website ynsadzdpgu.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
check4d.com check4d.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
ddm.com.tw ddm.com.tw
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
delafc.com delafc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
dyno.gg dyno.gg
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Oct 2019 Feb 2020 131 days
FWHL FWHL-897697 Oct 2019 Feb 2020 131 days
YIMO YIMO-2073946213921227802 Oct 2019 Feb 2020 131 days
RUB RUB-18110 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
freaked.com freaked.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 26 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
game735.com game735.com
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
gkcc.org gkcc.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
glenlionsfc.com glenlionsfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
governorpalin.org governorpalin.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
RUB RUB-18110 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
gry.pl gry.pl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Feb 2020 229 days
IEX IEX-186266 Aug 2019 Feb 2020 178 days
LIJI LIJI-230297 Jul 2019 Dec 2019 164 days
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
hettonlyonsfc.com hettonlyonsfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
inquirer.net inquirer.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
live4d2u.com live4d2u.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
lutonrugby.com lutonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
manatelugu.to manatelugu.to
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Dec 2019 176 days
SVRN SVRN-230297 Jul 2019 Dec 2019 176 days
LIJI LIJI-230297 Jul 2019 Dec 2019 176 days
SCLP SCLP-6793 Oct 2019 Dec 2019 64 days
OX OX-539872073 Aug 2019 Oct 2019 61 days
RUB RUB-18110 Dec 2019 Dec 2019 One Off
nhltraderumors.me nhltraderumors.me
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
nkfburbage.co.uk nkfburbage.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
nutfieldyouthfc.co.uk nutfieldyouthfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Dec 2019 Mar 2020 91 days
SCLP SCLP-6793 Dec 2019 Mar 2020 91 days
OX OX-540099026 Feb 2020 Mar 2020 37 days
OX OX-540553856 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
okjerseycity.com okjerseycity.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
pcdvd.com.tw pcdvd.com.tw
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
rimingtonfc.com rimingtonfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Feb 2020 53 days
SCLP SCLP-6793 Jan 2020 Feb 2020 53 days
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
ringwoodtownfc.co.uk ringwoodtownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Feb 2020 53 days
OX OX-540553856 Jan 2020 Feb 2020 53 days
SCLP SCLP-6793 Jan 2020 Feb 2020 53 days
RUB RUB-18110 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
rodawayroversfc.co.uk rodawayroversfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Apr 2020 36 days
OX OX-540553856 Feb 2020 Apr 2020 36 days
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
actoniansfc.co.uk actoniansfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
satiride.com satiride.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
SCLP SCLP-6793 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
sinchew.com.my sinchew.com.my
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jul 2020 Jul 2020 One Off
RUB RUB-18110 Jul 2020 Jul 2020 One Off
IEX IEX-186266 Jul 2020 Jul 2020 One Off
IEX IEX-186779 Jul 2020 Jul 2020 One Off
YIMO YIMO-2073946213921227802 Jul 2020 Jul 2020 One Off
SCLP SCLP-6793 Jul 2020 Jul 2020 One Off
spartansrufc.co.uk spartansrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Mar 2020 51 days
IEX IEX-186779 Jan 2020 Mar 2020 51 days
PUBM PUBM-158039 Jan 2020 Mar 2020 51 days
SCLP SCLP-390 Jan 2020 Mar 2020 51 days
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
sugarshock.io sugarshock.io
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
altonrfc.club altonrfc.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
banchorycommunityfc.org banchorycommunityfc.org
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
beaconsfieldcc.com beaconsfieldcc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
traffordfc.com traffordfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2020 83 days
OX OX-540553856 Jan 2020 Apr 2020 83 days
SCLP SCLP-6793 Jan 2020 Apr 2020 83 days
IEX IEX-186266 Mar 2020 Apr 2020 34 days
IEX IEX-186779 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
boveytraceycricketclub.org boveytraceycricketclub.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Mar 2020 40 days
OX OX-540553856 Feb 2020 Mar 2020 40 days
OX OX-540099026 Feb 2020 Mar 2020 20 days
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
brandongrovesafc.com brandongrovesafc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
broadfieldsunitedfc.co.uk broadfieldsunitedfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
buzzkini.com buzzkini.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YUME YUME-102973855 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
ybw44.org ybw44.org
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
ccyfc.com ccyfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
cfpdata.website cfpdata.website
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
cgmbacklot.com cgmbacklot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
cmdry.com cmdry.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Sep 2019 58 days
FWHL FWHL-897697 Jul 2019 Sep 2019 58 days
PUBM PUBM-158039 Jul 2019 Sep 2019 58 days
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
cnwhc.co.uk cnwhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
downhamtownfc.com downhamtownfc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Mar 2020 36 days
SCLP SCLP-6793 Feb 2020 Mar 2020 36 days
OX OX-540099026 Feb 2020 Mar 2020 23 days
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
eaglerufc.co.uk eaglerufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
fcdeportivogalicia.com fcdeportivogalicia.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
fcmallaby.com fcmallaby.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Mar 2020 34 days
OX OX-540553856 Feb 2020 Mar 2020 34 days
SCLP SCLP-6793 Feb 2020 Mar 2020 34 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
girlsgogames.it girlsgogames.it
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
SCLP SCLP-390 Aug 2019 Sep 2019 24 days
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
gmx.com gmx.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
SCLP SCLP-6793 Jul 2019 Jan 2020 205 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
SCLP SCLP-390 Aug 2019 Jan 2020 154 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
headstonemanoryouthfc.org headstonemanoryouthfc.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
heyfordparkfootballclub.co.uk heyfordparkfootballclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
hhczdh.com hhczdh.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
IEX IEX-186779 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
kingslangleyfc.co.uk kingslangleyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
leoaffairs.com leoaffairs.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
lindumcc.co.uk lindumcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
lionsrfc.co.uk lionsrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Feb 2020 59 days
SCLP SCLP-6793 Dec 2019 Feb 2020 59 days
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
mail.com mail.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
IEX IEX-186266 Aug 2019 Apr 2020 233 days
SCLP SCLP-390 Nov 2019 Jan 2020 65 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
nekoyoke.com nekoyoke.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
LOOP LOOP-S-2411 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
news18.tw news18.tw
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
nottinghammodernsrfc.com nottinghammodernsrfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
oyunlarskor.com oyunlarskor.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Dec 2020 1 year, 173 days
SCLP SCLP-390 Dec 2019 Apr 2021 1 year, 104 days
LIJI LIJI-230297 Jul 2019 Mar 2020 274 days
IEX IEX-186266 Aug 2019 Mar 2020 219 days
SVRN SVRN-230297 Dec 2019 Mar 2020 91 days
SCLP SCLP-6426 Mar 2020 Mar 2020 3 days
arpcc.org.uk arpcc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2020 76 days
OX OX-540553856 Jan 2020 Apr 2020 76 days
RUB RUB-18110 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
rutherglenglencairnjfc21s.com rutherglenglencairnjfc21s.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 88 days
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
agame.com agame.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
SCLP SCLP-390 Aug 2019 Mar 2020 199 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
apkaintezartha.website apkaintezartha.website
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
CA CA-PUB-1738284215641521 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
stourbridgefc.com stourbridgefc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
swayjuniorsfc.com swayjuniorsfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
auntkeysmith.website auntkeysmith.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
IEX IEX-186779 Jul 2019 Jul 2019 One Off
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
aztecscricketclub.com aztecscricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
uploadwidget.com uploadwidget.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
wansteadrfc.com wansteadrfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Mar 2020 48 days
OX OX-539872073 Jan 2020 Mar 2020 48 days
RUB RUB-18110 Jan 2020 Mar 2020 48 days
IEX IEX-186779 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
bowersandpitseafootballclub.com bowersandpitseafootballclub.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2020 Mar 2020 40 days
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
widnesfootballclub.co.uk widnesfootballclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Jul 2020 86 days
OX OX-540553856 Jan 2020 Apr 2020 81 days
SCLP SCLP-6793 Jan 2020 Apr 2020 81 days
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
wittonalbionfc.co.uk wittonalbionfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Mar 2020 47 days
PUBM PUBM-158039 Jan 2020 Mar 2020 47 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
wowcandyvisuals.com wowcandyvisuals.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Jan 2020 65 days
YIMO YIMO-2073946213921227802 Nov 2019 Jan 2020 65 days
OX OX-539872073 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
bwsrvr.dev bwsrvr.dev
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Sep 2019 Mar 2020 170 days
SCLP SCLP-390 Nov 2019 Mar 2020 105 days
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
coggeshallutdfc.com coggeshallutdfc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
cryptofree.pw cryptofree.pw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
diamondandsilk.com diamondandsilk.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Sep 2019 Dec 2019 64 days
IEX IEX-186266 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
OX OX-539872073 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
ehealthinsurance.website ehealthinsurance.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
elkonouz.com elkonouz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Dec 2019 64 days
YUME YUME-102973855 Oct 2019 Dec 2019 64 days
YIMO YIMO-2073946213921227802 Oct 2019 Dec 2019 64 days
IEX IEX-186779 Oct 2019 Oct 2019 One Off
PUBM PUBM-158039 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
gamesfreak.net gamesfreak.net
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
gogy.com gogy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 263 days
SCLP SCLP-6793 Aug 2019 Dec 2019 124 days
IEX IEX-186266 Aug 2019 Oct 2019 48 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
gzfszp168.com gzfszp168.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
heysidecricketclub.com heysidecricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
hullbridgesportsfc.co.uk hullbridgesportsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
kenningwellutd.co.uk kenningwellutd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
lfg.co lfg.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
OX OX-540553856 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
OX OX-540099026 Feb 2020 Mar 2020 33 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
lowkickmma.com lowkickmma.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Jul 2019 Oct 2019 111 days
SCLP SCLP-390 Aug 2019 Oct 2019 60 days
LIJI LIJI-230297 Jul 2019 Aug 2019 49 days
FWHL FWHL-897697 Jul 2019 Aug 2019 49 days
OX OX-540553856 Aug 2019 Aug 2019 One Off
IEX IEX-186779 Aug 2019 Aug 2019 One Off
mcfoxcraft.com mcfoxcraft.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2020 Jun 2021 329 days
IEX IEX-186779 Jul 2020 Jun 2021 329 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-390 Oct 2020 Apr 2021 165 days
SCLP SCLP-6793 Jul 2020 Dec 2020 155 days
IEX IEX-186266 Nov 2020 Feb 2021 91 days
mineblocks.com mineblocks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 May 2020 One Off
IEX IEX-186266 May 2020 May 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
OX OX-540099026 May 2020 May 2020 One Off
YUME YUME-102973855 May 2020 May 2020 One Off
YIMO YIMO-2073946213921227802 May 2020 May 2020 One Off
musselburghathleticfc.co.uk musselburghathleticfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540099026 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
nmgcc.co.uk nmgcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
nwrfc.club nwrfc.club
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
OX OX-539872073 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
offers-online.info offers-online.info
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
roaringearth.com roaringearth.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
radstocktownafc.com radstocktownafc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
royalfalconsfc.club royalfalconsfc.club
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Apr 2020 88 days
SCLP SCLP-6793 Jan 2020 Apr 2020 88 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
ruichangshi.com.cn ruichangshi.com.cn
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
stratfordtownfc.co.uk stratfordtownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
thebright.com thebright.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
thibaut-pinot.com thibaut-pinot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
IEX IEX-186266 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
wickfordcricketclub.co.uk wickfordcricketclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
cai678.com cai678.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
zurichrugbyacademy.com zurichrugbyacademy.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
charlevillerfc.com charlevillerfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
crucible.website crucible.website
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
earlsdonrfc.co.uk earlsdonrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
eggsarecool.com eggsarecool.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
erskineyouthfc.co.uk erskineyouthfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
fifenetball.com fifenetball.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Apr 2020 May 2020 22 days
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
hzvfdbq.com hzvfdbq.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Aug 2019 Oct 2019 61 days
FWHL FWHL-897697 Aug 2019 Oct 2019 61 days
LIJI LIJI-230297 Aug 2019 Oct 2019 61 days
YIMO YIMO-2073946213921227802 Aug 2019 Oct 2019 61 days
OX OX-540553856 Aug 2019 Aug 2019 One Off
jonotestcc.com jonotestcc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Dec 2019 Mar 2020 97 days
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
kirkbycoltsfc.com kirkbycoltsfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
minijuegos.com minijuegos.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
IEX IEX-186266 Aug 2019 Mar 2020 199 days
SCLP SCLP-6793 Sep 2019 Jan 2020 130 days
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
naguide.com naguide.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 346 days
OX OX-539872073 Aug 2019 Mar 2020 220 days
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
pontefractrufc.com pontefractrufc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
reigateltc.org.uk reigateltc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
rylandnetball.com rylandnetball.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
sheppeyrfc.co.uk sheppeyrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
silverdalejfc.co.uk silverdalejfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
haicao69.com haicao69.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
uno.one uno.one
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Aug 2019 Mar 2020 195 days
LIJI LIJI-230297 Jul 2019 Nov 2019 133 days
SCLP SCLP-390 Aug 2019 Nov 2019 82 days
SVRN SVRN-230297 Jul 2019 Jul 2019 15 days
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
vexation.website vexation.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
whoabella.com whoabella.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Apr 2020 34 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
LOOP LOOP-S-2411 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
OX OX-540553856 Mar 2020 Mar 2020 One Off
wionews.com wionews.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
cddtjx.com cddtjx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Sep 2019 58 days
PUBM PUBM-158039 Jul 2019 Sep 2019 58 days
LOOP LOOP-S-2411 Jul 2019 Jul 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
dlrccricket.com dlrccricket.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
emmbrookandbearwoodcc.com emmbrookandbearwoodcc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
ribbletonfc.co.uk ribbletonfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
girlsgogames.co.uk girlsgogames.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Apr 2020 209 days
LIJI LIJI-230297 Jul 2019 Sep 2019 55 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
gmx.co.uk gmx.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Aug 2019 Mar 2020 224 days
SVRN SVRN-230297 Aug 2019 Mar 2020 224 days
IEX IEX-186266 Oct 2019 Mar 2020 164 days
SCLP SCLP-390 Oct 2019 Mar 2020 164 days
LIJI LIJI-230297 Oct 2019 Feb 2020 129 days
hacc.club hacc.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
houstonstallionscc.org houstonstallionscc.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
hwrfc.co.uk hwrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
jujuxii.com jujuxii.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Aug 2019 Oct 2019 61 days
SVRN SVRN-230297 Aug 2019 Oct 2019 61 days
LIJI LIJI-230297 Aug 2019 Oct 2019 61 days
YIMO YIMO-2073946213921227802 Aug 2019 Oct 2019 61 days
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
ketteringrugby.com ketteringrugby.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Feb 2020 61 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
leedsandbroomfieldcc.com leedsandbroomfieldcc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
merseysideblindfc.co.uk merseysideblindfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
oyunbarbie.com oyunbarbie.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Aug 2019 Mar 2020 219 days
LIJI LIJI-230297 Aug 2019 Mar 2020 219 days
SCLP SCLP-390 Oct 2019 Dec 2019 65 days
SVRN SVRN-230297 Dec 2019 Feb 2020 56 days
SCLP SCLP-6426 Mar 2020 Mar 2020 3 days
qkej.top qkej.top
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
qqhair.tw qqhair.tw
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
rzwjjc.com rzwjjc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
RUB RUB-18110 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
rwbhc.co.uk rwbhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
alvechurchfc.club alvechurchfc.club
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 May 2020 May 2020 One Off
PUBM PUBM-158039 May 2020 May 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
sofifa.com sofifa.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 21 days
OX OX-540553856 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
stneotsrugbyclub.com stneotsrugbyclub.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
taiamoda.com taiamoda.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
IEX IEX-186779 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
bedminstercc.co.uk bedminstercc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
vijaykarnataka.com vijaykarnataka.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
vulcanworlds.com vulcanworlds.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
YUME YUME-102973855 Nov 2019 Nov 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
brockleycc.co.uk brockleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Mar 2020 40 days
SCLP SCLP-6793 Feb 2020 Mar 2020 40 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
catchago.website catchago.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
fcargyle.co.uk fcargyle.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Mar 2020 34 days
OX OX-540553856 Feb 2020 Mar 2020 34 days
PUBM PUBM-158039 Feb 2020 Mar 2020 34 days
SCLP SCLP-6793 Feb 2020 Mar 2020 34 days
OX OX-540099026 Mar 2020 Mar 2020 One Off
giantfreakinrobot.com giantfreakinrobot.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
YIMO YIMO-2073946213921227802 Feb 2020 Mar 2020 35 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
gmx.fr gmx.fr
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 263 days
SCLP SCLP-390 Aug 2019 Mar 2020 212 days
IEX IEX-186266 Aug 2019 Mar 2020 212 days
LIJI LIJI-230297 Oct 2019 Mar 2020 164 days
SCLP SCLP-6793 Oct 2019 Dec 2019 64 days
jeu.fr jeu.fr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 223 days
LIJI LIJI-230297 Jul 2019 Oct 2019 105 days
IEX IEX-186266 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
jeux.fr jeux.fr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 223 days
SCLP SCLP-6793 Aug 2019 Feb 2020 188 days
LIJI LIJI-230297 Jul 2019 Dec 2019 170 days
SCLP SCLP-390 Oct 2019 Mar 2020 162 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
juegosdechicas.com juegosdechicas.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Feb 2020 232 days
IEX IEX-186266 Aug 2019 Mar 2020 216 days
FWHL FWHL-897697 Oct 2019 Mar 2020 161 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
livingstonrfc.com livingstonrfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Feb 2020 59 days
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
mistleyrufc.co.uk mistleyrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
moyuechengyule.com moyuechengyule.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
RUB RUB-18110 Aug 2019 Aug 2019 One Off
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
prtzgl.com prtzgl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Oct 2019 One Off
IEX IEX-186779 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
queencityrugby.org queencityrugby.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Apr 2020 89 days
OX OX-540553856 Jan 2020 Apr 2020 89 days
SCLP SCLP-6793 Jan 2020 Apr 2020 89 days
RUB RUB-18110 Jan 2020 Jan 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
abp-105.website abp-105.website
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
PUBM PUBM-158039 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
adoring-kstewart.com adoring-kstewart.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
YIMO YIMO-2073946213921227802 Jan 2020 Jan 2020 One Off
afcreading.co.uk afcreading.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Jan 2020 One Off
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
15heures.com 15heures.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 293 days
SVRN SVRN-230297 Jul 2019 Apr 2020 293 days
IEX IEX-186266 Aug 2019 Apr 2020 242 days
SCLP SCLP-390 Aug 2019 Nov 2019 90 days
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
warlinghamcc.co.uk warlinghamcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
bsjfc.co.uk bsjfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 19 days
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
wypfc.co.uk wypfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
camdentownyouthfc.com camdentownyouthfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 39 days
SCLP SCLP-6793 Feb 2020 Mar 2020 39 days
OX OX-540099026 Feb 2020 Mar 2020 20 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
cbd-mart.net cbd-mart.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
chris-hemsworth.org chris-hemsworth.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
YUME YUME-102973855 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
dcsexabuselawyer.com dcsexabuselawyer.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
eclipseyouthfc.club eclipseyouthfc.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
edenbridgerugby.co.uk edenbridgerugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
ethl33t.uk ethl33t.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
LIJI LIJI-230297 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
everettroversfc.co.uk everettroversfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
gadgetsnow.com gadgetsnow.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
LOOP LOOP-5918 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
games.co.uk games.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
FWHL FWHL-897697 Sep 2019 Mar 2020 175 days
IEX IEX-186266 Sep 2019 Mar 2020 175 days
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
gamingsym.com gamingsym.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Aug 2019 Dec 2019 124 days
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
giaoducthoidai.vn giaoducthoidai.vn
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 225 days
LIJI LIJI-230297 Aug 2019 Mar 2020 225 days
YIMO YIMO-2073946213921227802 Aug 2019 Mar 2020 225 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
gooletowncc.co.uk gooletowncc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
holwellsportsfc.com holwellsportsfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
hoot.website hoot.website
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
ifc.org.uk ifc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
meophamcc.com meophamcc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Dec 2019 One Off
LOOP LOOP-5918 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
mousebreaker.com mousebreaker.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2019 Mar 2020 175 days
IEX IEX-186266 Nov 2019 Mar 2020 110 days
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
myscrapnook.com myscrapnook.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 272 days
IEX IEX-186266 Aug 2019 Mar 2020 221 days
SCLP SCLP-6793 Aug 2019 Mar 2020 220 days
SCLP SCLP-390 Aug 2019 Dec 2019 129 days
SVRN SVRN-230297 Jul 2019 Jul 2019 1 day
nappysxi.com nappysxi.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
oneailfx.com oneailfx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
pegasus81fc.com pegasus81fc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
poolafc.com poolafc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Apr 2020 35 days
SCLP SCLP-6793 Feb 2020 Apr 2020 35 days
FWHL FWHL-897697 Feb 2020 Apr 2020 35 days
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
arabianranchesproperty.biz arabianranchesproperty.biz
Attribute Value First Detected Last Detected Overlap Duration
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
ampthilltowncc.co.uk ampthilltowncc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
soft32.de soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2019 Apr 2021 1 year, 224 days
SCLP SCLP-6793 Jul 2019 Dec 2020 1 year, 173 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.it soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
SCLP SCLP-6793 Sep 2019 Dec 2020 1 year, 110 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
sports442.com sports442.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
014201.com 014201.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
stmarys1947fc.co.uk stmarys1947fc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
sunburycricket.co.uk sunburycricket.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
thorncliffefcu10.co.uk thorncliffefcu10.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
tokoyun.com tokoyun.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 267 days
LIJI LIJI-230297 Jul 2019 Apr 2020 267 days
IEX IEX-186266 Jan 2020 Apr 2020 84 days
SCLP SCLP-6793 Jan 2020 Mar 2020 50 days
bilbrookjunior.co.uk bilbrookjunior.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
viralmotion.net viralmotion.net
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Aug 2019 Jan 2020 148 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
xecuatui.vn xecuatui.vn
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 266 days
LIJI LIJI-230297 Jul 2019 Apr 2020 266 days
YIMO YIMO-2073946213921227802 Jul 2019 Apr 2020 266 days
SCLP SCLP-6793 Nov 2019 Apr 2020 146 days
zanz.net zanz.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
zzz109.top zzz109.top
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Nov 2019 Nov 2019 One Off
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
datchworthrugby.club datchworthrugby.club
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
edgbastonhc.co.uk edgbastonhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
esquire.co.id esquire.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Feb 2012 Mar 2020 8 years, 39 days
CA CA-PUB-3746615079893481 Nov 2013 Jul 2020 6 years, 235 days
NR NR-4F6641B933 Jun 2018 Aug 2019 1 year, 54 days
AT AT-RA-54EFF682151B7671 Sep 2015 Apr 2016 189 days
focus-proxy.com focus-proxy.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Oct 2019 Oct 2019 One Off
YUME YUME-102973855 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
gamesgames.com gamesgames.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
IEX IEX-186266 Aug 2019 Jan 2020 154 days
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
garstangcc.co.uk garstangcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
gmx.at gmx.at
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Mar 2020 Apr 2020 35 days
SCLP SCLP-6426 Mar 2020 Apr 2020 14 days
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
gooleafc.com gooleafc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
gwrovers.com gwrovers.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
hbfc1872.co.uk hbfc1872.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
howdenafc.co.uk howdenafc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
iamgujarat.com iamgujarat.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
LOOP LOOP-S-2411 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
juegos.com juegos.com
Attribute Value First Detected Last Detected Overlap Duration
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
mkhockey.co.uk mkhockey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
arcadeprehacks.com arcadeprehacks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
IEX IEX-186266 Aug 2019 Jan 2020 161 days
SCLP SCLP-390 Aug 2019 Jan 2020 161 days
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
rutherfordafc.co.uk rutherfordafc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
sandbachunitedfc.co.uk sandbachunitedfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
afcgatwick.co.uk afcgatwick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Apr 2020 77 days
SCLP SCLP-6793 Jan 2020 Mar 2020 43 days
OX OX-540553856 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
sidcupcc.co.uk sidcupcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.com.br soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
SCLP SCLP-6793 Jul 2019 Dec 2020 1 year, 173 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
specialoperations.com specialoperations.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jul 2019 19 days
LIJI LIJI-230297 Jul 2019 Jul 2019 19 days
IEX IEX-186779 Jul 2019 Jul 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
swanagefc.com swanagefc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
tdhulgql.site tdhulgql.site
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
tewcc.org.uk tewcc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
IEX IEX-186779 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
uwwnc.co.uk uwwnc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
wor7.com wor7.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
burghfieldfootballclub.com burghfieldfootballclub.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
cradleytownfc.co.uk cradleytownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
doversharksrugby.com doversharksrugby.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
enfieldcricketclub.com enfieldcricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
etonmanorrfc.com etonmanorrfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
gmx.ch gmx.ch
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
gmx.es gmx.es
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 263 days
IEX IEX-186266 Aug 2019 Mar 2020 212 days
SCLP SCLP-390 Aug 2019 Mar 2020 212 days
SVRN SVRN-230297 Jul 2019 Oct 2019 99 days
hip-hopvibe.com hip-hopvibe.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Mar 2020 One Off
RUB RUB-18110 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
hmn.tw hmn.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
kidlingtoncricket.com kidlingtoncricket.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Mar 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
knaphillfootballclub.com knaphillfootballclub.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
kpopf.app kpopf.app
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Oct 2019 Oct 2019 One Off
OX OX-540553856 Oct 2019 Oct 2019 One Off
LIJI LIJI-230297 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
lanadelreyfan.com lanadelreyfan.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
YUME YUME-102973855 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
lborofoxes.co.uk lborofoxes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
levelup.com levelup.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
RUB RUB-18110 Sep 2019 Sep 2019 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
matamata.com matamata.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
maximindonesia.co.id maximindonesia.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Dec 2013 Jun 2018 4 years, 206 days
CA CA-PUB-3746615079893481 Nov 2013 Apr 2015 1 year, 136 days
AT AT-RA-54EFF682151B7671 Jun 2015 Apr 2016 308 days
NR NR-4F6641B933 Jun 2018 Jun 2018 One Off
mearnsyouthfc.co.uk mearnsyouthfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 35 days
SCLP SCLP-6793 Feb 2020 Mar 2020 35 days
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
needhammarketfc.co.uk needhammarketfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
oakwoodfc.co.uk oakwoodfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
pinkneysgreencc.com pinkneysgreencc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
abhilashwedsarchana.website abhilashwedsarchana.website
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
FWHL FWHL-897697 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
YIMO YIMO-2073946213921227802 Jul 2019 Jul 2019 One Off
actonianslfc.com actonianslfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
sandsunitedfc.co.uk sandsunitedfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
afcpogmoor.co.uk afcpogmoor.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
alnwickbears.co.uk alnwickbears.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-539872073 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
shootoldschool.com shootoldschool.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Nov 2019 Nov 2019 One Off
OX OX-539872073 Nov 2019 Nov 2019 One Off
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
011362.com 011362.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Sep 2019 Sep 2019 One Off
IEX IEX-186266 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
abbeyvalefc.co.uk abbeyvalefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
botleyvillagefc.co.uk botleyvillagefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
braintreetownyouthfc.co.uk braintreetownyouthfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
wetherbyrufc.com wetherbyrufc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
wolvertontigermoths.co.uk wolvertontigermoths.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
bwin900.org bwin900.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
chapeltownhc.com chapeltownhc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
congletonrufc.co.uk congletonrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-539872073 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
cosmogirl.co.id cosmogirl.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Feb 2012 Mar 2020 8 years, 26 days
CA CA-PUB-3746615079893481 Oct 2013 Jul 2020 6 years, 280 days
NR NR-4F6641B933 Jun 2018 Aug 2019 1 year, 54 days
AT AT-RA-54EFF682151B7671 Nov 2015 Apr 2016 154 days
cpdbarnet.com cpdbarnet.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
cumnockrugby.com cumnockrugby.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
dagenhamrufc.co.uk dagenhamrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
dalbeattiestar.co.uk dalbeattiestar.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
deepingrangersfc.co.uk deepingrangersfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
arcadianmc.com forums.arcadianmc.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Feb 2021 Jun 2021 122 days
SVRN SVRN-230297 Feb 2021 Jun 2021 122 days
SCLP SCLP-390 Apr 2021 Apr 2021 1 day
IEX IEX-186266 Feb 2021 Feb 2021 One Off
garagesafari.website garagesafari.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
YIMO YIMO-2073946213921227802 Aug 2019 Aug 2019 One Off
haslemererugby.co.uk haslemererugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
hendonrugby.com hendonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
imgpile.com imgpile.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
kirkheatonyouthfc.com kirkheatonyouthfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
kqr936.cn kqr936.cn
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
lightwaterrfc.com lightwaterrfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
marplerugbyclub.com marplerugbyclub.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jun 2020 Jun 2020 One Off
OX OX-540099026 Jun 2020 Jun 2020 One Off
LOOP LOOP-5918 Jun 2020 Jun 2020 One Off
SCLP SCLP-390 Jun 2020 Jun 2020 One Off
mixmag.net mixmag.net
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
news18.com news18.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Aug 2019 Aug 2019 One Off
YUME YUME-102973855 Aug 2019 Aug 2019 One Off
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
LOOP LOOP-5918 Aug 2019 Aug 2019 One Off
nzxlmiaomu.com nzxlmiaomu.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Dec 2019 One Off
LOOP LOOP-S-2411 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
ovcricket.com ovcricket.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Dec 2019 Dec 2019 One Off
OX OX-540553856 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
raidboss.org raidboss.org
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
rpgsite.net rpgsite.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Aug 2019 60 days
RUB RUB-18110 Aug 2019 Aug 2019 9 days
SVRN SVRN-230297 Aug 2019 Aug 2019 One Off
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
shipstononstourcc.co.uk shipstononstourcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
soft32.es soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
SCLP SCLP-6793 Jul 2019 Dec 2020 1 year, 173 days
SCLP SCLP-6426 Mar 2020 Jun 2021 1 year, 76 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
013306.com 013306.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
LOOP LOOP-5918 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
streatham-croydonrfc.com streatham-croydonrfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
swaffhamrufc.co.uk swaffhamrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
ayrhockeyclub.com ayrhockeyclub.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
bemertonheathfc.com bemertonheathfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
beri201314.com beri201314.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
YIMO YIMO-2073946213921227802 Apr 2020 Apr 2020 One Off
usportsmouthhockey.co.uk usportsmouthhockey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
web.de web.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Mar 2020 Apr 2020 34 days
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
SCLP SCLP-6426 Mar 2020 Apr 2020 13 days
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
bradleystoketownfc.com bradleystoketownfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
cainscrossrfc.org cainscrossrfc.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
canterburycityfc.net canterburycityfc.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
ydrfc.com ydrfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
dastelefonbuch.de dastelefonbuch.de
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Nov 2019 65 days
LIJI LIJI-230297 Sep 2019 Nov 2019 65 days
SCLP SCLP-6793 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
dressuppink.com dressuppink.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jul 2019 19 days
SVRN SVRN-230297 Jul 2019 Jul 2019 19 days
LIJI LIJI-230297 Jul 2019 Jul 2019 19 days
SCLP SCLP-6793 Jul 2019 Jul 2019 19 days
driffieldhockey.co.uk driffieldhockey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
durkarfc.co.uk durkarfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Mar 2020 37 days
SCLP SCLP-6793 Feb 2020 Mar 2020 37 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
IEX IEX-186266 Mar 2020 Mar 2020 One Off
eghamcricketclub.com eghamcricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
gamingwonderland.com gamingwonderland.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 328 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 328 days
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
IEX IEX-186266 Jan 2020 Jan 2020 One Off
knutsfordfootballclub.com knutsfordfootballclub.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
nameness.com nameness.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
nottinghamcorsairsrfc.com nottinghamcorsairsrfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
parkwoodrangersfc.co.uk parkwoodrangersfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
portisheadtownfc.com portisheadtownfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
soft32.it sharepod.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de ammyy-admin.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soderetube.com soderetube.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 May 2020 325 days
LIJI LIJI-230297 Jul 2019 May 2020 325 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
southperry.net southperry.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.it starter-background-changer.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.de surgeon-simulator.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.com.br teamspeak.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.it teamviewer.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it avast-free-antivirus.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br avg-antivirus-free.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de avira-free-antivirus.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it avira-free-antivirus.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Apr 2021 Apr 2021 10 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
thatchamrugby.co.uk thatchamrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
aylesburyunitedladiesgirlsfc.com aylesburyunitedladiesgirlsfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
soft32.it turbo-c.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de ultraedit.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
vandalrandom.com vandalrandom.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 281 days
LIJI LIJI-230297 Jul 2019 Apr 2020 281 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.es blender.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
soft32.de viber.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de virtualdub.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.de bluestacks-app-player.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.es bluestacks-app-player.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
vns33vns.com vns33vns.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
soft32.com.br vlc-media-player.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Apr 2021 Apr 2021 10 days
soft32.it vlc-media-player.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
bonessunitedfc.co.uk bonessunitedfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
bowdonrufc.co.uk bowdonrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.de windows-7.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.com.br windows-media-player-11.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de windows-media-player-11.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.es windows-media-player-11.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
soft32.de windows-xp-service-pack-2.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.es windows-xp-service-pack-2.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
wisbechtownfc.co.uk wisbechtownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
soft32.de winrar.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it winrar.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br winzip.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.de winzip.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de wizard101.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.com.br camtasia-studio.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.es camtasia-studio.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Dec 2020 Dec 2020 One Off
soft32.it camtasia-studio.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
chesterhc.co.uk chesterhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-539872073 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
chris-hemsworth.net chris-hemsworth.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
YIMO YIMO-2073946213921227802 Feb 2020 Feb 2020 One Off
climaxcraft.com climaxcraft.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 201 days
SCLP SCLP-6793 Jul 2020 Dec 2020 153 days
SCLP SCLP-390 Dec 2020 Apr 2021 105 days
soft32.es convertxtodvd.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
soft32.es cool-edit-pro.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
cprfc.com cprfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.it cpu-z.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
dressupgal.com dressupgal.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
soft32.com.br everest.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.de evernote.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
fitnessformen.co.id fitnessformen.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Feb 2012 Aug 2018 6 years, 181 days
CA CA-PUB-3746615079893481 May 2014 Sep 2015 1 year, 147 days
NR NR-4F6641B933 Jun 2018 Aug 2018 51 days
soft32.com.br flip4mac-wmv-player.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br foxit-reader.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 164 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
SCLP SCLP-6426 Sep 2020 Sep 2020 One Off
soft32.it free-cuda-video-converter.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it free-studio.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
giulio-garaffa.co.uk giulio-garaffa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
gomezgallery.org gomezgallery.org
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
rainhillcc.com rainhillcc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.es half-life-2-garrys-mod.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
soft32.de hamachi.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
hgujfc.co.uk hgujfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
htmlgames.com htmlgames.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 166 days
LIJI LIJI-230297 Jul 2019 Dec 2019 166 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
hullwyke.com hullwyke.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.es internet-download-manager.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Dec 2020 Dec 2020 One Off
soft32.de irfanview.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es irfanview.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
soft32.com.br java-runtime-environment.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it java-runtime-environment.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
jogo.cz jogo.cz
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
SVRN SVRN-230297 Jul 2019 Feb 2020 232 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
juegosaccion.es juegosaccion.es
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Dec 2019 171 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
soft32.de kmplayer.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de mackeeper.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
mahjongjeux.com mahjongjeux.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Dec 2019 176 days
SVRN SVRN-230297 Aug 2019 Oct 2019 62 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
merrowcc.co.uk merrowcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
soft32.com.br microsoft-project-professional.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de microsoft-project-professional.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br microsoft-security-essentials.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br mozilla-thunderbird.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br msn-messenger.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
ojogos.com.br ojogos.com.br
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 273 days
SVRN SVRN-230297 Jul 2019 Aug 2019 54 days
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
soft32.it onyx.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br openoffice.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
soft32.it openoffice.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.de opera-web-browser.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br outlook-express.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
parkroyalfc.co.uk parkroyalfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
soft32.it picasa.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de plants-vs-zombies.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de powerarchiver.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it powerpoint.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it proshow-gold.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
rickmansworthcc.co.uk rickmansworthcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
rugbyclub9.be rugbyclub9.be
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
soft32.es safari.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Dec 2020 Dec 2020 1 day
soft32.it safari.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br ad-aware-free-antivirus.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it advanced-systemcare.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
sckufu.com sckufu.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
PUBM PUBM-158039 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
soft32.com.br ammyy-admin.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.de skype.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it skype.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.es snagit.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-390 Apr 2021 Apr 2021 1 day
012744.com 012744.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Sep 2019 One Off
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
sthelensfc.co.uk sthelensfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
soft32.com.br teamviewer.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.com.br avira-antivir-premium.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
avrojfc.org avrojfc.org
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
aylesburyvaledynamos.co.uk aylesburyvaledynamos.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
thelakewoodscoop.com thelakewoodscoop.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jul 2020 364 days
LIJI LIJI-230297 Jul 2019 Jul 2020 364 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
badgersrugby.com badgersrugby.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
torpointafc.co.uk torpointafc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Jan 2020 One Off
IEX IEX-186779 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
berkswichfc.co.uk berkswichfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
soft32.com.br viber.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br bluestacks-app-player.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it bluestacks-app-player.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.it wamp.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
warhistoryonline.com warhistoryonline.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 May 2020 305 days
SCLP SCLP-390 Aug 2019 Jan 2020 154 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.de windows-live-movie-maker.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.com.br windows-xp-service-pack-2.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.de windows-xp-service-pack-3.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.com.br cdburnerxp.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br convertxtodvd.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de convertxtodvd.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de cpu-z.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br cyberlink-youcam.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Apr 2021 Apr 2021 10 days
didsburynorthernhc.co.uk didsburynorthernhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
dressup.com dressup.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
soft32.es drivermax.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
soft32.com.br dropbox.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it facebook-messenger.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.it flip4mac-wmv-player.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
gagapictures.com gagapictures.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Dec 2019 Dec 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
YIMO YIMO-2073946213921227802 Dec 2019 Dec 2019 One Off
gameranger.com gameranger.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 May 2020 Jun 2021 1 year, 42 days
SCLP SCLP-6426 May 2020 Jun 2021 1 year, 42 days
SCLP SCLP-6793 May 2020 Dec 2020 233 days
soft32.com.br google-earth.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de google-earth.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it google-earth.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br googlechrome.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.de googlechrome.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es hamachi.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
SCLP SCLP-6426 Jun 2021 Jun 2021 One Off
hrajhry.sk hrajhry.sk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
soft32.com.br hugin.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br icofx.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de icofx.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
indobig.ru indobig.ru
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Aug 2019 42 days
SCLP SCLP-6793 Jul 2019 Aug 2019 42 days
YIMO YIMO-2073946213921227802 Jul 2019 Aug 2019 42 days
soft32.com.br internet-download-manager.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de internet-download-manager.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br internet-explorer-for-mac.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es internet-explorer-for-mac.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
soft32.de iobit-uninstaller.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it itunes.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
juegosgestiontiempo.com juegosgestiontiempo.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 171 days
LIJI LIJI-230297 Jul 2019 Oct 2019 106 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
soft32.it kies.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.de kingsoft-office-free.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it kingsoft-office-free.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.it kmplayer.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
lcpdfr.com lcpdfr.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Feb 2020 Jun 2021 1 year, 113 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
llandaffrugby.org llandaffrugby.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
lplchampionship.com lplchampionship.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
soft32.com.br macx-dvd-ripper-pro.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it macx-dvd-ripper-pro.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
mallowrfc.com mallowrfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
match3spellen.nl match3spellen.nl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 176 days
LIJI LIJI-230297 Jul 2019 Dec 2019 176 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
soft32.com.br mathtype.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.es microsoft-net-framework.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
soft32.it minecraft.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
mineheroes.net mineheroes.net
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Jul 2020 Jun 2021 329 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-390 Jan 2021 Apr 2021 78 days
soft32.de mozilla-firefox.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de nero-burning-rom-2.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
nzpools.com nzpools.com
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Dec 2019 Mar 2020 91 days
IEX IEX-186266 Dec 2019 Dec 2019 One Off
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
soft32.es openoffice.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-390 Apr 2021 Apr 2021 1 day
soft32.it opera-web-browser-for-mac.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.de outlook-express.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.es paltalk.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
soft32.it parallels-desktop-for-mac.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it partition-magic.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
pinnstarsfc.com pinnstarsfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
soft32.de pokemon-emerald-version.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
SCLP SCLP-390 Apr 2021 Apr 2021 10 days
soft32.es powerpoint.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Dec 2020 Dec 2020 1 day
soft32.de pspad-editor.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it quick-media-converter.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
radcliffeolympic.co.uk radcliffeolympic.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
soft32.com.br rar-expander.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de acoustica-mp3-audio-mixer.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.com.br safari.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br skype.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.com.br slender.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.de slender.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
skyforcefc2.com skyforcefc2.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
askeansrfc.com askeansrfc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
0938zd.com 0938zd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
YIMO YIMO-2073946213921227802 Jan 2020 Jan 2020 One Off
soft32.com.br steam.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.it steam.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.it supertux.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.es surgeon-simulator.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
szbcnsbmw.com szbcnsbmw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
soft32.it avg-antivirus-free.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
theconcordinsider.com theconcordinsider.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
bandlfc.uk bandlfc.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
beginwithsoftware.com beginwithsoftware.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Nov 2019 140 days
SVRN SVRN-230297 Jul 2019 Nov 2019 140 days
FWHL FWHL-897697 Jan 2020 Mar 2020 45 days
bishops.ch bishops.ch
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
soft32.com.br bitlord.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it bitlord.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es viber.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
soft32.it viber.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.de virtual-dj.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it virtual-dj.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.de vlc-media-player.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es vlc-media-player.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Dec 2020 Dec 2020 1 day
soft32.es windows-live-movie-maker.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
soft32.com.br winrar.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
wollatonhallyfc.co.uk wollatonhallyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
RUB RUB-18110 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
soft32.de bullzip-pdf-printer.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.it bullzip-pdf-printer.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
wwwshe.com wwwshe.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
caithnessrugbyfootballclub.com caithnessrugbyfootballclub.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.es xnview.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
soft32.de camtasia-studio.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it cheat-engine.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.com.br corel-videostudio-pro.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
cuckfieldcosmosfc.co.uk cuckfieldcosmosfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
detailfun.club detailfun.club
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
soft32.it directx-redistributable.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.com.br drivermax.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.it dropbox.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
elycityfc.co.uk elycityfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-390 Feb 2020 Feb 2020 One Off
soft32.com.br emdb-erics-movie-database.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.com.br emule.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
exmouthrugby.co.uk exmouthrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.de filezilla.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it foxit-reader.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Feb 2021 153 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
SCLP SCLP-6426 Dec 2020 Feb 2021 51 days
ghacks.net ghacks.net
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Nov 2019 Nov 2019 One Off
OX OX-540553856 Nov 2019 Nov 2019 One Off
YIMO YIMO-2073946213921227802 Nov 2019 Nov 2019 One Off
giochimahjong.it giochimahjong.it
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Dec 2019 163 days
SVRN SVRN-230297 Jul 2019 Dec 2019 163 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
soft32.de glary-utilities.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
heddonjuniorsfootballclub.co.uk heddonjuniorsfootballclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
soft32.it internet-explorer-9.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de itunes.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
izzygames.com izzygames.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
juegos-mentales.com juegos-mentales.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 171 days
LIJI LIJI-230297 Jul 2019 Aug 2019 45 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
soft32.com.br kindle.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it kindle.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
kiz10.com kiz10.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.com.br kmplayer.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de libreoffice.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it libreoffice.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
mahee.com mahee.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
malvernvalefc.com malvernvalefc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
OX OX-540099026 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
match3.co.uk match3.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 176 days
LIJI LIJI-230297 Jul 2019 Dec 2019 176 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
soft32.it microsoft-net-framework.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es mozilla-firefox.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
soft32.de mozilla-thunderbird.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
mysearch.com mysearch.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
IEX IEX-186266 Apr 2020 Apr 2020 One Off
nesn.com nesn.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Aug 2019 Apr 2021 1 year, 236 days
SCLP SCLP-6793 Jul 2019 Apr 2020 284 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.de netscape-navigator.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.it network-inventory-advisor.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br orbit-downloader.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it outlook-express.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
pelikone.fi pelikone.fi
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Oct 2019 Mar 2020 155 days
LIJI LIJI-230297 Oct 2019 Mar 2020 155 days
IEX IEX-186266 Jan 2020 Mar 2020 90 days
pocklingtoncc.com pocklingtoncc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
soft32.com.br powerpoint.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de primopdf.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
qhdyryx.com qhdyryx.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Aug 2019 Aug 2019 One Off
LOOP LOOP-5918 Aug 2019 Aug 2019 One Off
SCLP SCLP-390 Aug 2019 Aug 2019 One Off
soft32.com.br quicktime.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Apr 2021 Apr 2021 10 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.es quicktime.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
SCLP SCLP-390 Apr 2021 Apr 2021 1 day
soft32.it rar-expander.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
relmz.io relmz.io
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Oct 2019 Apr 2020 154 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Jan 2020 Jan 2020 One Off
soft32.com.br advanced-systemcare.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de aimp.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
aktionspiele.de aktionspiele.de
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Nov 2019 122 days
SVRN SVRN-230297 Sep 2019 Nov 2019 65 days
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
soft32.de snagit.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de appcleaner.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
012795.com 012795.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
013871.com 013871.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
soft32.com.br super-mario-forever.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.it super-mario-forever.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.de teamviewer.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es teamviewer.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
SCLP SCLP-6793 Dec 2020 Dec 2020 1 day
arjun.tw arjun.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
thamehockey.co.uk thamehockey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 One Off
IEX IEX-186779 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
soft32.com.br avira-free-antivirus.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it toast-titanium.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br tor.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2020 Sep 2020 One Off
SCLP SCLP-6426 Oct 2020 Oct 2020 One Off
SCLP SCLP-390 Dec 2020 Dec 2020 One Off
soft32.de total-uninstall.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
tresenraya.com tresenraya.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Nov 2019 Nov 2019 One Off
soft32.de turbo-c.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de ultrasurf.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
valleyadvocate.com valleyadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.de blender.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
bletchleyrugby.com bletchleyrugby.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
soft32.es virtual-dj.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Dec 2020 Dec 2020 1 day
wbthc.org.uk wbthc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
wegotthiscovered.com wegotthiscovered.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Mar 2020 Apr 2020 34 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
SCLP SCLP-390 Nov 2019 Nov 2019 One Off
wimmelbildspiele.de wimmelbildspiele.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Nov 2019 65 days
LIJI LIJI-230297 Jul 2019 Jul 2019 17 days
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
soft32.de winamp.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br windows-7.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it windows-live-movie-maker.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it windows-xp-service-pack-2.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.com.br windows-xp-service-pack-3.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
broughtonraversjfc.com broughtonraversjfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
soft32.com.br winscp.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es winscp.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 174 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
bubbleshooter.net bubbleshooter.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Mar 2020 175 days
SVRN SVRN-230297 Jul 2019 Jul 2019 19 days
LIJI LIJI-230297 Jul 2019 Jul 2019 19 days
womenjoy.net womenjoy.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Nov 2019 137 days
LIJI LIJI-230297 Jul 2019 Nov 2019 137 days
FWHL FWHL-897697 Mar 2020 Apr 2020 34 days
worcestercityfc.org worcestercityfc.org
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
OX OX-540553856 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
bungy.paris bungy.paris
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Sep 2019 Sep 2019 One Off
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
YIMO YIMO-2073946213921227802 Sep 2019 Sep 2019 One Off
wykearlfc.co.uk wykearlfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
OX OX-540553856 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
zeitmanagementspiel.de zeitmanagementspiel.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Sep 2019 55 days
FWHL FWHL-897697 Mar 2020 Apr 2020 33 days
LIJI LIJI-230297 Jul 2019 Jul 2019 19 days
soft32.com.br chemsketch.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
comptonfc.co.uk comptonfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
ctshush.co.uk ctshush.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
deltacommunityu.com deltacommunityu.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
PUBM PUBM-158039 Sep 2019 Sep 2019 One Off
YUME YUME-102973855 Sep 2019 Sep 2019 One Off
drgbristol.com drgbristol.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
soft32.com.br eraser.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it everest.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.es evernote.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Dec 2020 Dec 2020 One Off
SCLP SCLP-6426 Jun 2021 Jun 2021 One Off
soft32.es filezilla.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
SCLP SCLP-6426 Jun 2021 Jun 2021 One Off
soft32.it full-dvd-ripper-free.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
gamefront.com gamefront.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jul 2019 19 days
SVRN SVRN-230297 Jul 2019 Jul 2019 19 days
LIJI LIJI-230297 Jul 2019 Jul 2019 19 days
gillinghamgreenfc.com gillinghamgreenfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.com.br gimp.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
giochi.it giochi.it
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 163 days
SCLP SCLP-390 Feb 2020 Mar 2020 35 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
gmx.net gmx.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
SCLP SCLP-6793 Apr 2020 Apr 2020 One Off
soft32.de half-life-2-garrys-mod.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br hamachi.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
heskethcoltsjfc.co.uk heskethcoltsjfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
hiddenobjectgames.com hiddenobjectgames.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Nov 2019 140 days
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
soft32.es hma-pro-vpn.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-390 Dec 2020 Apr 2021 114 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
hryzadarmo.sk hryzadarmo.sk
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
SVRN SVRN-230297 Oct 2019 Jun 2021 1 year, 245 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.de internet-explorer-10.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it internet-explorer-for-mac.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de kindle.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.com.br mhotspot.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.it microsoft-project-professional.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de microsoft-security-essentials.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.it microsoft-security-essentials.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
mindgames.com mindgames.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Nov 2019 140 days
LIJI LIJI-230297 Jul 2019 Sep 2019 75 days
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
soft32.de minecraft.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
minelink.net minelink.net
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Apr 2020 Jun 2021 1 year, 43 days
SCLP SCLP-390 Jun 2020 Apr 2021 302 days
SCLP SCLP-6793 May 2020 Dec 2020 223 days
soft32.com.br mozilla-firefox.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it mozilla-firefox.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es mozilla-thunderbird.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
soft32.com.br network-inventory-advisor.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.de notepad.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
ollertontownfc.co.uk ollertontownfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Mar 2020 Mar 2020 One Off
LOOP LOOP-5918 Mar 2020 Mar 2020 One Off
SCLP SCLP-6426 Mar 2020 Mar 2020 One Off
soft32.com.br opera-web-browser.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it opera-web-browser.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.it paint-net.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.it paintbrush.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.de paltalk.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.com.br partition-magic.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.de partition-magic.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es photoscape.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
soft32.de picasa.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.es pokemon-emerald-version.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
prideparkfc.com prideparkfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
soft32.com.br raidcall.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
rickey.org rickey.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Nov 2020 1 year, 135 days
LIJI LIJI-230297 Jul 2019 Nov 2020 1 year, 135 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
roachdynamosjfc.com roachdynamosjfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540099026 Apr 2020 Apr 2020 One Off
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
soft32.de advanced-systemcare.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
aireboroughrugby.com aireboroughrugby.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jan 2020 Jan 2020 One Off
OX OX-540553856 Jan 2020 Jan 2020 One Off
al3abmizo.com al3abmizo.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 210 days
LIJI LIJI-230297 Jul 2019 Jan 2020 210 days
alodokter.com alodokter.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2019 Feb 2021 1 year, 201 days
CA CA-PUB-2186101008500724 Apr 2020 Jun 2021 1 year, 60 days
cari-kos.com cari-kos.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 15 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 258 days
shugaban.com shugaban.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2020 Oct 2020 95 days
LIJI LIJI-230297 Jul 2020 Oct 2020 95 days
sihape.com sihape.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2019 Feb 2020 117 days
CA CA-PUB-1738284215641521 Apr 2020 Apr 2020 One Off
soft32.es silverlight.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
smelty.net smelty.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Apr 2020 215 days
LIJI LIJI-230297 Sep 2019 Apr 2020 215 days
soft32.com.br songr.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
soft32.de sphax-purebdcraft-craft.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Apr 2021 Apr 2021 10 days
spelletje.nl spelletje.nl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 278 days
LIJI LIJI-230297 Jul 2019 Apr 2020 278 days
1001jeuxenligne.fr 1001jeuxenligne.fr
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 293 days
LIJI LIJI-230297 Jul 2019 Apr 2020 293 days
1001jogos.com.br 1001jogos.com.br
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Mar 2020 110 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
1001spiele.jetzt 1001spiele.jetzt
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
suaramudanews.com suaramudanews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2020 Oct 2020 116 days
CA CA-PUB-2186101008500724 Dec 2020 Dec 2020 One Off
sumutpos.co sumutpos.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 Feb 2021 268 days
CA CA-PUB-2186101008500724 Sep 2020 Sep 2020 One Off
superhry.cz superhry.cz
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 230 days
SVRN SVRN-230297 Nov 2019 Jan 2020 65 days
swakarya.com swakarya.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 130 days
CA CA-PUB-1738284215641521 Oct 2020 Feb 2021 111 days
swara-bengkulu.com swara-bengkulu.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 8 days
CA CA-PUB-2186101008500724 Jun 2021 Jun 2021 6 days
atmeplay.com atmeplay.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jan 2020 Mar 2020 41 days
LIJI LIJI-230297 Jan 2020 Mar 2020 41 days
babyfynsy.com babyfynsy.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Apr 2020 206 days
LIJI LIJI-230297 Sep 2019 Apr 2020 206 days
baohomnay.com baohomnay.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Apr 2020 175 days
CA CA-PUB-1738284215641521 Nov 2019 Mar 2020 107 days
batamxinwen.com batamxinwen.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 112 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 47 days
soft32.it total-video.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
berowrafco35.com berowrafco35.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
LOOP LOOP-S-2411 Feb 2020 Feb 2020 One Off
tvblik.nl tvblik.nl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
ubomoney.net ubomoney.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Sep 2019 One Off
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
utdt.net utdt.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
YIMO YIMO-2073946213921227802 Jan 2020 Jan 2020 One Off
soft32.com.br visual-basic-express.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
vseigru.net vseigru.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
vynagame.com vynagame.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Sep 2019 70 days
LIJI LIJI-230297 Jul 2019 Sep 2019 70 days
boredomtherapy.com boredomtherapy.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jul 2019 19 days
SVRN SVRN-230297 Jul 2019 Jul 2019 19 days
waspada.co.id waspada.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Mar 2020 178 days
CA CA-PUB-2186101008500724 Nov 2019 Apr 2020 146 days
weeklycurrents.com weeklycurrents.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Sep 2019 Jan 2020 130 days
weeklyrecordherald.com weeklyrecordherald.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
SVRN SVRN-230297 Jul 2019 Jan 2020 201 days
wickedgoodgames.com wickedgoodgames.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
soft32.es windows-7.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
woozworld.com woozworld.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
wowgame24.com wowgame24.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
xacsx.de xacsx.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
xeniagazette.com xeniagazette.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
xsmb.vn xsmb.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2019 Nov 2019 168 days
CA CA-PUB-2186101008500724 Oct 2019 Jan 2020 89 days
yof.com yof.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Apr 2020 Jun 2021 1 year, 64 days
LIJI LIJI-230297 Apr 2020 Jun 2021 1 year, 64 days
yupoutlet.nl yupoutlet.nl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2020 Jun 2021 343 days
LIJI LIJI-230297 Jul 2020 Jun 2021 343 days
freevpn.us cdn-app.freevpn.us
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Jun 2021 60 days
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
zustelldienst-graz.at zustelldienst-graz.at
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Nov 2019 Apr 2020 144 days
LIJI LIJI-230297 Nov 2019 Apr 2020 144 days
jobplanet.com id.jobplanet.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Jun 2021 275 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 52 days
soft32.es cinema-4d.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
coffeebreakarcade.com coffeebreakarcade.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 257 days
LIJI LIJI-230297 Jul 2019 Mar 2020 257 days
soft32.de cool-edit-pro.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
soft32.it cyberlink-powerdirector.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
dijelas.in dijelas.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 35 days
CA CA-PUB-1738284215641521 Feb 2020 Feb 2021 1 year, 3 days
soft32.com.br directx-redistributable.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
enjoydressup.com enjoydressup.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Jul 2019 Apr 2020 265 days
soft32.de eraser.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
fairborndailyherald.com fairborndailyherald.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Jan 2020 Jan 2020 One Off
farah.id farah.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Jun 2021 303 days
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 74 days
soft32.de flight-simulator-x.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
soft32.es flight-simulator-x.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
fokusjabar.id fokusjabar.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Dec 2020 101 days
CA CA-PUB-1738284215641521 Nov 2020 Nov 2020 One Off
soft32.com.br free-cuda-video-converter.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es free-cuda-video-converter.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Dec 2020 Dec 2020 One Off
fynsy.ru fynsy.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 224 days
LIJI LIJI-230297 Aug 2019 Mar 2020 224 days
gamasexual.com gamasexual.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Feb 2020 228 days
LIJI LIJI-230297 Jul 2019 Feb 2020 228 days
gamebrott.com gamebrott.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2020 Dec 2020 197 days
CA CA-PUB-2186101008500724 Dec 2020 Dec 2020 One Off
gamexran.com gamexran.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2020 Jun 2020 One Off
CA CA-PUB-1738284215641521 Jun 2020 Jun 2020 One Off
genpi.co genpi.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2019 Jun 2020 1 year, 35 days
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 149 days
girlieplay.net girlieplay.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 225 days
LIJI LIJI-230297 Aug 2019 Mar 2020 225 days
soft32.es glary-utilities.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
goldhillfc.co.uk goldhillfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Feb 2020 Feb 2020 One Off
RUB RUB-18110 Feb 2020 Feb 2020 One Off
gsflash.ru gsflash.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 263 days
LIJI LIJI-230297 Jul 2019 Mar 2020 263 days
haluansumatera.com haluansumatera.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Jun 2021 193 days
CA CA-PUB-1738284215641521 Sep 2020 Jan 2021 109 days
harapanrakyat.com harapanrakyat.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Feb 2021 361 days
CA CA-PUB-1738284215641521 Mar 2020 Sep 2020 173 days
hellodog.eu hellodog.eu
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
hepy.be hepy.be
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hepy.es hepy.es
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hepy.fr hepy.fr
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hepy.games hepy.games
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hepy.it hepy.it
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hhcourier.com hhcourier.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
hoc247.vn hoc247.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Mar 2020 1 year, 17 days
CA CA-PUB-2186101008500724 Oct 2019 Feb 2020 116 days
soft32.de horizon.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
hrydnes.cz hrydnes.cz
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
hryprodivky.cz hryprodivky.cz
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
SVRN SVRN-230297 Jul 2019 Oct 2019 102 days
ilovearcade.com ilovearcade.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 265 days
LIJI LIJI-230297 Jul 2019 Mar 2020 265 days
ingyenesjatekok.hu ingyenesjatekok.hu
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Dec 2019 Feb 2020 63 days
LIJI LIJI-230297 Dec 2019 Feb 2020 63 days
soft32.de internet-explorer-for-mac.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
iotqdu.com iotqdu.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
IEX IEX-186266 Oct 2019 Oct 2019 One Off
isoladeigiochi.it isoladeigiochi.it
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 266 days
LIJI LIJI-230297 Jul 2019 Mar 2020 266 days
soft32.it istat-pro.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.com.br itunes.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
izzyjeux.fr izzyjeux.fr
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Aug 2019 Mar 2020 223 days
SVRN SVRN-230297 Jul 2019 Oct 2019 105 days
jagoanssh.com jagoanssh.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2020 349 days
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 152 days
soft32.de java-runtime-environment.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
jocuriin2.ro jocuriin2.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
joernalinakor.com joernalinakor.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 336 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 274 days
juegosdedescendientes.com juegosdedescendientes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 222 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
juegosdefutbol2020.com juegosdefutbol2020.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
kabargames.id kabargames.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 329 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 282 days
kids-n-fun.de kids-n-fun.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
kikirti.com kikirti.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Feb 2020 233 days
LIJI LIJI-230297 Jul 2019 Feb 2020 233 days
koalahero.com koalahero.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 318 days
CA CA-PUB-1738284215641521 Oct 2020 Feb 2021 131 days
kompastimur.com kompastimur.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Jan 2021 156 days
CA CA-PUB-1738284215641521 Jul 2020 Oct 2020 66 days
kreativv.com kreativv.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Jun 2021 211 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 52 days
kukispiele.de kukispiele.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Mar 2020 268 days
lensajatengnews.com lensajatengnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Oct 2020 Feb 2021 129 days
CA CA-PUB-2186101008500724 Dec 2020 Dec 2020 One Off
soft32.com.br libreoffice.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
limaohio.com limaohio.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
lylagames.com lylagames.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 270 days
LIJI LIJI-230297 Jul 2019 Mar 2020 270 days
soft32.com.br mackeeper.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
mahjong-spiele.at mahjong-spiele.at
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Oct 2019 Feb 2020 124 days
LIJI LIJI-230297 Oct 2019 Feb 2020 124 days
mahjongspelen.nl mahjongspelen.nl
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jan 2020 205 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
mary.com mary.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
soft32.it mathtype.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
mediaempatlawang.com mediaempatlawang.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 86 days
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 16 days
soft32.com.br microsoft-net-framework.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es microsoft-project-professional.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
midhurstandeasebournefc.co.uk midhurstandeasebournefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2019 Dec 2019 One Off
RUB RUB-18110 Dec 2019 Dec 2019 One Off
mngdoom.com mngdoom.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Aug 2019 51 days
SCLP SCLP-390 Oct 2019 Oct 2019 One Off
moneyfazz.id moneyfazz.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Aug 2020 Aug 2020 One Off
CA CA-PUB-2186101008500724 Oct 2020 Oct 2020 One Off
soft32.it mozilla-thunderbird.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
mubapostnews.com mubapostnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2021 Jan 2021 One Off
CA CA-PUB-2186101008500724 Mar 2021 Mar 2021 One Off
onews-id.com onews-id.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2020 Jun 2021 244 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 64 days
soft32.com.br onyx.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
ooredooplay.com ooredooplay.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Oct 2019 Mar 2020 155 days
LIJI LIJI-230297 Oct 2019 Mar 2020 155 days
pandagila.com pandagila.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Jun 2021 1 year, 73 days
CA CA-PUB-1738284215641521 Feb 2020 Feb 2021 351 days
playcombo.com playcombo.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 285 days
LIJI LIJI-230297 Jul 2019 Apr 2020 285 days
playmob.tv playmob.tv
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jan 2020 Apr 2020 90 days
LIJI LIJI-230297 Jan 2020 Apr 2020 90 days
playzzz.com playzzz.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Apr 2020 218 days
LIJI LIJI-230297 Aug 2019 Apr 2020 218 days
pomu.com pomu.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
pomu.dk pomu.dk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
pomu.no pomu.no
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
popa.hk popa.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
pregnancy.co.id pregnancy.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Jun 2015 Mar 2016 292 days
CA CA-PUB-3746615079893481 Apr 2015 Dec 2015 242 days
publiksatu.co publiksatu.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
soft32.com.br quick-media-converter.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
registerherald.com registerherald.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Nov 2019 Apr 2020 144 days
ruangrakyat.com ruangrakyat.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Nov 2019 9 days
CA CA-PUB-1738284215641521 Jul 2019 Jul 2019 One Off
soft32.de acdsee.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
seasia.co seasia.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Jun 2020 1 year, 114 days
CA CA-PUB-2186101008500724 Oct 2019 Nov 2020 1 year, 22 days
selipan.com selipan.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Apr 2021 1 year, 173 days
selembardigital.com selembardigital.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Jun 2021 275 days
CA CA-PUB-1738284215641521 Oct 2020 Feb 2021 114 days
serumpi.com serumpi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Apr 2021 1 year, 162 days
CA CA-PUB-1738284215641521 Mar 2019 Apr 2020 1 year, 31 days
shayef.net shayef.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Nov 2019 May 2020 196 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
shefford-saints.com shefford-saints.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Jul 2020 Jul 2020 One Off
LOOP LOOP-S-2411 Jul 2020 Jul 2020 One Off
soft32.es ammyy-admin.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
mimin.tv mimin.tv
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 85 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 65 days
soft32.es skype.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
stacyontheright.com stacyontheright.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
LOOP LOOP-5918 Jan 2020 Jan 2020 One Off
014931.com 014931.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
1001jeux.ca 1001jeux.ca
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 293 days
LIJI LIJI-230297 Jul 2019 Apr 2020 293 days
1001jeux.fr 1001jeux.fr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
IEX IEX-186266 Aug 2019 Sep 2019 25 days
1001juegos.com.co 1001juegos.com.co
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Nov 2019 Apr 2020 152 days
LIJI LIJI-230297 Nov 2019 Apr 2020 152 days
1001juegos.com.mx 1001juegos.com.mx
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Nov 2019 Apr 2020 152 days
LIJI LIJI-230297 Nov 2019 Apr 2020 152 days
abadikini.com abadikini.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Jun 2021 1 year, 61 days
CA CA-PUB-1738284215641521 Mar 2020 Feb 2021 338 days
sultranews.co.id sultranews.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
CA CA-PUB-2186101008500724 Feb 2021 Feb 2021 One Off
soft32.com.br supertux.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
suratkabar.id suratkabar.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Jul 2020 269 days
CA CA-PUB-1738284215641521 Mar 2019 Mar 2019 24 days
atbakfit.com atbakfit.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 288 days
LIJI LIJI-230297 Jul 2019 Apr 2020 288 days
tdn-net.com tdn-net.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 May 2020 305 days
LIJI LIJI-230297 Jul 2019 May 2020 305 days
soft32.es audacity.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
terkini.id terkini.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 May 2020 78 days
CA CA-PUB-2186101008500724 Mar 2020 May 2020 78 days
soft32.es avira-antivir-premium.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
bacaterus.com bacaterus.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Apr 2021 1 year, 31 days
CA CA-PUB-1738284215641521 Jan 2020 Jul 2020 169 days
topfree.de topfree.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Nov 2019 Apr 2020 149 days
LIJI LIJI-230297 Nov 2019 Apr 2020 149 days
soft32.com.br tor-browser.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
bebingtonhockeyclub.com bebingtonhockeyclub.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jan 2020 Jan 2020 One Off
RUB RUB-18110 Jan 2020 Jan 2020 One Off
tudonav.com tudonav.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 280 days
LIJI LIJI-230297 Jul 2019 Apr 2020 280 days
blockchainmedia.id blockchainmedia.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 17 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 280 days
vtworld.co vtworld.co
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jul 2019 Sep 2019 54 days
LIJI LIJI-230297 Jul 2019 Jul 2019 16 days
soft32.es weatherbug.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
brankaspedia.com brankaspedia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
bronav.com bronav.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
soft32.it windows-xp-service-pack-3.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
soft32.es winzip.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
wnewsj.com wnewsj.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Sep 2019 Apr 2020 209 days
wowgame.jp wowgame.jp
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
wroxhamfc.club wroxhamfc.club
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
soft32.es ccleaner.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
zoxok.com zoxok.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
jawaracorpo.com m.jawaracorpo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Jun 2021 60 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 52 days
claycrosstownfc.com claycrosstownfc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
communitycommon.com communitycommon.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Nov 2019 Jan 2020 65 days
soft32.es corel-videostudio-pro.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
soft32.es cpu-z.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
cstore.mobi cstore.mobi
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Feb 2020 131 days
LIJI LIJI-230297 Sep 2019 Feb 2020 131 days
dailycall.com dailycall.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 265 days
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
deteksionline.com deteksionline.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 108 days
CA CA-PUB-1738284215641521 Jan 2021 Jan 2021 One Off
elib.vn elib.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2020 343 days
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 146 days
fcnews.org fcnews.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
femaledaily.net femaledaily.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
fhm.co.id fhm.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 May 2012 Apr 2018 5 years, 348 days
CA CA-PUB-3746615079893481 Oct 2013 May 2016 2 years, 218 days
soft32.de fraps.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
friv-2020.com friv-2020.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Feb 2021 328 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
friv2020.us friv2020.us
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Feb 2021 328 days
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
futuristarchitecture.com futuristarchitecture.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 153 days
CA CA-PUB-2186101008500724 Jul 2020 Jul 2020 One Off
fynsy.com fynsy.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 224 days
LIJI LIJI-230297 Aug 2019 Mar 2020 224 days
gameee.ru gameee.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 224 days
LIJI LIJI-230297 Aug 2019 Mar 2020 224 days
gamesclub.com gamesclub.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
soft32.it gimp.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
gioco.it gioco.it
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Feb 2020 228 days
FWHL FWHL-897697 Dec 2019 Feb 2020 65 days
gmo.jp gmo.jp
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 327 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 327 days
soft32.com.br gom-player.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
hellokids.com hellokids.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
LIJI LIJI-230297 Jul 2019 Jan 2020 205 days
hhrfc.co.uk hhrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
OX OX-540553856 Feb 2020 Feb 2020 One Off
hrajted.cz hrajted.cz
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 265 days
LIJI LIJI-230297 Jul 2019 Mar 2020 265 days
soft32.it ibm-spss-statistics.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
ichannel.mobi ichannel.mobi
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Oct 2019 103 days
LIJI LIJI-230297 Jul 2019 Oct 2019 103 days
igreya.ru igreya.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 223 days
LIJI LIJI-230297 Aug 2019 Mar 2020 223 days
soft32.es internet-explorer-10.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
iplayer.com.ua iplayer.com.ua
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Oct 2019 Mar 2020 162 days
LIJI LIJI-230297 Oct 2019 Mar 2020 162 days
jawaracorpo.com jawaracorpo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Jun 2021 1 year, 81 days
CA CA-PUB-1738284215641521 Feb 2020 Feb 2021 359 days
jeanettegy.com jeanettegy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
CA CA-PUB-1738284215641521 Jun 2019 Feb 2021 1 year, 231 days
jejakpiknik.com jejakpiknik.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 152 days
CA CA-PUB-1738284215641521 Oct 2019 Oct 2019 One Off
joacajocuri.ro joacajocuri.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
jocuriaparate.com jocuriaparate.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
jocuridefotbal.com jocuridefotbal.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
jocurionline.ro jocurionline.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
jogosbr.net jogosbr.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
jogosdeplantasvszumbis.co jogosdeplantasvszumbis.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 161 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.it joomla.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
juegosderalpheldemoledor.net juegosderalpheldemoledor.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Feb 2020 187 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
kakkun.jp kakkun.jp
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
keepo.me keepo.me
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Jun 2021 1 year, 114 days
CA CA-PUB-1738284215641521 Dec 2019 Dec 2019 One Off
ketquasieutoc.com ketquasieutoc.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Oct 2019 Feb 2021 1 year, 118 days
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 154 days
kids-n-fun.co.uk kids-n-fun.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
kids-n-fun.nl kids-n-fun.nl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 268 days
LIJI LIJI-230297 Jul 2019 Mar 2020 268 days
lahathotline.com lahathotline.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2020 Jun 2021 252 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 68 days
lampung.co lampung.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Jun 2021 295 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 274 days
lensajabar.com lensajabar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2020 Jun 2021 251 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 68 days
listph.com listph.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
lokerjakarta.id lokerjakarta.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2019 Dec 2020 348 days
CA CA-PUB-1738284215641521 Feb 2020 Dec 2020 289 days
lowonganhoteljakarta.com lowonganhoteljakarta.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Jun 2021 1 year, 112 days
CA CA-PUB-1738284215641521 Dec 2019 Feb 2021 1 year, 50 days
magdalene.co magdalene.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Jun 2020 235 days
CA CA-PUB-1738284215641521 May 2020 May 2020 One Off
mahee.es mahee.es
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Dec 2019 176 days
SVRN SVRN-230297 Jul 2019 Oct 2019 111 days
mankiz.com mankiz.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
mediasulsel.com mediasulsel.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Feb 2021 207 days
CA CA-PUB-2186101008500724 Jun 2020 Jun 2020 One Off
mobitekno.com mobitekno.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Jun 2020 Jun 2021 361 days
mosalsalat.online mosalsalat.online
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 May 2020 318 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
moviestarplanet.ca moviestarplanet.ca
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 185 days
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
moviestarplanet.pl moviestarplanet.pl
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Sep 2019 Mar 2020 175 days
SVRN SVRN-230297 Jul 2019 Nov 2019 120 days
mydailysentinel.com mydailysentinel.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
najjox.com najjox.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Feb 2020 One Off
LIJI LIJI-230297 Feb 2020 Feb 2020 One Off
nurfc.com nurfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
okaytab.com okaytab.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 273 days
LIJI LIJI-230297 Jul 2019 Mar 2020 273 days
onghutgao.net onghutgao.net
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
YIMO YIMO-2073946213921227802 Oct 2019 Oct 2019 One Off
panduaji.net panduaji.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 332 days
CA CA-PUB-1738284215641521 Aug 2020 Feb 2021 167 days
penjaranews.com penjaranews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Oct 2020 45 days
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
soft32.it photoscape.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
pomu.at pomu.at
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
pomu.de pomu.de
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 290 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
pomu.vn pomu.vn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
ponsy.net ponsy.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Apr 2020 218 days
LIJI LIJI-230297 Aug 2019 Apr 2020 218 days
portsmouth-dailytimes.com portsmouth-dailytimes.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 May 2020 286 days
LIJI LIJI-230297 Jul 2019 May 2020 286 days
puzzleguys.com puzzleguys.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 275 days
LIJI LIJI-230297 Jul 2019 Apr 2020 275 days
pvpro.com pvpro.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Aug 2019 Aug 2019 One Off
SCLP SCLP-6793 Aug 2019 Aug 2019 One Off
rcmmj.com rcmmj.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Apr 2020 Apr 2020 One Off
LIJI LIJI-230297 Apr 2020 Apr 2020 One Off
femaledaily.com reviews.femaledaily.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 122 days
CA CA-PUB-1738284215641521 Nov 2020 Nov 2020 One Off
abouttng.com abouttng.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 39 days
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 88 days
adwickwarriorsjfc.co.uk adwickwarriorsjfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
selular.id selular.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2020 Nov 2020 139 days
CA CA-PUB-2186101008500724 May 2020 Sep 2020 115 days
sigap88.co sigap88.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 123 days
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 10 days
siwalimanews.com siwalimanews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2020 Jun 2021 235 days
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 162 days
skojspel.se skojspel.se
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 278 days
LIJI LIJI-230297 Jul 2019 Apr 2020 278 days
sneakers.co.id sneakers.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Jun 2021 1 year, 104 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 268 days
sodereondemand.com sodereondemand.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 May 2020 305 days
LIJI LIJI-230297 Jul 2019 May 2020 305 days
spielkarussell.de spielkarussell.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Jan 2020 130 days
LIJI LIJI-230297 Sep 2019 Jan 2020 130 days
soft32.com.br avast-free-antivirus.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-390 Apr 2021 Apr 2021 10 days
011546.com 011546.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
014250.com 014250.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
striker.id striker.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Feb 2021 1 year, 102 days
sultrademo.co sultrademo.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 131 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 59 days
analisaaceh.com analisaaceh.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 Feb 2021 262 days
CA CA-PUB-2186101008500724 Apr 2021 Jun 2021 60 days
asumsi.co asumsi.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Aug 2020 286 days
CA CA-PUB-1738284215641521 May 2020 Sep 2020 111 days
soft32.it teamspeak.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
autocarindonesia.com autocarindonesia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-3746615079893481 Jul 2015 Apr 2016 280 days
UA UA-4418968 Aug 2017 Sep 2017 26 days
soft32.es avira-free-antivirus.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
ayahbunda.co.id ayahbunda.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
CA CA-PUB-1738284215641521 Apr 2020 Apr 2020 One Off
ayokuliah.id ayokuliah.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 Jul 2020 75 days
CA CA-PUB-2186101008500724 Aug 2020 Sep 2020 40 days
badtameezdilweb.net badtameezdilweb.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
bananagiveaway.com bananagiveaway.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
tobasatu.com tobasatu.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
CA CA-PUB-1738284215641521 Apr 2020 Feb 2021 310 days
totanav.com totanav.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 280 days
LIJI LIJI-230297 Jul 2019 Apr 2020 280 days
bedworthrfc.co.uk bedworthrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Mar 2020 Mar 2020 One Off
SCLP SCLP-390 Mar 2020 Mar 2020 One Off
transportumum.com transportumum.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Jun 2021 179 days
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 6 days
belajarmtk.com belajarmtk.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Aug 2020 146 days
CA CA-PUB-2186101008500724 May 2020 Jul 2020 41 days
beritabitcoin.id beritabitcoin.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Nov 2020 One Off
CA CA-PUB-2186101008500724 Feb 2021 Feb 2021 One Off
bewarajabar.com bewarajabar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Jun 2021 1 year, 58 days
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 89 days
urbanasia.com urbanasia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 153 days
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
bishopsstortfordcc.com bishopsstortfordcc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-5918 Apr 2020 Apr 2020 One Off
OX OX-540099026 Apr 2020 Apr 2020 One Off
warda.com warda.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
btczone.xyz btczone.xyz
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Sep 2019 One Off
LIJI LIJI-230297 Sep 2019 Sep 2019 One Off
soft32.com.br windows-live-messenger.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
soft32.com.br windows-live-movie-maker.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Oct 2020 Jun 2021 234 days
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
soft32.es windows-xp-service-pack-3.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-390 Dec 2020 Apr 2021 115 days
bubugames.com bubugames.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
bukamatanews.id bukamatanews.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 329 days
CA CA-PUB-1738284215641521 Jul 2020 Feb 2021 218 days
wowgame.tv wowgame.tv
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
wuki.com wuki.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 209 days
IEX IEX-186266 Mar 2020 Mar 2020 One Off
wyspagier.pl wyspagier.pl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 185 days
LIJI LIJI-230297 Jul 2019 Jan 2020 185 days
xem.vn xem.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Mar 2020 1 year, 2 days
CA CA-PUB-2186101008500724 Oct 2019 Apr 2020 169 days
xosodaiviet.net xosodaiviet.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Mar 2020 177 days
CA CA-PUB-2186101008500724 Oct 2019 Apr 2020 169 days
soft32.de cdburnerxp.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
soft32.de zoo-tycoon.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
soft32.es zoo-tycoon.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
cookly.mobi cookly.mobi
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
soft32.it debut-pro-edition-for-mac.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
delgazette.com delgazette.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
dimaspratama20.com dimaspratama20.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Mar 2020 One Off
CA CA-PUB-1738284215641521 Apr 2020 Apr 2020 One Off
eastlancsleague.com eastlancsleague.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
PUBM PUBM-158039 Feb 2020 Feb 2020 One Off
englewoodindependent.com englewoodindependent.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 265 days
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
facetofeet.com facetofeet.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
fog-game.ru fog-game.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Jun 2021 1 year, 120 days
LIJI LIJI-230297 Feb 2020 Jun 2021 1 year, 120 days
soft32.com.br free-studio.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
soft32.es free-studio.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Dec 2020 Dec 2020 One Off
friv.ro friv.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
friv2020.com.br friv2020.com.br
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
gadjian.com gadjian.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 338 days
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 154 days
gaiviettraitay.com gaiviettraitay.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2019 Mar 2020 100 days
CA CA-PUB-2186101008500724 Feb 2020 Mar 2020 34 days
galioninquirer.com galioninquirer.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
gamesya.com gamesya.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 262 days
LIJI LIJI-230297 Jul 2019 Mar 2020 262 days
gamex.co.in gamex.co.in
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Feb 2020 190 days
LIJI LIJI-230297 Aug 2019 Feb 2020 190 days
genpinews.com genpinews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Jun 2021 260 days
CA CA-PUB-1738284215641521 Jun 2020 Feb 2021 250 days
ghozaliq.com ghozaliq.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Nov 2020 290 days
CA CA-PUB-1738284215641521 Dec 2019 Mar 2020 100 days
soft32.de gimp.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
giocare.it giocare.it
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
girlieplay.com girlieplay.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 225 days
LIJI LIJI-230297 Aug 2019 Mar 2020 225 days
soft32.it gom-player.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
goodhousekeeping.co.id goodhousekeeping.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Feb 2012 Aug 2015 3 years, 167 days
CA CA-PUB-3746615079893481 Oct 2013 Nov 2013 14 days
soft32.es googlechrome.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
grabfreegame.com grabfreegame.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
hepy.at hepy.at
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hepy.pl hepy.pl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hepy.ro hepy.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
higo.id higo.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 May 2021 163 days
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 27 days
soft32.de hma-pro-vpn.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Oct 2020 Dec 2020 60 days
hoofa.net hoofa.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 224 days
LIJI LIJI-230297 Aug 2019 Mar 2020 224 days
soft32.es horizon.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
hryprebaby.sk hryprebaby.sk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Oct 2019 102 days
LIJI LIJI-230297 Jul 2019 Oct 2019 102 days
icanplay.ru icanplay.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Mar 2020 223 days
LIJI LIJI-230297 Aug 2019 Mar 2020 223 days
icarusfc.co.uk icarusfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
soft32.es icofx.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
indonesiadesign.com indonesiadesign.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
inilahmuaraenim.co.id inilahmuaraenim.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 Jun 2021 28 days
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 22 days
soft32.de istat-pro.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.es itunes.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Dec 2020 Dec 2020 One Off
soft32.es java-runtime-environment.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
jeux-jeu.fr jeux-jeu.fr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 303 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
jocuri-fete.ro jocuri-fete.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
jocurimasini.ro jocurimasini.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
juegosjuegos.com juegosjuegos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 209 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
juegossolitario.com juegossolitario.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Aug 2019 45 days
SVRN SVRN-230297 Oct 2019 Oct 2019 One Off
haluan.co kepri.haluan.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 154 days
CA CA-PUB-2186101008500724 Nov 2020 Dec 2020 38 days
soft32.es kmplayer.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
knobelspiele.com knobelspiele.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 172 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
kuliahkechina.com kuliahkechina.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2020 Feb 2020 One Off
CA CA-PUB-2186101008500724 Mar 2020 Mar 2020 One Off
lokerbali.info lokerbali.info
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2020 Jun 2021 364 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 67 days
lulaot.co.il lulaot.co.il
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
soft32.it mackeeper.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
mahirphotoshop.com mahirphotoshop.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2019 Feb 2021 1 year, 273 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
mahjonganime.com mahjonganime.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Dec 2019 Mar 2020 94 days
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
mediakendari.com mediakendari.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Apr 2021 114 days
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
soft32.de microsoft-3d-pinball-space-cadet.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
soft32.es microsoft-security-essentials.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Dec 2020 Dec 2020 1 day
mommiesdaily.com mommiesdaily.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Sep 2020 Jun 2021 275 days
moodspike.com moodspike.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
morrowcountysentinel.com morrowcountysentinel.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
SVRN SVRN-230297 Sep 2019 Apr 2020 209 days
moviestarplanet.co.uk moviestarplanet.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Apr 2020 209 days
LIJI LIJI-230297 Nov 2019 Apr 2020 144 days
moviestarplanet.com moviestarplanet.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 284 days
LIJI LIJI-230297 Jul 2019 Apr 2020 284 days
moviestarplanet.dk moviestarplanet.dk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 264 days
LIJI LIJI-230297 Nov 2019 Apr 2020 144 days
mydailytribune.com mydailytribune.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 231 days
SVRN SVRN-230297 Nov 2019 Jan 2020 65 days
mymacsense.com mymacsense.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 May 2021 170 days
CA CA-PUB-1738284215641521 Jan 2021 Jan 2021 One Off
najox.com najox.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 272 days
LIJI LIJI-230297 Jul 2019 Mar 2020 272 days
nangunsatkerthilokabali.com nangunsatkerthilokabali.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 May 2021 66 days
CA CA-PUB-1738284215641521 Jan 2021 Jan 2021 One Off
niaga.asia niaga.asia
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 137 days
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 15 days
okeyboz.com okeyboz.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 89 days
CA CA-PUB-2186101008500724 Apr 2021 Jun 2021 60 days
femaledaily.net reviews.femaledaily.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Jun 2021 261 days
CA CA-PUB-1738284215641521 Aug 2020 Feb 2021 181 days
soft32.es outlook-express.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
parenting.co.id parenting.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Jun 2021 288 days
CA CA-PUB-1738284215641521 Jul 2020 Feb 2021 210 days
pelitabanten.com pelitabanten.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 May 2020 One Off
CA CA-PUB-1738284215641521 Sep 2020 Sep 2020 One Off
rimma.co rimma.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
pilarsumsel.com pilarsumsel.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 79 days
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 13 days
pomu.fr pomu.fr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 290 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
pomu.nl pomu.nl
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
pomu.uk pomu.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.de powerpoint.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
recordherald.com recordherald.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 265 days
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
soft32.de safari.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
dotmsr.com dotmsr.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Sep 2019 Nov 2019 65 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
saibumi.com saibumi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Jun 2020 1 year, 96 days
CA CA-PUB-2186101008500724 Oct 2019 May 2020 207 days
soft32.es advanced-systemcare.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
aldridgerfc.co.uk aldridgerfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Mar 2020 Mar 2020 One Off
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
sidneydailynews.com sidneydailynews.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
ameks.id ameks.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 19 days
CA CA-PUB-1738284215641521 Aug 2020 Feb 2021 191 days
soft32.it ammyy-admin.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6793 Dec 2020 Dec 2020 8 days
skor.id skor.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jul 2020 61 days
CA CA-PUB-1738284215641521 Jun 2020 Jun 2020 One Off
smartphoneku.com smartphoneku.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Dec 2020 1 year, 270 days
CA CA-PUB-2186101008500724 Oct 2019 Apr 2021 1 year, 173 days
solitaire.com solitaire.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
LIJI LIJI-230297 Jul 2019 Jan 2020 205 days
spiele-umsonst.de spiele-umsonst.de
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Nov 2019 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
spielpanda.de spielpanda.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Apr 2020 34 days
LIJI LIJI-230297 Mar 2020 Apr 2020 34 days
suarasurabaya.net suarasurabaya.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2020 Jun 2021 1 year, 153 days
CA CA-PUB-1738284215641521 Nov 2019 Feb 2021 1 year, 97 days
swantonenterprise.com swantonenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 250 days
SVRN SVRN-230297 Jul 2019 Sep 2019 75 days
sxmb.vn sxmb.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Feb 2021 1 year, 160 days
CA CA-PUB-2186101008500724 Oct 2019 Apr 2020 165 days
tagar.id tagar.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2020 May 2020 128 days
CA CA-PUB-2186101008500724 May 2020 May 2020 One Off
atmegame.com atmegame.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 254 days
SVRN SVRN-230297 Jul 2019 Sep 2019 82 days
technologytimes.pk technologytimes.pk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Jul 2020 One Off
CA CA-PUB-2186101008500724 Nov 2020 Nov 2020 One Off
tek.id tek.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 24 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 267 days
auto-car.co.id auto-car.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Nov 2011 Oct 2013 1 year, 332 days
CA CA-PUB-3746615079893481 Oct 2013 Oct 2013 One Off
soft32.com.br tetris.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
theedgesingapore.com theedgesingapore.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
thuvienmienphi.com thuvienmienphi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2019 Jan 2020 231 days
CA CA-PUB-2186101008500724 Oct 2019 Jan 2020 82 days
timesindonesia.co.id timesindonesia.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2020 Jun 2020 One Off
CA CA-PUB-2186101008500724 Jul 2020 Jul 2020 One Off
tokagames.com tokagames.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jan 2020 Apr 2020 79 days
LIJI LIJI-230297 Jan 2020 Apr 2020 79 days
traxmagz.com traxmagz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Aug 2013 Aug 2016 3 years, 29 days
CA CA-PUB-3746615079893481 Oct 2013 Feb 2016 2 years, 112 days
tuikhonmuondoi.com tuikhonmuondoi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Mar 2020 179 days
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 132 days
soft32.com.br turbo-c.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
ugonki.ru ugonki.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 281 days
LIJI LIJI-230297 Nov 2019 Jan 2020 65 days
urbanacitizen.com urbanacitizen.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 303 days
SVRN SVRN-230297 Jul 2019 Mar 2020 250 days
vandaliadrummernews.com vandaliadrummernews.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Jul 2019 Mar 2020 231 days
bishopscanningsfc.com bishopscanningsfc.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
bisniswisata.co.id bisniswisata.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 341 days
CA CA-PUB-1738284215641521 Jul 2020 Feb 2021 205 days
blacknews.com blacknews.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 May 2020 May 2020 One Off
soft32.com.br virtual-dj.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
vosjeux.fr vosjeux.fr
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jul 2019 16 days
LIJI LIJI-230297 Jul 2019 Jul 2019 16 days
wartainspirasi.com wartainspirasi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 127 days
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 5 days
breatheheavy.com breatheheavy.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Sep 2019 Apr 2020 209 days
LIJI LIJI-230297 Sep 2019 Apr 2020 209 days
soft32.es winrar.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
soft32.es bullzip-pdf-printer.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
wowgirls.jp wowgirls.jp
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Apr 2020 282 days
LIJI LIJI-230297 Jul 2019 Apr 2020 282 days
burgtelegram.com burgtelegram.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 230 days
SVRN SVRN-230297 Sep 2019 Jan 2020 130 days
bzuu.com.br bzuu.com.br
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Sep 2019 86 days
LIJI LIJI-230297 Jul 2019 Sep 2019 86 days
yangcanggih.com yangcanggih.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
zonautara.com zonautara.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Oct 2020 203 days
CA CA-PUB-1738284215641521 Mar 2020 Mar 2020 One Off
cinemags.co.id cinemags.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Jun 2021 1 year, 129 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 279 days
soft32.es corel-paint-shop-pro.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
soft32.com.br counter-strike.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
ctbet3.com ctbet3.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
SCLP SCLP-6793 Mar 2020 Mar 2020 One Off
cutezee.com cutezee.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jun 2021 1 year, 347 days
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
dailyadvocate.com dailyadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Nov 2019 Mar 2020 110 days
disposisi.com disposisi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 159 days
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 76 days
droitwichspaladiesfc.co.uk droitwichspaladiesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Feb 2020 Feb 2020 One Off
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
soft32.de dropbox.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
emahjong.ro emahjong.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 260 days
LIJI LIJI-230297 Jul 2019 Mar 2020 260 days
escapeclub.jp escapeclub.jp
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 261 days
LIJI LIJI-230297 Jul 2019 Mar 2020 261 days
farfeshplus.com farfeshplus.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Oct 2019 Apr 2020 195 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
fidonav.com fidonav.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 May 2020 313 days
LIJI LIJI-230297 Jul 2019 May 2020 313 days
hepy.de hepy.de
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hepy.dk hepy.dk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
hepy.nl hepy.nl
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Mar 2020 Mar 2020 One Off
LIJI LIJI-230297 Mar 2020 Mar 2020 One Off
foto.co.id foto.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 319 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 277 days
freevpn.us freevpn.us
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
soft32.com.br fruity-loops.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
gaagjescraft.net gaagjescraft.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Aug 2019 38 days
SVRN SVRN-230297 Jul 2019 Aug 2019 38 days
gadgetren.com gadgetren.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
gamasexual.ru gamasexual.ru
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 262 days
LIJI LIJI-230297 Jul 2019 Mar 2020 262 days
gameesusgudd.fun gameesusgudd.fun
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
SVRN SVRN-230297 Dec 2019 Dec 2019 One Off
gameloft.com gameloft.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 May 2020 286 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
gamezebo.com gamezebo.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 265 days
SVRN SVRN-230297 Jul 2019 Apr 2020 265 days
giochisolitario.it giochisolitario.it
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 163 days
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
gladespil.dk gladespil.dk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 263 days
LIJI LIJI-230297 Jul 2019 Mar 2020 263 days
gurugeografi.id gurugeografi.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Jul 2020 145 days
CA CA-PUB-1738284215641521 Aug 2020 Aug 2020 One Off
hancinema.net hancinema.net
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2019 Mar 2020 175 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
hargabulanini.com hargabulanini.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Jun 2020 78 days
CA CA-PUB-1738284215641521 Jun 2020 Jun 2020 One Off
soft32.it hma-pro-vpn.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Dec 2020 Apr 2021 122 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
howieandbelle.com howieandbelle.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 337 days
CA CA-PUB-1738284215641521 Jun 2020 Feb 2021 247 days
hrypredivky.sk hrypredivky.sk
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Dec 2019 166 days
SVRN SVRN-230297 Jul 2019 Aug 2019 41 days
httptools.net httptools.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2020 348 days
CA CA-PUB-2186101008500724 Oct 2019 May 2020 201 days
humorwx.net humorwx.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Oct 2019 Jun 2021 1 year, 245 days
SVRN SVRN-230297 Jul 2019 Mar 2020 265 days
independensi.com independensi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
infojepang.net infojepang.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2020 Mar 2021 274 days
CA CA-PUB-1738284215641521 Sep 2020 Sep 2020 One Off
soft32.it internet-download-manager.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 224 days
SCLP SCLP-6426 Dec 2020 Jun 2021 182 days
soft32.es internet-explorer-9.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
inwepo.co inwepo.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 142 days
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 20 days
jocuriminiclip.ro jocuriminiclip.ro
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Dec 2019 Mar 2020 97 days
LIJI LIJI-230297 Dec 2019 Mar 2020 97 days
joio.com joio.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
juegosmahjong.com juegosmahjong.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Dec 2019 171 days
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
kabaroto.com kabaroto.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 153 days
CA CA-PUB-1738284215641521 Jun 2019 Jun 2019 One Off
karhoot.com karhoot.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 267 days
LIJI LIJI-230297 Jul 2019 Mar 2020 267 days
keluargasamawa.com keluargasamawa.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021 1 year, 233 days
CA CA-PUB-1738284215641521 Aug 2019 Feb 2021 1 year, 179 days
kenali.co.id kenali.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 141 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 69 days
kids-n-fun.com kids-n-fun.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Feb 2020 Mar 2020 35 days
LIJI LIJI-230297 Feb 2020 Mar 2020 35 days
soft32.es kindle.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Dec 2020 Jun 2021 175 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
klikpositif.com klikpositif.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Sep 2020 168 days
CA CA-PUB-1738284215641521 May 2020 Jul 2020 67 days
koosaj.com koosaj.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 268 days
LIJI LIJI-230297 Jul 2019 Mar 2020 268 days
krjogja.com krjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Feb 2021 207 days
CA CA-PUB-2186101008500724 Dec 2020 Jun 2021 174 days
kuatmlarat.com kuatmlarat.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2019 Dec 2019 One Off
CA CA-PUB-1738284215641521 Feb 2020 Feb 2020 One Off
langcuoi.vn langcuoi.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2019 Mar 2020 96 days
CA CA-PUB-1738284215641521 Oct 2019 Dec 2019 64 days
langgam.id langgam.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 329 days
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
lensajakarta.com lensajakarta.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Jun 2021 190 days
CA CA-PUB-1738284215641521 Aug 2020 Feb 2021 172 days
lowonganhotelbali.com lowonganhotelbali.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Jun 2021 1 year, 113 days
CA CA-PUB-1738284215641521 Dec 2019 Feb 2021 1 year, 50 days
facetofeet.com microsite.facetofeet.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Jun 2021 303 days
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 33 days
moorsidecbc.org.uk moorsidecbc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
OX OX-539872073 Dec 2019 Dec 2019 One Off
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
moviestarplanet.com.tr moviestarplanet.com.tr
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Sep 2019 Apr 2020 210 days
SVRN SVRN-230297 Nov 2019 Apr 2020 145 days
mrthaya.com mrthaya.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Mar 2020 271 days
LIJI LIJI-230297 Jul 2019 Mar 2020 271 days
soft32.es msn-messenger.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
mydailyregister.com mydailyregister.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jan 2020 205 days
LIJI LIJI-230297 Jul 2019 Jan 2020 205 days
ngalam.co ngalam.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Aug 2020 308 days
CA CA-PUB-1738284215641521 Feb 2020 Oct 2020 230 days
nontunai.com nontunai.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2020 Jun 2021 359 days
CA CA-PUB-1738284215641521 May 2020 Feb 2021 271 days
soft32.es notepad.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Nov 2020 Jun 2021 213 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
nusupan.best nusupan.best
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2019 Mar 2020 91 days
CA CA-PUB-2186101008500724 Mar 2020 Mar 2020 One Off
nyonyor.com nyonyor.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Jul 2020 106 days
CA CA-PUB-1738284215641521 May 2020 May 2020 One Off
obahsambat.com obahsambat.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2019 Dec 2019 One Off
CA CA-PUB-2186101008500724 Mar 2020 Mar 2020 One Off
soft32.de openoffice.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 284 days
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
oyundedem.com oyundedem.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Feb 2020 239 days
LIJI LIJI-230297 Jul 2019 Feb 2020 239 days
soft32.es partition-magic.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Apr 2021 153 days
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
pelatihan-prmn.com pelatihan-prmn.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Oct 2020 Feb 2021 121 days
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 80 days
persepsi.co.id persepsi.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Jun 2021 288 days
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 63 days
phatgiao.org.vn phatgiao.org.vn
Attribute Value First Detected Last Detected Overlap Duration
YIMO YIMO-2073946213921227802 Mar 2020 Mar 2020 One Off
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
soft32.es picasa.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
SCLP SCLP-6793 Nov 2020 Dec 2020 39 days
plucki.com plucki.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Apr 2020 218 days
LIJI LIJI-230297 Aug 2019 Apr 2020 218 days
pomu.ie pomu.ie
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
pomu.pl pomu.pl
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.it raidcall.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Oct 2020 Apr 2021 174 days
SCLP SCLP-6793 Sep 2020 Dec 2020 110 days
redbourncc.com redbourncc.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
SCLP SCLP-6426 Apr 2020 Apr 2020 One Off
rekano.com rekano.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Feb 2020 234 days
LIJI LIJI-230297 Jul 2019 Feb 2020 234 days
rmolbanten.com rmolbanten.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Apr 2021 62 days
roda2blog.com roda2blog.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2019 Nov 2019 One Off
sabervivirtv.com sabervivirtv.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Jan 2020 189 days
sahabatmaroko.com sahabatmaroko.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Apr 2020 35 days
saintif.com saintif.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Apr 2020 One Off
arcadehippo.com arcadehippo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 207 days
seattlepi.com seattlepi.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
serikatnews.com serikatnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Apr 2021 114 days
akisitv.com akisitv.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2019 Jun 2019 One Off
seruni.id seruni.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
alborsaanews.com alborsaanews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
almashhad-alyemeni.com almashhad-alyemeni.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 263 days
sospergola.net sospergola.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jul 2019 One Off
artjakarta.com artjakarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Jan 2010 Oct 2017 7 years, 285 days
10minutemail.net 10minutemail.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
suarapasundan.com suarapasundan.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 161 days
soft32.com.br adobe-flash-player-non-ie.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
tainhanh.vn tainhanh.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Jul 2019 105 days
assawsana.com assawsana.com
Attribute Value First Detected Last Detected Overlap Duration
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
techorz.com techorz.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jun 2021 Jun 2021 6 days
harianjogja.com tekno.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Jun 2021 212 days
teknojurnal.com teknojurnal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
thehour.com thehour.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
babyhome.com.tw babyhome.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
baducanu.eu baducanu.eu
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2019 Jun 2019 One Off
thestandnews.com thestandnews.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Feb 2021 Jun 2021 123 days
baotintuc.vn baotintuc.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Apr 2019 Jan 2020 286 days
todojuegosgratis.es todojuegosgratis.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
soft32.es tor-browser.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Jun 2021 Jun 2021 One Off
bellator.com bellator.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
beritabeta.com beritabeta.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 May 2020 One Off
beritafakta.id beritafakta.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 82 days
beritajawabarat.com beritajawabarat.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Nov 2020 One Off
beritarafflesia.com beritarafflesia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Jun 2021 169 days
tuviphongthuy.net tuviphongthuy.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Mar 2020 179 days
tvland.com tvland.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
bibhp.com bibhp.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
ultimagz.com ultimagz.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Sep 2020 364 days
unica.ro unica.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2021 1 year, 3 days
bidiktangsel.com bidiktangsel.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Feb 2021 205 days
biga.com.tw biga.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
bimmer.id bimmer.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 89 days
vedit.co.id vedit.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2021 Jun 2021 3 days
blogo.id blogo.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 52 days
vinted.com vinted.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2021 1 year, 3 days
vinted.es vinted.es
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 May 2020 Apr 2021 328 days
vinted.pl vinted.pl
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 May 2020 Apr 2021 328 days
webphimmoi.net webphimmoi.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Sep 2019 Sep 2019 One Off
bravacasa.co.id bravacasa.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Feb 2012 Nov 2016 4 years, 277 days
brecorder.com brecorder.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Feb 2021 220 days
werewolf.com werewolf.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 May 2020 Sep 2020 109 days
widnescricketclub.com widnescricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2020 Jul 2020 One Off
wizard101.com wizard101.com
Attribute Value First Detected Last Detected Overlap Duration
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
soft32.es wizard101.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
yombie.net yombie.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
yukepo.com yukepo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Jan 2020 131 days
cbhounslowunitedfc.com cbhounslowunitedfc.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Feb 2020 Feb 2020 One Off
gq.com.tw gq.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
vl.com.tw hd.vl.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
christabelle.idv.tw christabelle.idv.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
biji.co vn.running.biji.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
fhm.co.id m.fhm.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Mar 2016 Apr 2017 1 year, 18 days
cjay.cc cjay.cc
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
facetofeet.com cms.facetofeet.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 Jun 2021 37 days
convertisseur-youtube.net convertisseur-youtube.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
inginim.com crm.jtb.inginim.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
ctee.com.tw ctee.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
snowbeartranslation.com cyborg-tl.snowbeartranslation.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Feb 2021 One Off
darientimes.com darientimes.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
deherba.com deherba.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Feb 2021 331 days
dengi.ua dengi.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Mar 2020 168 days
canalrcn.com deportes.canalrcn.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2020 Sep 2020 One Off
soft32.es dropbox.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
dulohupa.id dulohupa.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Apr 2021 114 days
earth.com earth.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
edaweb.id edaweb.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Feb 2021 330 days
brecorder.com epaper.brecorder.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 154 days
eva.vn eva.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Sep 2019 May 2020 250 days
beritaone.com fajarbanten.beritaone.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Sep 2020 One Off
fajarbanten.com fajarbanten.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Jun 2021 303 days
fanpiece.com fanpiece.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
fashionwaltzfw.com fashionwaltzfw.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
fixsnews.co.id fixsnews.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 32 days
foodievegans.com foodievegans.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
friv250.net friv250.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
ftv.com.tw ftv.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ftvnews.com.tw ftvnews.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
game24s.com game24s.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
gamesoyo.com gamesoyo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 224 days
garudapos.com garudapos.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Jun 2021 260 days
gds.ro gds.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
harianjogja.com harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Jun 2021 212 days
headcramp.com headcramp.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 264 days
inmywordz.com inmywordz.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
iradiofm.com iradiofm.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 122 days
iwastesomuchmoney.com iwastesomuchmoney.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
jeux-gratuits.com jeux-gratuits.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
jeux.org jeux.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 223 days
jogosgabi.com jogosgabi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 223 days
juegosdegta5.com juegosdegta5.com
Attribute Value First Detected Last Detected Overlap Duration
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
juegosdepou.co juegosdepou.co
Attribute Value First Detected Last Detected Overlap Duration
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
juegosdesoyluna.com juegosdesoyluna.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
poskota.co.id karawang.poskota.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
katamutiara.org katamutiara.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Aug 2019 163 days
kepobio.com kepobio.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Oct 2019 Oct 2019 One Off
kliksajariau.co kliksajariau.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 Jun 2021 23 days
kolobok.ua kolobok.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
labottegadeiservizi.com labottegadeiservizi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
lensajabar.com lensasriwijaya.lensajabar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 89 days
soft32.es libreoffice.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
lokerku.net lokerku.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jul 2020 One Off
soft32.com.br macromedia-dreamweaver.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it macromedia-dreamweaver.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Feb 2021 One Off
matahidup.com matahidup.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2019 Feb 2021 1 year, 273 days
maxmanroe.com maxmanroe.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 329 days
medanbisnisdaily.com medanbisnisdaily.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Dec 2019 63 days
metro7.co.id metro7.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 138 days
meuspremiosnick.com.br meuspremiosnick.com.br
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
mirrormedia.mg mirrormedia.mg
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
moonsally.com moonsally.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
mport.ua mport.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Dec 2019 Mar 2020 92 days
mrjogos.net mrjogos.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Aug 2019 Oct 2019 63 days
raketka.cz raketka.cz
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Oct 2019 Apr 2020 154 days
mtv.pt mtv.pt
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 16 days
musictory.it musictory.it
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
harianjogja.com news.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 90 days
sabay.com.kh news.master.sabay.com.kh
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Feb 2021 Apr 2021 61 days
newsnusantara.com newsnusantara.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 May 2021 170 days
ohkopak.com ohkopak.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 May 2021 May 2021 One Off
ohman.vn ohman.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Dec 2019 300 days
harianjogja.com opini.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
harianjogja.com otomotif.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Jun 2021 212 days
padang-today.com padang-today.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 80 days
padangkita.com padangkita.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Mar 2020 One Off
padangmedia.com padangmedia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Jun 2021 60 days
paginainizio.com paginainizio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Feb 2020 183 days
rcnnovelas.com rcnnovelas.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Apr 2021 1 year, 46 days
penaku.id penaku.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jan 2021 One Off
penguingames.info penguingames.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Jun 2021 1 year, 97 days
petel.bg petel.bg
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
play123.in play123.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
pomu.co.it pomu.co.it
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
pomu.com.ar pomu.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.com.co pomu.com.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.com.ec pomu.com.ec
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.gr pomu.gr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 290 days
pomu.se pomu.se
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
femaledaily.com prod-cdn.reviews.femaledaily.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 91 days
qgames.org qgames.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Apr 2020 269 days
registercitizen.com registercitizen.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
mimbarumum.co.id mimbarumum.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 16 days
rtl2.de rtl2.de
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Sep 2019 Apr 2020 210 days
rundschau-online.de rundschau-online.de
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Feb 2020 53 days
soft32.es adobe-flash-player-non-ie.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Apr 2021 Apr 2021 One Off
adventurebucko.com adventurebucko.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
sehajmal.com sehajmal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
alhadthonline.com alhadthonline.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Apr 2020 34 days
sfgate.com sfgate.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
sheltonherald.com sheltonherald.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
aljaras.com aljaras.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Nov 2019 Apr 2020 144 days
albumbaru.com albumbaru.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2019 Feb 2021 1 year, 250 days
sidikpost.com sidikpost.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jan 2021 One Off
sijoritoday.com sijoritoday.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 132 days
readingonthefarm.com readingonthefarm.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Apr 2020 One Off
smak.ua smak.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
gig.hk sme.gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
spiele123.com spiele123.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
vl.com.tw sport.vl.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
stamfordadvocate.com stamfordadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
1001giochi.it 1001giochi.it
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Mar 2020 231 days
1001spiele.at 1001spiele.at
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Sep 2019 One Off
stirescu.ro stirescu.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
abingdonrufc.co.uk abingdonrufc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Jan 2020 Jan 2020 One Off
gig.hk success.gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
sultengterkini.com sultengterkini.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Apr 2021 One Off
sumselnet.com sumselnet.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 59 days
sushi.id sushi.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Feb 2021 52 days
altermedia.id altermedia.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 39 days
sweetrip.id sweetrip.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Apr 2020 Feb 2021 311 days
taiwan17go.com taiwan17go.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
tangerangonline.id tangerangonline.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 160 days
auto-bild.ro auto-bild.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Nov 2019 Apr 2021 1 year, 140 days
terasmaluku.com terasmaluku.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Sep 2020 One Off
soft32.it tetris.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
theridgefieldpress.com theridgefieldpress.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
thestorypedia.com thestorypedia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
baladnaelyoum.com baladnaelyoum.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Sep 2019 Jan 2020 131 days
baliandbeyond.co.id baliandbeyond.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Apr 2016 Oct 2017 1 year, 161 days
balifactualnews.com balifactualnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 112 days
tiebreakertimes.com.ph tiebreakertimes.com.ph
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
tmox.ml tmox.ml
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jul 2019 Sep 2019 54 days
soft32.es tor.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Nov 2020 Dec 2020 39 days
beaumontenterprise.com beaumontenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
triaspolitika.id triaspolitika.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Jun 2021 179 days
truckerscafefood4soul.org truckerscafefood4soul.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jul 2019 One Off
berindonews.com berindonews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Apr 2021 116 days
best-game.co best-game.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
bestkiwi.ru bestkiwi.ru
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
bestreviews.pk bestreviews.pk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Nov 2020 192 days
betintl.co.uk betintl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
betshoof.com betshoof.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Apr 2020 Jun 2021 1 year, 58 days
bincangsyariah.com bincangsyariah.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Nov 2020 117 days
bisnis.com bisnis.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 May 2020 One Off
vcreative.sg vcreative.sg
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 Feb 2021 266 days
okmall.tw viablog.okmall.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
vidcon.com vidcon.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
higo.id blog.higo.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2021 Jan 2021 One Off
blok-a.com blok-a.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 111 days
vinted.cz vinted.cz
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 May 2020 May 2020 One Off
soft32.it visual-basic-express.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Apr 2021 Jun 2021 70 days
vozpopuli.com vozpopuli.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
wartasolo.com wartasolo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Sep 2020 185 days
watan.com watan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Jun 2021 1 year, 97 days
wwwclicks.com wwwclicks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Apr 2020 80 days
captionkata.com captionkata.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jul 2020 79 days
ylpt838.net ylpt838.net
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2019 Sep 2019 One Off
yombie.com yombie.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
youm7.com youm7.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Sep 2019 Mar 2020 175 days
youngster.id youngster.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Sep 2020 68 days
cauthu.com.vn cauthu.com.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2019 Nov 2019 122 days
cerpenmu.com cerpenmu.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2019 Mar 2020 277 days
zonakeren.com zonakeren.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Mar 2020 One Off
cherry123.com cherry123.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
gg.pl gg.pl
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2021 1 year, 81 days
iq.com iq.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2021 Jun 2021 122 days
phununet.com me.phununet.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2021 Jun 2021 One Off
wap.vn m.xoso.wap.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Feb 2021 154 days
cocux.com cocux.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 257 days
cokitos.com cokitos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
soft32.it coreldraw-graphics-suite.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
soft32.it counter-strike.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
creditwayup.com creditwayup.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ctinsider.com ctinsider.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
cuerpomente.com cuerpomente.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Mar 2020 169 days
lianhonghong.com curation.lianhonghong.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
daydayplay.hk daydayplay.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
digination.id digination.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jun 2021 326 days
soft32.it easeus-partition-master-free-edition.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
femaledaily.net editorial.femaledaily.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Aug 2020 Sep 2020 42 days
eranews.co.id eranews.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 Jun 2021 37 days
soft32.es eraser.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
estoybiendesalud.com estoybiendesalud.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Apr 2020 65 days
expressnews.com expressnews.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
feminis.ro feminis.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2021 1 year, 82 days
financiarul.ro financiarul.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
fokustekno.com fokustekno.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2019 Dec 2019 One Off
freekaamaal.com freekaamaal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
galamedianews.com galamedianews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2019 Jun 2019 48 days
gamebase.com.tw gamebase.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
gamez6.com gamez6.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Feb 2020 66 days
gizmologi.id gizmologi.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
teknologi.id global.teknologi.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Jun 2021 211 days
soft32.es gom-player.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Apr 2021 Apr 2021 1 day
ground-combat-technology.com ground-combat-technology.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2020 Mar 2020 34 days
gsp.ro gsp.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
habari.id habari.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Jun 2021 60 days
haluan.co haluan.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Nov 2020 117 days
gig.hk health.gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
heronsyfc.co.uk heronsyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
heyquiz.com heyquiz.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
harianjogja.com hiburan.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
igre123.net igre123.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
inilahkoran.com inilahkoran.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Feb 2021 153 days
iprofesional.com iprofesional.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Dec 2019 Feb 2020 63 days
irunning.com.ua irunning.com.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Oct 2019 Jul 2020 271 days
islampos.com islampos.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2019 Mar 2020 273 days
jadigamers.com jadigamers.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2020 Feb 2020 One Off
jagossh.com jagossh.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Jun 2019 111 days
vl.com.tw japan.vl.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
poskota.co.id jatim.poskota.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
harianjogja.com jogjapolitan.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
jogosfriv2020.net jogosfriv2020.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
juegosdeloola.com juegosdeloola.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
juegosjuegos.com.co juegosjuegos.com.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
kiatfit.com kiatfit.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Aug 2019 164 days
mediakendari.com konut.mediakendari.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
koooraarabia.com koooraarabia.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Dec 2019 Mar 2020 95 days
kooralive.info kooralive.info
Attribute Value First Detected Last Detected Overlap Duration
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
ksta.de ksta.de
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Mar 2020 45 days
gig.hk ladies.gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
lampungjaya.news lampungjaya.news
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 Jun 2021 22 days
lebahndut.net lebahndut.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Mar 2020 One Off
lensajabar.com lensajatengnews.lensajabar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 140 days
libertatea.ro libertatea.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2021 1 year, 3 days
libertateapentrufemei.ro libertateapentrufemei.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Dec 2019 Apr 2021 1 year, 113 days
lothiancoltsfc.co.uk lothiancoltsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Dec 2019 Dec 2019 One Off
madriddiferente.com madriddiferente.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Aug 2020 Apr 2021 234 days
manadobaswara.com manadobaswara.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 Feb 2021 273 days
soft32.es realplayer.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Jun 2021 Jun 2021 One Off
soft32.it realplayer.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
mediaterbittimornews.com mediaterbittimornews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Jan 2021 50 days
mediakendari.com metro.mediakendari.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Dec 2020 One Off
money.com.tw money.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
moneydj.com moneydj.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
motherandbabyfair.com motherandbabyfair.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Apr 2016 Mar 2020 3 years, 336 days
mtv.be mtv.be
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
mtv.it mtv.it
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
mtv.nl mtv.nl
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 16 days
mysanantonio.com mysanantonio.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
sabay.com.kh news.sabay.com.kh
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Apr 2021 Jun 2021 61 days
next-level-arcade.com next-level-arcade.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
niusnews.com niusnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
noisegarage.id noisegarage.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
ntdtv.com.tw ntdtv.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ntn24.com ntn24.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Apr 2021 1 year, 211 days
femaledaily.net ofdbr.femaledaily.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 32 days
olx.com.sv olx.com.sv
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
soft32.es opera-web-browser.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
patrolipost.com patrolipost.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 135 days
soft32.de pdf24-creator.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Feb 2021 One Off
penangfoodie.com penangfoodie.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
harianjogja.com pengabdianumy.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Dec 2020 One Off
pmu-resultat.net pmu-resultat.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
pohadkyonline.eu pohadkyonline.eu
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
pomu.ch pomu.ch
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
pomu.com.br pomu.com.br
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.com.do pomu.com.do
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.com.py pomu.com.py
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.com.uy pomu.com.uy
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.jp pomu.jp
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
pomu.ro pomu.ro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
pomu.ru pomu.ru
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 290 days
qqkelly.com qqkelly.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
raaga.com raaga.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
soft32.es raidcall.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
randomsaladgames.com randomsaladgames.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 Jun 2021 1 year, 27 days
rba.es rba.es
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Jul 2019 19 days
arcadehole.com arcadehole.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Apr 2020 142 days
sahsoxid.info sahsoxid.info
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
aif.ua aif.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2020 77 days
sekilasjabar.co sekilasjabar.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Jun 2021 1 year, 70 days
servicepaymntinfrmtnvalidatecnfg97233.com servicepaymntinfrmtnvalidatecnfg97233.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2020 Jan 2020 One Off
setanmerah.org setanmerah.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2019 Nov 2019 One Off
cosmopolitan.co.id shop.cosmopolitan.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Oct 2010 Oct 2013 2 years, 350 days
almaany.com almaany.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
amica.co.id amica.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Feb 2012 Oct 2013 1 year, 236 days
sipse.com sipse.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ambonkita.com ambonkita.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jul 2020 Jul 2020 One Off
slideshare.vn slideshare.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 May 2019 81 days
animeshow.tv animeshow.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
annybear.com annybear.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ants.vn ants.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
antsprogrammatic.com antsprogrammatic.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 Feb 2021 262 days
camerabay.tv sports.camerabay.tv
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
asiawiki.net asiawiki.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Jan 2020 188 days
cosmogirl.co.id staging.cosmogirl.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Jul 2017 Jul 2017 One Off
0223.com.ar 0223.com.ar
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2020 79 days
1001freefonts.com 1001freefonts.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
stebvv.com stebvv.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Jul 2019 Jul 2019 11 days
analisadaily.com analisadaily.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2019 Nov 2019 One Off
tailieuhoctap.com tailieuhoctap.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Jul 2019 130 days
tavesper.tech tavesper.tech
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
soft32.de tetris.soft32.de
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Feb 2021 Jun 2021 131 days
themaclife.com themaclife.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Jun 2020 Dec 2020 173 days
bali-travelnews.com bali-travelnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Feb 2021 57 days
baodautu.vn baodautu.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Jan 2020 332 days
beritalima.com beritalima.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 111 days
beritasembilan.com beritasembilan.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Jun 2021 204 days
tucajogos.com.br tucajogos.com.br
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Apr 2020 266 days
ayokuliah.id uat.ayokuliah.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Sep 2020 40 days
uphillrun.io uphillrun.io
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
usdgg.cn usdgg.cn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jan 2020 Jan 2020 One Off
veganpunch.com veganpunch.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
vgorode.ua vgorode.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 May 2020 55 days
verywed.com verywed.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
vogue.com.tw vogue.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
wiltonbulletin.com wiltonbulletin.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
canalrcn.com canalrcn.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2020 Apr 2021 1 year, 70 days
yoobgames.org yoobgames.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
hireme.ph cebu.hireme.ph
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 May 2021 Jun 2021 30 days
channelbali.com channelbali.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Dec 2020 One Off
chron.com chron.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
mread.info tv.mread.info
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 May 2021 Jun 2021 18 days
ciudad.com.ar ciudad.com.ar
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
techorz.com m.techorz.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Apr 2021 Jun 2021 69 days
cna.com.tw cna.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
cokitos.net cokitos.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
cokitos.pt cokitos.pt
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Mar 2020 38 days
comdag.de comdag.de
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 May 2020 May 2020 One Off
cosmopolitanfm.com cosmopolitanfm.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Apr 2021 66 days
ctitv.com.tw ctitv.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
dailycryptoblast.com dailycryptoblast.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
doanhnghiepvn.vn doanhnghiepvn.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Dec 2019 274 days
duwitmu.com duwitmu.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2019 Feb 2021 1 year, 68 days
soft32.it easeus-partition-master-home-edition.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Dec 2020 102 days
ecapsgames.com ecapsgames.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Mar 2020 260 days
elbehiraanews.com elbehiraanews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Feb 2020 Mar 2020 36 days
eltrecetv.com.ar eltrecetv.com.ar
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Nov 2019 Mar 2020 110 days
emdep.vn emdep.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021 1 year, 343 days
eprice.com.tw eprice.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
finansialku.com finansialku.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Oct 2019 Feb 2021 1 year, 129 days
foes.io foes.io
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Feb 2020 Feb 2020 One Off
gig.hk foodie.gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
football.ua football.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Apr 2020 209 days
freeonlinegames.com freeonlinegames.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Nov 2019 Mar 2020 110 days
frivyoob.com frivyoob.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Mar 2020 Mar 2020 One Off
futurofinancial.xyz futurofinancial.xyz
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 May 2021 One Off
gadu-gadu.pl gadu-gadu.pl
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Nov 2019 Apr 2021 1 year, 147 days
game2p.com game2p.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
gierkionline.pl gierkionline.pl
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 165 days
gingsul.com gingsul.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Jun 2020 77 days
giokando.net giokando.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Mar 2020 100 days
gogoblog.tw gogoblog.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
soft32.es google-earth.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
guidejeux.fr guidejeux.fr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
tvbs.com.tw health.tvbs.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
gig.hk heha.gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
biji.co hiking.biji.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
hireme.ph hireme.ph
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021 174 days
histock.tw histock.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
hkofficedaily.com hkofficedaily.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 149 days
houstonchronicle.com houstonchronicle.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
soft32.com.br ibm-spss-statistics.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
igrulez.net igrulez.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-230297 Jul 2019 Jun 2021 1 year, 347 days
imcnews.id imcnews.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jan 2021 One Off
indonesiadaily.co.id indonesiadaily.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 Jun 2021 28 days
investigasinusantara.com investigasinusantara.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 142 days
soft32.com.br istat-pro.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
jaringinfo.com jaringinfo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2021 Jun 2021 141 days
poskota.co.id jateng.poskota.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Apr 2021 62 days
jogloabang.com jogloabang.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Sep 2020 One Off
jogosonlineapps.com.br jogosonlineapps.com.br
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
juantambayan.me juantambayan.me
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Mar 2021 50 days
juegos-de-dos-jugadores.com juegos-de-dos-jugadores.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 222 days
juegos-de-zombies.net juegos-de-zombies.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 222 days
juegosdedragonballsuper.com juegosdedragonballsuper.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Mar 2020 35 days
juegosdefortnite.net juegosdefortnite.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
juegosdeyanderesimulator.com juegosdeyanderesimulator.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Dec 2019 126 days
juegosfriv2019com.com juegosfriv2019com.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
kabarseleb.id kabarseleb.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Aug 2019 Aug 2019 One Off
kawula.id kawula.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Sep 2020 One Off
ketbanlamquen.com ketbanlamquen.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2019 Jun 2019 One Off
soft32.es kingsoft-office-free.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Sep 2020 Dec 2020 102 days
kleiderkreisel.de kleiderkreisel.de
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
klikpapua.com klikpapua.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 18 days
kliksajamaluku.co kliksajamaluku.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 90 days
kopitekno.com kopitekno.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 122 days
korea-lover.com korea-lover.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 Feb 2021 274 days
lapinou.com lapinou.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Mar 2020 160 days
lebanese-forces.com lebanese-forces.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Jul 2019 Apr 2020 265 days
lecturas.com lecturas.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
leighgenesis.co.uk leighgenesis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186779 Dec 2019 Dec 2019 One Off
linetv.tw linetv.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
livenews.vn livenews.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Jul 2020 One Off
lmtonline.com lmtonline.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
lollipop168.com lollipop168.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ludosmg.com ludosmg.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
mambee.com mambee.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Aug 2019 Feb 2020 186 days
mdewiresmi.com mdewiresmi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 156 days
mtv.co.za mtv.co.za
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 16 days
mtv.de mtv.de
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2021 1 year, 3 days
mtvasia.com mtvasia.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
muffingraphics.com muffingraphics.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 84 days
muylinux.com muylinux.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
myfreegames.online myfreegames.online
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Jun 2020 Jun 2020 One Off
myplainview.com myplainview.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
nawalakarsa.id nawalakarsa.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2020 Sep 2020 One Off
ohayo.co.id ohayo.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Feb 2020 356 days
ohplaygames.com ohplaygames.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
otakuverse.id otakuverse.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Mar 2021 One Off
pcactual.com pcactual.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jul 2019 Mar 2020 274 days
phew.tw phew.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
phimvn2.net phimvn2.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Oct 2019 Oct 2019 One Off
playbaseballgames.org playbaseballgames.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Jun 2021 1 year, 97 days
pomu.com.pa pomu.com.pa
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.com.pe pomu.com.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.cr pomu.cr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.pt pomu.pt
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
popmagz.com popmagz.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2020 Sep 2020 196 days
poskota.co.id poskota.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
postku.web.id postku.web.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2020 Feb 2020 55 days
presisinews.com presisinews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 May 2021 One Off
qooky.com qooky.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
rakyatpos.com rakyatpos.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Nov 2020 One Off
vietnamnet.vn raovat.vietnamnet.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 91 days
ruangmuda.com ruangmuda.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2021 Jan 2021 One Off
biji.co running.biji.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
sales-frontier.com sales-frontier.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
santuy.club santuy.club
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 May 2020 One Off
sapagreen.com sapagreen.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Apr 2020 One Off
saungnews.co saungnews.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2020 Jun 2021 237 days
sehatq.com sehatq.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jan 2020 Nov 2020 310 days
harianjogja.com sepakbola.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Dec 2020 One Off
aksalser.com aksalser.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Sep 2019 Apr 2020 209 days
alwafd.news alwafd.news
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
gig.hk shine.gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
alinea.id alinea.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 39 days
aljaras.me aljaras.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Nov 2019 Nov 2019 One Off
sogi.com.tw sogi.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
anclacormlad.ml anclacormlad.ml
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
sourcesindonesia.com sourcesindonesia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Dec 2016 Feb 2017 44 days
soft32.es sphax-purebdcraft-craft.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Apr 2021 Jun 2021 61 days
spielen.de spielen.de
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Sep 2019 Apr 2020 209 days
1000heronline.cz 1000heronline.cz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
101games.gr 101games.gr
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 8 days
101games.it 101games.it
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 8 days
101paixnidia.gr 101paixnidia.gr
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
aaj.tv aaj.tv
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Feb 2021 220 days
tvbs.com.tw supertaste.tvbs.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
sweepon.com sweepon.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
tecnofilos.es tecnofilos.es
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Feb 2021 Feb 2021 One Off
teknologi.id teknologi.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Jun 2021 211 days
tendenciasdebelleza.com tendenciasdebelleza.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2020 84 days
tinmoi.vn tinmoi.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Jan 2020 323 days
poskota.co.id banten.poskota.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2021 Feb 2021 One Off
bantenhits.com bantenhits.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Apr 2021 343 days
tochka.net tochka.net
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
beauty321.com beauty321.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
beckenhamwaterpolo.com beckenhamwaterpolo.com
Attribute Value First Detected Last Detected Overlap Duration
OX OX-540553856 Apr 2020 Apr 2020 One Off
gig.hk trends.gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
trurocityfc.net trurocityfc.net
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
beredukasi.com beredukasi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2020 Apr 2020 One Off
soft32.es turbo-c.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Sep 2020 Jun 2021 276 days
beritamalut.co beritamalut.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Jun 2021 53 days
tvmania.ro tvmania.ro
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2021 1 year, 90 days
twpkinfo.com twpkinfo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
soft32.com.br updater-new.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
bleepingcomputer.com bleepingcomputer.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
viddl.me viddl.me
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2019 May 2019 One Off
vihrogon.bg vihrogon.bg
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
vinted.fr vinted.fr
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 May 2020 Apr 2021 328 days
vorzeit.mobi vorzeit.mobi
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
bolaskor.com bolaskor.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Apr 2019 Jun 2019 51 days
waspada.id waspada.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Dec 2020 Dec 2020 One Off
watanserb.com watanserb.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
bravaradio.com bravaradio.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Apr 2021 Jun 2021 52 days
wiradesa.co wiradesa.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Jun 2021 126 days
soft32.es yahoo-messenger.soft32.es
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2020 Apr 2021 216 days
yapo.cl yapo.cl
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Apr 2020 Apr 2020 One Off
yeutretho.vn yeutretho.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Mar 2020 176 days
carisinyal.com carisinyal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Sep 2020 One Off
yoob3.com yoob3.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
youngesteight.com youngesteight.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Nov 2019 24 days
yquetecuento.com yquetecuento.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
yucaipaapartments.com yucaipaapartments.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Sep 2019 Sep 2019 One Off
yunoya.id yunoya.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2021 Jun 2021 1 day
zamo.vn zamo.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Sep 2019 Sep 2019 One Off
zdarma-online-hry.eu zdarma-online-hry.eu
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Apr 2020 Apr 2020 One Off
ceksite.id ceksite.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2019 Nov 2019 One Off
centralbatam.co.id centralbatam.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Dec 2020 Jun 2021 166 days
zoxygames.com zoxygames.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Apr 2020 Apr 2020 One Off
chiblog.tw chiblog.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
chocolive.ru chocolive.ru
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Nov 2019 Nov 2019 One Off
chovui.com chovui.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2019 Mar 2020 143 days
tv.ua tv.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Apr 2020 79 days
cocopedia.id cocopedia.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Jun 2021 201 days
cofax.ru cofax.ru
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
comedycentralasia.com comedycentralasia.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
cryptoharian.com cryptoharian.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2020 Jun 2021 1 year, 89 days
cucinare.tv cucinare.tv
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Sep 2019 One Off
biji.co cycling.biji.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
cyparblog.com cyparblog.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Apr 2019 Apr 2019 One Off
designlisticle.com designlisticle.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Nov 2020 Feb 2021 77 days
directplus.fr directplus.fr
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
doisongphapluat.com doisongphapluat.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2019 Apr 2020 1 year, 37 days
vl.com.tw drama.vl.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
fitness.co.id fitness.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Feb 2012 Feb 2012 One Off
egypttoday.com egypttoday.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158039 Mar 2020 Mar 2020 One Off
eljueves.es eljueves.es
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Sep 2019 Apr 2020 209 days
elmueble.com elmueble.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
estampas.com estampas.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 May 2020 May 2020 One Off
fabiosa.com fabiosa.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 May 2020 May 2020 One Off
fajar.co.id fajar.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Mar 2020 One Off
fashionwaltz.com fashionwaltz.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
fashionwaltz.net fashionwaltz.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
soft32.com.br foxit-pdf-reader.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
soft32.it foxit-pdf-reader.soft32.it
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6426 Jun 2021 Jun 2021 8 days
franpolempi.ml franpolempi.ml
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 May 2020 One Off
cwgv.com.tw futureparenting.cwgv.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
gadis.co.id gadis.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Feb 2020 Feb 2020 One Off
gamev6.com gamev6.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Oct 2019 Feb 2020 130 days
gig.hk gig.hk
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Jan 2021 Jun 2021 151 days
girlsocool.com girlsocool.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Jul 2019 Jul 2019 19 days
globalisttravels.com globalisttravels.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
gogofirenze.it gogofirenze.it
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
gogoterme.com gogoterme.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ctitv.com.tw gotv.ctitv.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
gwan.tw gwan.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
hairideas.co.id hairideas.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Feb 2012 Oct 2013 1 year, 236 days
healthforall.com.tw healthforall.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
hellomagazine.co.id hellomagazine.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-4418968 Apr 2016 Jun 2016 47 days
hothk.com hothk.com
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Dec 2020 Feb 2021 52 days
incub8pi.com incub8pi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Feb 2020 One Off
infosurabaya.id infosurabaya.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2020 Jun 2021 1 year, 32 days
inilahnews.com inilahnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jul 2020 Sep 2020 54 days
inote.tw inote.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
inponsel.com inponsel.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2020 Feb 2020 One Off
isport.ua isport.ua
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
iwastesomuchtime.com iwastesomuchtime.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Mar 2020 One Off
jadwalbis.com jadwalbis.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Oct 2019 Feb 2021 1 year, 120 days
jeux123.fr jeux123.fr
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
jiemr.me jiemr.me
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
jogopop.com.br jogopop.com.br
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
jogos123.net jogos123.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
jogosfriv2019.com jogosfriv2019.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
jogosgratis.online jogosgratis.online
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
juegos123.net juegos123.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
juegosgabi.com juegosgabi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Feb 2020 Feb 2020 One Off
jydtlw.cn jydtlw.cn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Oct 2020 Oct 2020 One Off
kamini.id kamini.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2020 Dec 2020 192 days
sabay.com.kh kanha.sabay.com.kh
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Apr 2021 Jun 2021 61 days
keketravel.cc keketravel.cc
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ketbanbonphuong.vn ketbanbonphuong.vn
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2019 May 2019 One Off
ketbanlamquen.net ketbanlamquen.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jun 2019 Jun 2019 One Off
khotrithuc.org khotrithuc.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2019 Feb 2020 285 days
kliksajajabar.co kliksajajabar.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 90 days
kliksajapapua.co kliksajapapua.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 Jun 2021 23 days
lampuhijau.co.id lampuhijau.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Aug 2020 Aug 2020 One Off
latinus.us latinus.us
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Oct 2020 Apr 2021 192 days
league-funny.com league-funny.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
lensajabar.com lensajakarta.lensajabar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 89 days
harianjogja.com lifestyle.harianjogja.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Jun 2021 Jun 2021 One Off
luyengame.com luyengame.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Dec 2019 One Off
marieclaire.com.tw marieclaire.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
matchness.com matchness.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Mar 2021 One Off
vl.com.tw maxtv.vl.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
mcpharmaceuticals.com mcpharmaceuticals.com
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-6793 Oct 2019 Oct 2019 One Off
mediaasuransinews.co.id mediaasuransinews.co.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 May 2021 Jun 2021 19 days
mohot.com mohot.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
mommiesdaily.net mommiesdaily.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Jan 2021 Feb 2021 16 days
moviestarplanet.fr moviestarplanet.fr
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-230297 Nov 2019 Mar 2020 110 days
moviexplorers.com moviexplorers.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 May 2020 Dec 2020 207 days
mtv.fr mtv.fr
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Mar 2020 Apr 2021 1 year, 16 days
soft32.com.br musicmatch-jukebox.soft32.com.br
Attribute Value First Detected Last Detected Overlap Duration
SCLP SCLP-390 Feb 2021 Apr 2021 71 days
mygiftsfromabove.com mygiftsfromabove.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1738284215641521 Mar 2020 Mar 2020 One Off
mykiru.ph mykiru.ph
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 May 2021 Jun 2021 17 days
sabay.com.kh news.testing.sabay.com.kh
Attribute Value First Detected Last Detected Overlap Duration
MGRID MGRID-5IJLC8 Feb 2021 Jun 2021 122 days
nhregister.com nhregister.com
Attribute Value First Detected Last Detected Overlap Duration
RUB RUB-18110 Apr 2020 Apr 2020 One Off
nuestrateleinternacional.com nuestrateleinternacional.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 May 2020 Aug 2020 103 days
nusadaily.com nusadaily.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Nov 2020 Apr 2021 152 days
ogramy.pl ogramy.pl
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Mar 2020 219 days
olgclub.com olgclub.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Feb 2020 184 days
videoland.com.tw ontv.videoland.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
vl.com.tw ontv.vl.com.tw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020 One Off
ospika.net ospika.net
Attribute Value First Detected Last Detected Overlap Duration
SPTX SPTX-71426 Oct 2019 Oct 2019 One Off
oyundenizi.com oyundenizi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Dec 2019 Feb 2020 56 days
pesantrenluhur.or.id pesantrenluhur.or.id
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Mar 2021 Jun 2021 79 days
playfootballgames.org playfootballgames.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Mar 2020 Mar 2020 One Off
pomu.cl pomu.cl
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.co.ve pomu.co.ve
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.com.mx pomu.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Aug 2019 One Off
pomu.cz pomu.cz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
pomu.hu pomu.hu
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Jun 2021 1 year, 290 days
pomu.sk pomu.sk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-897697 Aug 2019 Apr 2020 218 days
pramborsfm.com pramborsfm.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Sep 2020 Jun 2021 276 days
reason.com reason.com
Attribute Value First Detected Last Detected Overlap Duration
LOOP LOOP-S-2411 Jan 2020 Jan 2020 One Off
refaccionesperez.com refaccionesperez.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-186266 Aug 2019 Aug 2019 One Off
resepbyta.com resepbyta.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Oct 2020 Oct 2020 One Off
haluan.co riau.haluan.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-2186101008500724 Feb 2021 Feb 2021 One Off
MOTHERANDBABY.CO.ID
Non IP Attributes
Attribute First Last
UA UA-4418968 Nov 2008 Mar 2020
CA CA-PUB-3746615079893481 Oct 2013 Jul 2020
PUBM PUBM-158039 Jul 2019 Jun 2021
FWHL FWHL-897697 Jul 2019 Jun 2021
IEX IEX-186779 Jul 2019 Jun 2021
SVRN SVRN-230297 Jul 2019 Jun 2021
LIJI LIJI-230297 Jul 2019 Jun 2021
YUME YUME-102973855 Jul 2019 Jun 2021
YIMO YIMO-2073946213921227802 Jul 2019 Jun 2021
CA CA-PUB-1738284215641521 Mar 2019 Feb 2021
RUB RUB-18110 Aug 2019 Jun 2021
LOOP LOOP-5918 Aug 2019 Jun 2021
LOOP LOOP-S-2411 Jul 2019 Apr 2021
SCLP SCLP-390 Aug 2019 Apr 2021
CA CA-PUB-2186101008500724 Oct 2019 Jun 2021
OX OX-540553856 Jul 2019 Feb 2021
AT AT-RA-5B8CBA8FE33D5DC4 Sep 2018 Mar 2020
IEX IEX-186266 Aug 2019 Feb 2021
SCLP SCLP-6793 Jul 2019 Dec 2020
OX OX-540099026 Feb 2020 Jun 2021
SCLP SCLP-6426 Mar 2020 Jun 2021
NR NR-4F6641B933 Jun 2018 Aug 2019
SPTX SPTX-283632 May 2020 Jun 2021
AT AT-RA-54EFF682151B7671 Jun 2015 Apr 2016
OX OX-539872073 Aug 2019 Mar 2020
FB FB-1498944493475809 Nov 2017 May 2018
MGRID MGRID-5IJLC8 Dec 2020 Jun 2021
TB TB-1363359 Apr 2021 Jun 2021
SPTX SPTX-71426 Oct 2019 Oct 2019
CA CA-PUB-1937576406332709 Dec 2020 Dec 2020
MOTHERANDBABY.CO.ID
Overlap Attribute Domains
motherandbaby.co.id motherandbaby.co.id
cosmopolitan.co.id cosmopolitan.co.id
herworld.co.id herworld.co.id
casaindonesia.com casaindonesia.com
thanhniennews.com thanhniennews.com
thesundaily.my thesundaily.my
smartm.com.tw smartm.com.tw
gocekan.com gocekan.com
papillon-world.com papillon-world.com
spidermannews.com spidermannews.com
teqnoforia.com teqnoforia.com
makanyuks.com makanyuks.com
angelsontrip.com angelsontrip.com
astaqauliyah.com astaqauliyah.com
tailieu.vn tailieu.vn
womany.net womany.net
businessinsider.in businessinsider.in
gpsbestari.com gpsbestari.com
juksy.com juksy.com
kuchingborneo.info kuchingborneo.info
miaminewtimes.com miaminewtimes.com
palingseru.com palingseru.com
poki.co.il poki.co.il
poki.com poki.com
poki.dk poki.dk
poki.pt poki.pt
songdee.com songdee.com
sportsplanetmag.com sportsplanetmag.com
hipwee.com hipwee.com
juksy.club juksy.club
poki.at poki.at
poki.com.br poki.com.br
poki.gr poki.gr
poki.ro poki.ro
rakluke.com rakluke.com
rappler.com rappler.com
astalog.com astalog.com
bola.com bola.com
wowlavie.com wowlavie.com
gateworld.net gateworld.net
kaskus.co.id kaskus.co.id
kincir.com kincir.com
poki.no poki.no
popular-world.com popular-world.com
remaja.my remaja.my
sosugary.com sosugary.com
codeforgender.com codeforgender.com
ltn.com.tw ltn.com.tw
poki.it poki.it
poki.jp poki.jp
poki.nl poki.nl
poki.pl poki.pl
abovetopsecret.com abovetopsecret.com
thefamouspeople.com thefamouspeople.com
thpromotion.com thpromotion.com
vitdaily.com vitdaily.com
vtvgiaitri.vn vtvgiaitri.vn
brickset.com brickset.com
chordzaa.com chordzaa.com
cnyes.com cnyes.com
doc24.vn doc24.vn
dodeden.com dodeden.com
freemalaysiatoday.com freemalaysiatoday.com
liputan.co.id liputan.co.id
pesonapengantin.my pesonapengantin.my
phoenixnewtimes.com phoenixnewtimes.com
poki.cn poki.cn
aelitaxtranslate.com aelitaxtranslate.com
springnews.co.th springnews.co.th
bernama.com bernama.com
turnnewsapp.com turnnewsapp.com
ytower.com.tw ytower.com.tw
choosephilippines.com choosephilippines.com
zi.media zi.media
dallasobserver.com dallasobserver.com
happeningbkk.com happeningbkk.com
hotinfonow.com hotinfonow.com
joiiup.com joiiup.com
mombaby.com.tw mombaby.com.tw
motthegioi.vn motthegioi.vn
pushbike.tw pushbike.tw
universemc.us universemc.us
upmedia.mg upmedia.mg
westword.com westword.com
cincainews.com cincainews.com
detalog.com detalog.com
kocaelibarisgazetesi.com kocaelibarisgazetesi.com
libur.com.my libur.com.my
managertoday.com.tw managertoday.com.tw
momocheck.tw momocheck.tw
mycte.turnnewsapp.com mycte.turnnewsapp.com
penatimor.com penatimor.com
poki.be poki.be
pulsk.com pulsk.com
rajah.com rajah.com
sohh.com sohh.com
thetruenet.com thetruenet.com
bella.tw bella.tw
tvshowbox.tw tvshowbox.tw
umpan.com.my umpan.com.my
wildaboutmovies.com wildaboutmovies.com
wonkette.com wonkette.com
zanzlanz.com zanzlanz.com
dailyview.tw dailyview.tw
dreamers.id dreamers.id
esports.id esports.id
free.com.tw free.com.tw
givegoodjuju.com givegoodjuju.com
mid-day.com mid-day.com
newser.com newser.com
niniandblue.com niniandblue.com
onlymyhealth.com onlymyhealth.com
poki.cz poki.cz
poki.de poki.de
aksisosial.org aksisosial.org
ap1.newtalk.tw ap1.newtalk.tw
abplive.com abplive.com
sudsapda.com sudsapda.com
astroawani.com astroawani.com
techz.vn techz.vn
thethao247.vn thethao247.vn
batman-news.com batman-news.com
toonado.com toonado.com
vanz.bike vanz.bike
browardpalmbeach.com browardpalmbeach.com
harianhaluan.com harianhaluan.com
hops.id hops.id
ibudanbalita.net ibudanbalita.net
indozone.id indozone.id
jagran.com jagran.com
juksy.me juksy.me
katadata.co.id katadata.co.id
kilastimor.com kilastimor.com
kipkipfun.com kipkipfun.com
lagged.com lagged.com
love-beauty.cc love-beauty.cc
mugeanlitv.com mugeanlitv.com
newtalkcdn29080164.newtalk.tw newtalkcdn29080164.newtalk.tw
popbela.com popbela.com
popmama.com popmama.com
posttoday.com posttoday.com
queeniego.com queeniego.com
rubycatlife.com rubycatlife.com
stars12.com stars12.com
tipsdancara.net tipsdancara.net
toonclub-th.co toonclub-th.co
tuoitre.vn tuoitre.vn
blocktoro.com blocktoro.com
bluesea0925.com bluesea0925.com
vropinions.com vropinions.com
epic7x.com epic7x.com
gtplanet.net gtplanet.net
houstonpress.com houstonpress.com
inews.id inews.id
inextlive.com inextlive.com
ngthai.com ngthai.com
ontheflix.com ontheflix.com
relyonhorror.com relyonhorror.com
spoilertv.com spoilertv.com
thefilmstage.com thefilmstage.com
cheers.com.tw cheers.com.tw
eznewlife.com eznewlife.com
gefiusth.club gefiusth.club
malaysiamemilih.com malaysiamemilih.com
palingseru.id palingseru.id
rileklah.com rileklah.com
repairiphone.com.tw repairiphone.com.tw
rmol.id rmol.id
abpganga.com abpganga.com
theybf.com theybf.com
upeks.co.id upeks.co.id
vgr.com vgr.com
violentegg.club violentegg.club
wahcricket.com wahcricket.com
zombsroyaleunblocked.com zombsroyaleunblocked.com
comicbookmovie.com comicbookmovie.com
esnacky.com esnacky.com
gamerdvr.com gamerdvr.com
kaohoon.com kaohoon.com
kashoorga.com kashoorga.com
overwolf.com overwolf.com
prachatai.com prachatai.com
qucaiguoji333.com qucaiguoji333.com
rasa.my rasa.my
aimgallery.com aimgallery.com
sinarharian.com.my sinarharian.com.my
amarintv.com amarintv.com
technology-portfolio.net technology-portfolio.net
thehealthsite.com thehealthsite.com
travelerliv.com travelerliv.com
twinfinite.net twinfinite.net
waynedupree.com waynedupree.com
woop.id woop.id
zineblog.com.tw zineblog.com.tw
dek-d.com dek-d.com
doktercantik.com doktercantik.com
eca.party eca.party
edtguide.com edtguide.com
enanyang.my enanyang.my
englishforeveryone.org englishforeveryone.org
gmanetwork.com gmanetwork.com
haibunda.com haibunda.com
hiptoro.com hiptoro.com
lagged.com.br lagged.com.br
momspresso.com momspresso.com
newtalk.tw newtalk.tw
oyunlar1.net oyunlar1.net
postjung.com postjung.com
psu.com psu.com
animemojo.com animemojo.com
sooperboy.com sooperboy.com
techno.id techno.id
thcosmo.space thcosmo.space
baeblemusic.com baeblemusic.com
tiin.com.vn tiin.com.vn
bolgegundem.com bolgegundem.com
femaledaily.com femaledaily.com
fishki.net fishki.net
fwurbansugar.com fwurbansugar.com
game8.com.vn game8.com.vn
gridoto.com gridoto.com
hoc247.net hoc247.net
inafeed.com inafeed.com
kkplay3c.net kkplay3c.net
konsultank3.com konsultank3.com
luv2beauty.com luv2beauty.com
lyes.tw lyes.tw
nancybolg.com nancybolg.com
saostar.vn saostar.vn
srw.wingzero.tw srw.wingzero.tw
tafsir-mimpi.com tafsir-mimpi.com
thethaovanhoa.vn thethaovanhoa.vn
vishvasnews.com vishvasnews.com
vortexpvp.com vortexpvp.com
bola.net bola.net
watchlakorn.in watchlakorn.in
yolk.tech yolk.tech
mb.com.ph mb.com.ph
cricketcountry.com cricketcountry.com
dnaindia.com dnaindia.com
doupdeco.com doupdeco.com
ejan.co ejan.co
ffxivguild.com ffxivguild.com
flyblog.tw flyblog.tw
goingplacesmagazine.com goingplacesmagazine.com
haber61.net haber61.net
india.com india.com
jateng.liputan.co.id jateng.liputan.co.id
jrussofamilydental.com jrussofamilydental.com
komchadluek.net komchadluek.net
matichon.co.th matichon.co.th
objectivist.co objectivist.co
obviouslyharith.com obviouslyharith.com
phunutoday.vn phunutoday.vn
poelab.com poelab.com
prachachat.net prachachat.net
sina.com.tw sina.com.tw
spiceee.net spiceee.net
tempo.co tempo.co
vietq.vn vietq.vn
cmmedia.com.tw cmmedia.com.tw
datpiff.com datpiff.com
hardaway.com.tw hardaway.com.tw
hellhorror.com hellhorror.com
inkuiri.com inkuiri.com
ltsports.com.tw ltsports.com.tw
malaysia-chronicle.com malaysia-chronicle.com
nownews.com nownews.com
pepperrr.net pepperrr.net
picsee.co picsee.co
tel3c.tw tel3c.tw
titotu.io titotu.io
becteroradio.com becteroradio.com
udargol.com udargol.com
detik.com detik.com
dotahut.com dotahut.com
favforward.com favforward.com
finduniversity.ph finduniversity.ph
kenalice.tw kenalice.tw
kiss4d.com kiss4d.com
majorcineplex.com majorcineplex.com
oldcryptiansrfc.co.uk oldcryptiansrfc.co.uk
oomph.co.id oomph.co.id
afcsudbury.co.uk afcsudbury.co.uk
thansettakij.com thansettakij.com
thetechgame.com thetechgame.com
bossmurmur.com bossmurmur.com
cnnindonesia.com cnnindonesia.com
egg.network egg.network
fimela.com fimela.com
gamebanshee.com gamebanshee.com
hoc24.vn hoc24.vn
idntimes.com idntimes.com
lordsofpain.net lordsofpain.net
mavikadin.com mavikadin.com
oldamplefordianrfc.com oldamplefordianrfc.com
ondu.ru ondu.ru
sindonews.com sindonews.com
sparknotes.com sparknotes.com
suportepjfp.com suportepjfp.com
arax.site arax.site
teepr.com teepr.com
thedeadbolt.com thedeadbolt.com
bella-hadid.org bella-hadid.org
blog.0rz.tw blog.0rz.tw
wargabiz.com.my wargabiz.com.my
weieats.me weieats.me
cocidaho.com cocidaho.com
flyblog.cc flyblog.cc
fraghero.com fraghero.com
game8.vn game8.vn
gbatemp.net gbatemp.net
gcube.id gcube.id
goody25.com goody25.com
hijabista.com.my hijabista.com.my
merdeka.com merdeka.com
overeasy.club overeasy.club
redbridgeunitedboysfc.com redbridgeunitedboysfc.com
akkinews.net akkinews.net
thaiticketmajor.com thaiticketmajor.com
tinngan.vn tinngan.vn
titotu.ru titotu.ru
vnex.tv vnex.tv
weibo.com weibo.com
yjg66qf.cn yjg66qf.cn
yshanxuxu.com yshanxuxu.com
comicbookherald.com comicbookherald.com
dreamersradio.com dreamersradio.com
dualshockers.com dualshockers.com
eramuslim.com eramuslim.com
hazardlab.jp hazardlab.jp
homeschoolmath.net homeschoolmath.net
hqcelebrity.org hqcelebrity.org
investasi.web.id investasi.web.id
jabx.net jabx.net
lfgcomic.com lfgcomic.com
mababy.com mababy.com
malaymail.com malaymail.com
onmsft.com onmsft.com
panlasangpinoy.com panlasangpinoy.com
racingweb.site racingweb.site
riaumandiri.haluan.co riaumandiri.haluan.co
applianceinsight.com.tw applianceinsight.com.tw
redcarrufc.co.uk redcarrufc.co.uk
southnewtonfc.co.uk southnewtonfc.co.uk
014438.com 014438.com
stalbansladiesfc.com stalbansladiesfc.com
bajenny.com bajenny.com
uberhumor.com uberhumor.com
worldpopulationreview.com worldpopulationreview.com
edwardmovieclub.com edwardmovieclub.com
fstoppers.com fstoppers.com
goal.com goal.com
gujaratimidday.com gujaratimidday.com
horrornews.net horrornews.net
ihorror.com ihorror.com
myphoneclub.com myphoneclub.com
ohztv.com ohztv.com
oldcooperiansrfc.com oldcooperiansrfc.com
purinkonbayashi.com purinkonbayashi.com
saucemonsters.com saucemonsters.com
sportingnews.com sportingnews.com
stonehavenfc.co.uk stonehavenfc.co.uk
teepr.cc teepr.cc
tgrthaber.com.tr tgrthaber.com.tr
theweekdaytimes.com theweekdaytimes.com
beta.hops.id beta.hops.id
bgr.in bgr.in
bleedingcool.com bleedingcool.com
bowdoncricketclub.com bowdoncricketclub.com
wowkeren.com wowkeren.com
zdtf.icu zdtf.icu
dongtw.com dongtw.com
ksubthai.co ksubthai.co
lolcounter.com lolcounter.com
mook.com.tw mook.com.tw
nonilo.com nonilo.com
oldwilsoniansfc.com oldwilsoniansfc.com
planetminecraft.com planetminecraft.com
inmap.tw inmap.tw
alphingtonafc.com alphingtonafc.com
ssbworld.com ssbworld.com
staplegroveyfc.com staplegroveyfc.com
teamplayergaming.com teamplayergaming.com
utusan.my utusan.my
blackenterprise.com blackenterprise.com
bnext.com.tw bnext.com.tw
coastguardnews.com coastguardnews.com
ggwp.id ggwp.id
grid.id grid.id
jagranjosh.com jagranjosh.com
khaosod.co.th khaosod.co.th
kidlingtonyouthfc.co.uk kidlingtonyouthfc.co.uk
majalahpama.my majalahpama.my
recipepair.com recipepair.com
repeat.tw repeat.tw
rossingtonmainfc.co.uk rossingtonmainfc.co.uk
baomoi.com baomoi.com
vitalegria.com vitalegria.com
welcomehomeblog.com welcomehomeblog.com
zambsroyale.com zambsroyale.com
evinyolu.net evinyolu.net
foodnext.net foodnext.net
horrorfreaknews.com horrorfreaknews.com
iha.com.tr iha.com.tr
inquilab.com inquilab.com
khan.co.kr khan.co.kr
mensxp.com mensxp.com
momotrip.tw momotrip.tw
olm.vn olm.vn
redhillfc.com redhillfc.com
sukansinar.com sukansinar.com
tfc.tv tfc.tv
winscombeafc.co.uk winscombeafc.co.uk
zmescience.com zmescience.com
haroldwoodathleticfc.com haroldwoodathleticfc.com
kidsgroveathleticfc.com kidsgroveathleticfc.com
kilwinningrangers2004.com kilwinningrangers2004.com
liphookripsleycricketclub.com liphookripsleycricketclub.com
liputan6.com liputan6.com
oldemanuelrfc.co.uk oldemanuelrfc.co.uk
poki.by poki.by
prowrestling.com prowrestling.com
redruthalbanyrfc.co.uk redruthalbanyrfc.co.uk
aboluowang.com aboluowang.com
abs-cbn.com abs-cbn.com
rossendalerufc.com rossendalerufc.com
al-anni.com al-anni.com
smmsport.com smmsport.com
aol-ii.com aol-ii.com
southernlionsrufc.com southernlionsrufc.com
vdaily.news vdaily.news
clickanitta.com clickanitta.com
cnnphilippines.com cnnphilippines.com
firefightingnews.com firefightingnews.com
gnav.top gnav.top
herzindagi.com herzindagi.com
jbdailyphotos.com jbdailyphotos.com
kolambil.com kolambil.com
ksk.tw ksk.tw
pargolf.my pargolf.my
popularmilitary.com popularmilitary.com
projekmm.com projekmm.com
ravensyouthfc.co.uk ravensyouthfc.co.uk
aphoneweb.com aphoneweb.com
southparkrangersfc.co.uk southparkrangersfc.co.uk
barbara-palvin.com barbara-palvin.com
cavemancircus.com cavemancircus.com
dreadcentral.com dreadcentral.com
egmeadsfc.co.uk egmeadsfc.co.uk
ekonomirakyat.com.my ekonomirakyat.com.my
freebrushs.com freebrushs.com
harlestontownfc.com harlestontownfc.com
kinhtedothi.vn kinhtedothi.vn
kontan.co.id kontan.co.id
ksubtv.co ksubtv.co
netnews.vn netnews.vn
ngoisao.vn ngoisao.vn
paghamfootballclub.co.uk paghamfootballclub.co.uk
prsekolah.web.id prsekolah.web.id
nciscbs.com nciscbs.com
slant.co slant.co
tiin.vn tiin.vn
belpertownfc.co.uk belpertownfc.co.uk
belstonefc.com belstonefc.com
upliftingtoday.com upliftingtoday.com
willow.tv willow.tv
epicstream.com epicstream.com
feq4k.com feq4k.com
fohc.co.uk fohc.co.uk
healthprep.com healthprep.com
hemat.id hemat.id
jawapos.com jawapos.com
liarfc.co.uk liarfc.co.uk
lionfun.tw lionfun.tw
oldedsfc.com oldedsfc.com
oldwalcountiansrfc.com oldwalcountiansrfc.com
pewpewboy.com pewpewboy.com
stanwayroversfc.co.uk stanwayroversfc.co.uk
swagly.net swagly.net
teambrg.com teambrg.com
twickenhamcc.net twickenhamcc.net
unpuzzlefinance.com unpuzzlefinance.com
yzc122.com yzc122.com
zombsroyale.io zombsroyale.io
decibo.com decibo.com
handlebay.com handlebay.com
haveanice.com haveanice.com
hcrufc.com hcrufc.com
hokiyu.tw hokiyu.tw
jessalba.net jessalba.net
lowerbreckfc.co.uk lowerbreckfc.co.uk
mrmad.com.tw mrmad.com.tw
oneloveunitedfc.com oneloveunitedfc.com
pandit.id pandit.id
pixlr.com pixlr.com
racingweb.net racingweb.net
saucyrecipes.com saucyrecipes.com
sharing.tcincubator.com sharing.tcincubator.com
sujfc.com sujfc.com
tsarizm.com tsarizm.com
wallingfordtownafc.com wallingfordtownafc.com
walsallwoodfc.com walsallwoodfc.com
braintreehc.co.uk braintreehc.co.uk
windleshamutdfc.co.uk windleshamutdfc.co.uk
chat.olm.vn chat.olm.vn
chicksonright.com chicksonright.com
dooserieshd.com dooserieshd.com
garforthvillajfc.co.uk garforthvillajfc.co.uk
girlsaskguys.com girlsaskguys.com
harworthcollieryfc.co.uk harworthcollieryfc.co.uk
kapanlagi.com kapanlagi.com
kingstontownfc.com kingstontownfc.com
olsmj.com olsmj.com
armorgames.com armorgames.com
1001oyun.com 1001oyun.com
baanlaesuan.com baanlaesuan.com
barntgreencc.com barntgreencc.com
usfmensrugby.org usfmensrugby.org
usmclife.com usmclife.com
workingtonrfc.co.uk workingtonrfc.co.uk
xboxclips.co xboxclips.co
crazyppt.com crazyppt.com
immay.tw immay.tw
keresleyrfc.co.uk keresleyrfc.co.uk
littlehamptonunitedfc.co.uk littlehamptonunitedfc.co.uk
movietvtechgeeks.com movietvtechgeeks.com
muaythaiauthority.com muaythaiauthority.com
naidunia.com naidunia.com
pitcheroplay.com pitcheroplay.com
abplive.in abplive.in
aberdeenshirerfc.com aberdeenshirerfc.com
sarawakcrocs.com sarawakcrocs.com
scientology-chinese.com scientology-chinese.com
altoncc.co.uk altoncc.co.uk
alison.com alison.com
stagingeggnetwork.creon.my stagingeggnetwork.creon.my
014718.com 014718.com
stcolumbas.club stcolumbas.club
stocksfieldfc.com stocksfieldfc.com
tdshipleyfc.co.uk tdshipleyfc.co.uk
thenewslens.com thenewslens.com
uxbridgefc.com uxbridgefc.com
blitz.gg blitz.gg
blog.wingzero.tw blog.wingzero.tw
vrsz.icu vrsz.icu
bollywoodlife.com bollywoodlife.com
winscomberfc.co.uk winscomberfc.co.uk
wjpy555.com wjpy555.com
wyvernfc.co.uk wyvernfc.co.uk
yomayo21.ru yomayo21.ru
creepypasta.com creepypasta.com
ealingcc.co.uk ealingcc.co.uk
eliteprospects.com eliteprospects.com
haroldwoodcougarsjfc.co.uk haroldwoodcougarsjfc.co.uk
incar.tw incar.tw
lamchame.com lamchame.com
laxss.com laxss.com
neathcricketclub.co.uk neathcricketclub.co.uk
mojok.co mojok.co
motoweb.net motoweb.net
policerugby.com policerugby.com
riaumandiri.id riaumandiri.id
sddbih.com sddbih.com
sevenoakshockey.club sevenoakshockey.club
anselmiansrufc.com anselmiansrufc.com
spenac.co.uk spenac.co.uk
spielyeti.ch spielyeti.ch
tfcnetball.com tfcnetball.com
batleyboysarlfc.com batleyboysarlfc.com
utusan.com.my utusan.com.my
wandsworthboroughfootballclub.co.uk wandsworthboroughfootballclub.co.uk
chinatimes.com chinatimes.com
farnhamrugby.org farnhamrugby.org
guelphrugby.com guelphrugby.com
jilinhaoda.com jilinhaoda.com
kissthemgoodbye.net kissthemgoodbye.net
mbow.tw mbow.tw
nono41920.com nono41920.com
nycitymvp.com nycitymvp.com
pesquiseaqui.com pesquiseaqui.com
play4.games play4.games
pmfc1.com pmfc1.com
arianapictures.com arianapictures.com
021dy.com 021dy.com
teepr.org teepr.org
readtheory.org readtheory.org
tsionizm.com tsionizm.com
tytheringtonrocksfc.co.uk tytheringtonrocksfc.co.uk
wombwelltownfc.com wombwelltownfc.com
wortonandcheverellfc.com wortonandcheverellfc.com
yolk.life yolk.life
chelmsfordcc.co.uk chelmsfordcc.co.uk
fader.id fader.id
fightersweep.com fightersweep.com
hatfieldathleticfc.com hatfieldathleticfc.com
ivsvs.com ivsvs.com
kemel.fun kemel.fun
kendallkeek.com kendallkeek.com
ledburytownfootballclub.co.uk ledburytownfootballclub.co.uk
littleoakleyfc.co.uk littleoakleyfc.co.uk
mdl3etarekoreia.ir mdl3etarekoreia.ir
megagames.com megagames.com
ndas.cn ndas.cn
oann.com oann.com
pexhilljfc.com pexhilljfc.com
pirbrightyc.com pirbrightyc.com
polycount.com polycount.com
abertillerybgrfc.com abertillerybgrfc.com
afckingstonyouth.co.uk afckingstonyouth.co.uk
sleafordtownfc.co.uk sleafordtownfc.co.uk
resepkoki.id resepkoki.id
twistity.com twistity.com
uhbmn.com uhbmn.com
brymbofc.co.uk brymbofc.co.uk
camberleycc.co.uk camberleycc.co.uk
zingnews.vn zingnews.vn
chuanyusport.com.tw chuanyusport.com.tw
desitelugu.net desitelugu.net
dream.co.id dream.co.id
hamptonyouthfc.com hamptonyouthfc.com
jamja.vn jamja.vn
koventh.club koventh.club
leonafunlife.com leonafunlife.com
maxfoodfun.com maxfoodfun.com
melbournerfc.com melbournerfc.com
ourladyofmercy.ro ourladyofmercy.ro
owrjuniors.org.uk owrjuniors.org.uk
picsee.soci.vip picsee.soci.vip
rastrickcricketclub.co.uk rastrickcricketclub.co.uk
sezhan18.com sezhan18.com
ammoniy.com ammoniy.com
teepr.net teepr.net
thaismf.com thaismf.com
updates2020s.com updates2020s.com
vanillakismis.my vanillakismis.my
viral.id viral.id
violentegg.fun violentegg.fun
yorkrufc.co.uk yorkrufc.co.uk
zingmp3.vn zingmp3.vn
cnbcindonesia.com cnbcindonesia.com
expbravo.com expbravo.com
eynshamnetball.co.uk eynshamnetball.co.uk
fifarosters.com fifarosters.com
finchampsteadcc.co.uk finchampsteadcc.co.uk
htfuelcell.com htfuelcell.com
imreadygo.com imreadygo.com
kwongwah.com.my kwongwah.com.my
melkshamtownfc.com melkshamtownfc.com
movieinsider.com movieinsider.com
nellydyu.tw nellydyu.tw
nurseryrhymes.com nurseryrhymes.com
rannochafc.co.uk rannochafc.co.uk
appcrawlr.com appcrawlr.com
romseyrugby.club romseyrugby.club
scguide07.net scguide07.net
ardsrugby.co.uk ardsrugby.co.uk
setn.com setn.com
012617.com 012617.com
stchadscc.com stchadscc.com
asikq168.com asikq168.com
tattenhoeyouthfc.co.uk tattenhoeyouthfc.co.uk
titi.tw titi.tw
blackpoolrangersjfc.club blackpoolrangersjfc.club
blink.com.tw blink.com.tw
box-manga.com box-manga.com
westleigh.net westleigh.net
brooke-photos.com brooke-photos.com
ctwant.com ctwant.com
durhamcityhockey.com durhamcityhockey.com
etafc.com etafc.com
fmtmalaysia.info fmtmalaysia.info
haberyuzdeyuz.com haberyuzdeyuz.com
hastingsrugby.org hastingsrugby.org
keluarga.my keluarga.my
kilmarnockrfc.com kilmarnockrfc.com
leasticoulddo.com leasticoulddo.com
moneycontrol.com moneycontrol.com
ope8.info ope8.info
royaleapi.com royaleapi.com
amtulsalumni.website amtulsalumni.website
014546.com 014546.com
standrewscoltsfc.co.uk standrewscoltsfc.co.uk
suttonhighfc.com suttonhighfc.com
tattenhoefc.co.uk tattenhoefc.co.uk
bangorrfc.com bangorrfc.com
trendsunitedfc.co.uk trendsunitedfc.co.uk
brockenhurstcc.co.uk brockenhurstcc.co.uk
worcesterraidersfc.com worcesterraidersfc.com
zingnews.com.vn zingnews.com.vn
cindypark.cc cindypark.cc
controlador-090.website controlador-090.website
crushthat.com crushthat.com
hannity.com hannity.com
heanortownfc.co.uk heanortownfc.co.uk
kjyfc.org.uk kjyfc.org.uk
littletownfc.com littletownfc.com
mayandbakerrufc.com mayandbakerrufc.com
moiteigri.com moiteigri.com
nationalinterest.org nationalinterest.org
redmarleyfc.co.uk redmarleyfc.co.uk
allchinacup4.com allchinacup4.com
tekflashlight.com tekflashlight.com
zomacrm.com zomacrm.com
edwardstechnology.website edwardstechnology.website
fidralionshc.club fidralionshc.club
filehippo.com filehippo.com
fyviefc.com fyviefc.com
huncoatunited.co.uk huncoatunited.co.uk
husbandxwife.com husbandxwife.com
hwhc.co.uk hwhc.co.uk
infonet.vn infonet.vn
kruchiangrai.net kruchiangrai.net
laodong.vn laodong.vn
mcnadinsc.co.uk mcnadinsc.co.uk
mydramalist.com mydramalist.com
nufuma.com nufuma.com
pilkingtonrecs.org pilkingtonrecs.org
pixelpushas.shop pixelpushas.shop
prudhoeycfc.com prudhoeycfc.com
quizfactory.com quizfactory.com
robmaness.com robmaness.com
rosehillyouthfc.com rosehillyouthfc.com
ruisliptownfc.co.uk ruisliptownfc.co.uk
alicantecityfc.com alicantecityfc.com
alphaomegafc.com alphaomegafc.com
sofrep.com sofrep.com
sportskeeda.com sportskeeda.com
014340.com 014340.com
abpfc.co.uk abpfc.co.uk
armadafc.co.uk armadafc.co.uk
avorianscc.co.uk avorianscc.co.uk
waddesdoncricketclub.com waddesdoncricketclub.com
zeebiz.com zeebiz.com
cheltenhamcc.co.uk cheltenhamcc.co.uk
dublinnorthhc.com dublinnorthhc.com
fandom.com fandom.com
guesehat.com guesehat.com
hambledonfc.com hambledonfc.com
hsdgallery.net hsdgallery.net
islandmarinefc.com islandmarinefc.com
ledongtho.com ledongtho.com
portarlingtonrugby.com portarlingtonrugby.com
rudgwickfc.co.uk rudgwickfc.co.uk
smcathletic.co.uk smcathletic.co.uk
snapcraft.net snapcraft.net
014317.com 014317.com
strathendrickrfc.com strathendrickrfc.com
techienewsnetwork.com techienewsnetwork.com
tvpoolonline.com tvpoolonline.com
twhc.co.uk twhc.co.uk
ultimate-rihannas.com ultimate-rihannas.com
binghamrufc.co.uk binghamrufc.co.uk
wnefc.com wnefc.com
celeb411.com celeb411.com
cgmagonline.com cgmagonline.com
cmpanthersfc.com cmpanthersfc.com
cpba.cn cpba.cn
deadlyegg.com deadlyegg.com
egg.dance egg.dance
hkusandybayrfc.com hkusandybayrfc.com
julla27.net julla27.net
langdonunitedyfc.co.uk langdonunitedyfc.co.uk
mayandbakersfc.co.uk mayandbakersfc.co.uk
okehamptonrfc.com okehamptonrfc.com
qujipifu.com qujipifu.com
arcadianmc.com arcadianmc.com
ronny.wang ronny.wang
rtl.de rtl.de
altoftsafc.com altoftsafc.com
shnc.co.uk shnc.co.uk
almondsburyfc.co.uk almondsburyfc.co.uk
silksworthlionsfc.co.uk silksworthlionsfc.co.uk
sportsv.net sportsv.net
babyhazelgames.com babyhazelgames.com
barwickcc.co.uk barwickcc.co.uk
waltononthamescc.co.uk waltononthamescc.co.uk
cbm.net cbm.net
controlador-091.website controlador-091.website
daleparkfc.co.uk daleparkfc.co.uk
garstonladiesfc.co.uk garstonladiesfc.co.uk
harpersbazaar.co.id harpersbazaar.co.id
horsforthjfc.org horsforthjfc.org
imleagues.com imleagues.com
kosmo.com.my kosmo.com.my
kpopmap.com kpopmap.com
lekhanhthanh.com lekhanhthanh.com
oyunskor.com oyunskor.com
reefpig.com reefpig.com
probatehelpkitsap.com probatehelpkitsap.com
rcwfc.co.uk rcwfc.co.uk
rhosafc.com rhosafc.com
saddleworthcbtc.co.uk saddleworthcbtc.co.uk
afchenley.com afchenley.com
allaroundhappy.com allaroundhappy.com
staffordtownfc.co.uk staffordtownfc.co.uk
011681.com 011681.com
swanleyfc.co.uk swanleyfc.co.uk
atternews.website atternews.website
beckenhammanorfc.com beckenhammanorfc.com
beesrugby.com beesrugby.com
utusanmelayu.com.my utusanmelayu.com.my
bishopswalthamdynamos.co.uk bishopswalthamdynamos.co.uk
vina.tw vina.tw
watersky.net watersky.net
webserver-pcstoremx.website webserver-pcstoremx.website
wheatleyrufc.com wheatleyrufc.com
widnesrufc.com widnesrufc.com
wivenhoetownfc.com wivenhoetownfc.com
worcesterparkfc.co.uk worcesterparkfc.co.uk
wyreforestphoenixfc.com wyreforestphoenixfc.com
ynysdduwelfare.co.uk ynysdduwelfare.co.uk
zigazig-ha.com zigazig-ha.com
corringhamathleticfc.co.uk corringhamathleticfc.co.uk
dfda.cn dfda.cn
gomhwi.monster gomhwi.monster
hassocksladiesfc.co.uk hassocksladiesfc.co.uk
ictnews.vn ictnews.vn
idiva.com idiva.com
jgtst.com jgtst.com
keighleyalbionarlfc.com keighleyalbionarlfc.com
kipocopys.com kipocopys.com
lamchame.vn lamchame.vn
liveplaylist.net liveplaylist.net
locheeharpjfc.com locheeharpjfc.com
nayatravel.com nayatravel.com
riccallunited.com riccallunited.com
pontnewynyddafc.co.uk pontnewynyddafc.co.uk
rathisci.website rathisci.website
romfordrugby.co.uk romfordrugby.co.uk
skhid.net skhid.net
014327.com 014327.com
suttonvalencehockey.com suttonvalencehockey.com
tarreo.com tarreo.com
teepr.tv teepr.tv
teepr.tw teepr.tw
timesnowtamil.com timesnowtamil.com
trochoi.net trochoi.net
trontv.com trontv.com
uncle4d.com uncle4d.com
upcominghorrormovies.com upcominghorrormovies.com
copthornefc.co.uk copthornefc.co.uk
denhamunitedlfc.co.uk denhamunitedlfc.co.uk
dorchesteronthamescc.com dorchesteronthamescc.com
fantraxhq.com fantraxhq.com
girlsgogames.ru girlsgogames.ru
hullcityosc.org hullcityosc.org
igvofficial.com igvofficial.com
irinashaykphotos.com irinashaykphotos.com
jmtestingagain.com jmtestingagain.com
loadoutroom.com loadoutroom.com
lochaberrfc.co.uk lochaberrfc.co.uk
mope.io mope.io
oofu.icu oofu.icu
orfordfcjuniors.co.uk orfordfcjuniors.co.uk
panthersfc.co.uk panthersfc.co.uk
plymouthphoenixgirlsfc.co.uk plymouthphoenixgirlsfc.co.uk
qwacc.org qwacc.org
rawdonoldboys.com rawdonoldboys.com
actoniansrfc.com actoniansrfc.com
sbobrfc.co.uk sbobrfc.co.uk
sheldonroyalsfc.com sheldonroyalsfc.com
sidearms.io sidearms.io
ambrose-images.net ambrose-images.net
014527.com 014527.com
014762.com 014762.com
123pelit.com 123pelit.com
takmp3.com takmp3.com
bernama.com.my bernama.com.my
bizcritics.com bizcritics.com
wcfc.co.uk wcfc.co.uk
bramleycc.co.uk bramleycc.co.uk
bromsgroverfc.com bromsgroverfc.com
yanagawaoomachi.website yanagawaoomachi.website
zwzt6666.com zwzt6666.com
cpsj3.vip cpsj3.vip
erdingtonrfc.com erdingtonrfc.com
firstpost.com firstpost.com
frjfc.org.uk frjfc.org.uk
furosemidelasixbuy.site furosemidelasixbuy.site
gameblog.fr gameblog.fr
gzhbe.com gzhbe.com
hiphoplately.com hiphoplately.com
kingsleyolympicfc.co.uk kingsleyolympicfc.co.uk
langleyburycc.co.uk langleyburycc.co.uk
lloydsrfc.co.uk lloydsrfc.co.uk
lordswoodyouthfc.com lordswoodyouthfc.com
megajatek.hu megajatek.hu
merciajfc.co.uk merciajfc.co.uk
newsoflegends.com newsoflegends.com
oswaldtwistlestmarysfc.co.uk oswaldtwistlestmarysfc.co.uk
penrithcc.co.uk penrithcc.co.uk
amblesidejfc.org amblesidejfc.org
aldridgecricketclub.co.uk aldridgecricketclub.co.uk
spelthornesportsfc.com spelthornesportsfc.com
014490.com 014490.com
aaqn.top aaqn.top
athleticopitchero.com athleticopitchero.com
ticehurstfc.co.uk ticehurstfc.co.uk
tjtwgy1000.com tjtwgy1000.com
bipik.site bipik.site
britney-galaxy.com britney-galaxy.com
bwltir.com bwltir.com
wycombehousecc.com wycombehousecc.com
ynsadzdpgu.website ynsadzdpgu.website
check4d.com check4d.com
ddm.com.tw ddm.com.tw
delafc.com delafc.com
dyno.gg dyno.gg
freaked.com freaked.com
game735.com game735.com
gkcc.org gkcc.org
glenlionsfc.com glenlionsfc.com
governorpalin.org governorpalin.org
gry.pl gry.pl
hettonlyonsfc.com hettonlyonsfc.com
inquirer.net inquirer.net
live4d2u.com live4d2u.com
lutonrugby.com lutonrugby.com
manatelugu.to manatelugu.to
nhltraderumors.me nhltraderumors.me
nkfburbage.co.uk nkfburbage.co.uk
nutfieldyouthfc.co.uk nutfieldyouthfc.co.uk
okjerseycity.com okjerseycity.com
pcdvd.com.tw pcdvd.com.tw
rimingtonfc.com rimingtonfc.com
ringwoodtownfc.co.uk ringwoodtownfc.co.uk
rodawayroversfc.co.uk rodawayroversfc.co.uk
actoniansfc.co.uk actoniansfc.co.uk
satiride.com satiride.com
sinchew.com.my sinchew.com.my
spartansrufc.co.uk spartansrufc.co.uk
sugarshock.io sugarshock.io
altonrfc.club altonrfc.club
banchorycommunityfc.org banchorycommunityfc.org
beaconsfieldcc.com beaconsfieldcc.com
traffordfc.com traffordfc.com
boveytraceycricketclub.org boveytraceycricketclub.org
brandongrovesafc.com brandongrovesafc.com
broadfieldsunitedfc.co.uk broadfieldsunitedfc.co.uk
buzzkini.com buzzkini.com
ybw44.org ybw44.org
ccyfc.com ccyfc.com
cfpdata.website cfpdata.website
cgmbacklot.com cgmbacklot.com
cmdry.com cmdry.com
cnwhc.co.uk cnwhc.co.uk
downhamtownfc.com downhamtownfc.com
eaglerufc.co.uk eaglerufc.co.uk
fcdeportivogalicia.com fcdeportivogalicia.com
fcmallaby.com fcmallaby.com
girlsgogames.it girlsgogames.it
gmx.com gmx.com
headstonemanoryouthfc.org headstonemanoryouthfc.org
heyfordparkfootballclub.co.uk heyfordparkfootballclub.co.uk
hhczdh.com hhczdh.com
kingslangleyfc.co.uk kingslangleyfc.co.uk
leoaffairs.com leoaffairs.com
lindumcc.co.uk lindumcc.co.uk
lionsrfc.co.uk lionsrfc.co.uk
mail.com mail.com
nekoyoke.com nekoyoke.com
news18.tw news18.tw
nottinghammodernsrfc.com nottinghammodernsrfc.com
oyunlarskor.com oyunlarskor.com
arpcc.org.uk arpcc.org.uk
rutherglenglencairnjfc21s.com rutherglenglencairnjfc21s.com
agame.com agame.com
apkaintezartha.website apkaintezartha.website
stourbridgefc.com stourbridgefc.com
swayjuniorsfc.com swayjuniorsfc.com
auntkeysmith.website auntkeysmith.website
aztecscricketclub.com aztecscricketclub.com
uploadwidget.com uploadwidget.com
wansteadrfc.com wansteadrfc.com
bowersandpitseafootballclub.com bowersandpitseafootballclub.com
widnesfootballclub.co.uk widnesfootballclub.co.uk
wittonalbionfc.co.uk wittonalbionfc.co.uk
wowcandyvisuals.com wowcandyvisuals.com
bwsrvr.dev bwsrvr.dev
coggeshallutdfc.com coggeshallutdfc.com
cryptofree.pw cryptofree.pw
diamondandsilk.com diamondandsilk.com
ehealthinsurance.website ehealthinsurance.website
elkonouz.com elkonouz.com
gamesfreak.net gamesfreak.net
gogy.com gogy.com
gzfszp168.com gzfszp168.com
heysidecricketclub.com heysidecricketclub.com
hullbridgesportsfc.co.uk hullbridgesportsfc.co.uk
kenningwellutd.co.uk kenningwellutd.co.uk
lfg.co lfg.co
lowkickmma.com lowkickmma.com
mcfoxcraft.com mcfoxcraft.com
mineblocks.com mineblocks.com
musselburghathleticfc.co.uk musselburghathleticfc.co.uk
nmgcc.co.uk nmgcc.co.uk
nwrfc.club nwrfc.club
offers-online.info offers-online.info
roaringearth.com roaringearth.com
radstocktownafc.com radstocktownafc.com
royalfalconsfc.club royalfalconsfc.club
ruichangshi.com.cn ruichangshi.com.cn
stratfordtownfc.co.uk stratfordtownfc.co.uk
thebright.com thebright.com
thibaut-pinot.com thibaut-pinot.com
wickfordcricketclub.co.uk wickfordcricketclub.co.uk
cai678.com cai678.com
zurichrugbyacademy.com zurichrugbyacademy.com
charlevillerfc.com charlevillerfc.com
crucible.website crucible.website
earlsdonrfc.co.uk earlsdonrfc.co.uk
eggsarecool.com eggsarecool.com
erskineyouthfc.co.uk erskineyouthfc.co.uk
fifenetball.com fifenetball.com
hzvfdbq.com hzvfdbq.com
jonotestcc.com jonotestcc.com
kirkbycoltsfc.com kirkbycoltsfc.com
minijuegos.com minijuegos.com
naguide.com naguide.com
pontefractrufc.com pontefractrufc.com
reigateltc.org.uk reigateltc.org.uk
rylandnetball.com rylandnetball.com
sheppeyrfc.co.uk sheppeyrfc.co.uk
silverdalejfc.co.uk silverdalejfc.co.uk
haicao69.com haicao69.com
uno.one uno.one
vexation.website vexation.website
whoabella.com whoabella.com
wionews.com wionews.com
cddtjx.com cddtjx.com
dlrccricket.com dlrccricket.com
emmbrookandbearwoodcc.com emmbrookandbearwoodcc.com
ribbletonfc.co.uk ribbletonfc.co.uk
girlsgogames.co.uk girlsgogames.co.uk
gmx.co.uk gmx.co.uk
hacc.club hacc.club
houstonstallionscc.org houstonstallionscc.org
hwrfc.co.uk hwrfc.co.uk
jujuxii.com jujuxii.com
ketteringrugby.com ketteringrugby.com
leedsandbroomfieldcc.com leedsandbroomfieldcc.com
merseysideblindfc.co.uk merseysideblindfc.co.uk
oyunbarbie.com oyunbarbie.com
qkej.top qkej.top
qqhair.tw qqhair.tw
rzwjjc.com rzwjjc.com
rwbhc.co.uk rwbhc.co.uk
alvechurchfc.club alvechurchfc.club
sofifa.com sofifa.com
stneotsrugbyclub.com stneotsrugbyclub.com
taiamoda.com taiamoda.com
bedminstercc.co.uk bedminstercc.co.uk
vijaykarnataka.com vijaykarnataka.com
vulcanworlds.com vulcanworlds.com
brockleycc.co.uk brockleycc.co.uk
catchago.website catchago.website
fcargyle.co.uk fcargyle.co.uk
giantfreakinrobot.com giantfreakinrobot.com
gmx.fr gmx.fr
jeu.fr jeu.fr
jeux.fr jeux.fr
juegosdechicas.com juegosdechicas.com
livingstonrfc.com livingstonrfc.com
mistleyrufc.co.uk mistleyrufc.co.uk
moyuechengyule.com moyuechengyule.com
prtzgl.com prtzgl.com
queencityrugby.org queencityrugby.org
abp-105.website abp-105.website
adoring-kstewart.com adoring-kstewart.com
afcreading.co.uk afcreading.co.uk
15heures.com 15heures.com
warlinghamcc.co.uk warlinghamcc.co.uk
bsjfc.co.uk bsjfc.co.uk
wypfc.co.uk wypfc.co.uk
camdentownyouthfc.com camdentownyouthfc.com
cbd-mart.net cbd-mart.net
chris-hemsworth.org chris-hemsworth.org
dcsexabuselawyer.com dcsexabuselawyer.com
eclipseyouthfc.club eclipseyouthfc.club
edenbridgerugby.co.uk edenbridgerugby.co.uk
ethl33t.uk ethl33t.uk
everettroversfc.co.uk everettroversfc.co.uk
gadgetsnow.com gadgetsnow.com
games.co.uk games.co.uk
gamingsym.com gamingsym.com
giaoducthoidai.vn giaoducthoidai.vn
gooletowncc.co.uk gooletowncc.co.uk
holwellsportsfc.com holwellsportsfc.com
hoot.website hoot.website
ifc.org.uk ifc.org.uk
meophamcc.com meophamcc.com
mousebreaker.com mousebreaker.com
myscrapnook.com myscrapnook.com
nappysxi.com nappysxi.com
oneailfx.com oneailfx.com
pegasus81fc.com pegasus81fc.com
poolafc.com poolafc.com
arabianranchesproperty.biz arabianranchesproperty.biz
ampthilltowncc.co.uk ampthilltowncc.co.uk
soft32.de soft32.de
soft32.it soft32.it
sports442.com sports442.com
014201.com 014201.com
stmarys1947fc.co.uk stmarys1947fc.co.uk
sunburycricket.co.uk sunburycricket.co.uk
thorncliffefcu10.co.uk thorncliffefcu10.co.uk
tokoyun.com tokoyun.com
bilbrookjunior.co.uk bilbrookjunior.co.uk
viralmotion.net viralmotion.net
xecuatui.vn xecuatui.vn
zanz.net zanz.net
zzz109.top zzz109.top
datchworthrugby.club datchworthrugby.club
edgbastonhc.co.uk edgbastonhc.co.uk
esquire.co.id esquire.co.id
focus-proxy.com focus-proxy.com
gamesgames.com gamesgames.com
garstangcc.co.uk garstangcc.co.uk
gmx.at gmx.at
gooleafc.com gooleafc.com
gwrovers.com gwrovers.com
hbfc1872.co.uk hbfc1872.co.uk
howdenafc.co.uk howdenafc.co.uk
iamgujarat.com iamgujarat.com
juegos.com juegos.com
mkhockey.co.uk mkhockey.co.uk
arcadeprehacks.com arcadeprehacks.com
rutherfordafc.co.uk rutherfordafc.co.uk
sandbachunitedfc.co.uk sandbachunitedfc.co.uk
afcgatwick.co.uk afcgatwick.co.uk
sidcupcc.co.uk sidcupcc.co.uk
soft32.com.br soft32.com.br
specialoperations.com specialoperations.com
swanagefc.com swanagefc.com
tdhulgql.site tdhulgql.site
tewcc.org.uk tewcc.org.uk
uwwnc.co.uk uwwnc.co.uk
wor7.com wor7.com
burghfieldfootballclub.com burghfieldfootballclub.com
cradleytownfc.co.uk cradleytownfc.co.uk
doversharksrugby.com doversharksrugby.com
enfieldcricketclub.com enfieldcricketclub.com
etonmanorrfc.com etonmanorrfc.com
gmx.ch gmx.ch
gmx.es gmx.es
hip-hopvibe.com hip-hopvibe.com
hmn.tw hmn.tw
kidlingtoncricket.com kidlingtoncricket.com
knaphillfootballclub.com knaphillfootballclub.com
kpopf.app kpopf.app
lanadelreyfan.com lanadelreyfan.com
lborofoxes.co.uk lborofoxes.co.uk
levelup.com levelup.com
matamata.com matamata.com
maximindonesia.co.id maximindonesia.co.id
mearnsyouthfc.co.uk mearnsyouthfc.co.uk
needhammarketfc.co.uk needhammarketfc.co.uk
oakwoodfc.co.uk oakwoodfc.co.uk
pinkneysgreencc.com pinkneysgreencc.com
abhilashwedsarchana.website abhilashwedsarchana.website
actonianslfc.com actonianslfc.com
sandsunitedfc.co.uk sandsunitedfc.co.uk
afcpogmoor.co.uk afcpogmoor.co.uk
alnwickbears.co.uk alnwickbears.co.uk
shootoldschool.com shootoldschool.com
011362.com 011362.com
abbeyvalefc.co.uk abbeyvalefc.co.uk
botleyvillagefc.co.uk botleyvillagefc.co.uk
braintreetownyouthfc.co.uk braintreetownyouthfc.co.uk
wetherbyrufc.com wetherbyrufc.com
wolvertontigermoths.co.uk wolvertontigermoths.co.uk
bwin900.org bwin900.org
chapeltownhc.com chapeltownhc.com
congletonrufc.co.uk congletonrufc.co.uk
cosmogirl.co.id cosmogirl.co.id
cpdbarnet.com cpdbarnet.com
cumnockrugby.com cumnockrugby.com
dagenhamrufc.co.uk dagenhamrufc.co.uk
dalbeattiestar.co.uk dalbeattiestar.co.uk
deepingrangersfc.co.uk deepingrangersfc.co.uk
forums.arcadianmc.com forums.arcadianmc.com
garagesafari.website garagesafari.website
haslemererugby.co.uk haslemererugby.co.uk
hendonrugby.com hendonrugby.com
imgpile.com imgpile.com
kirkheatonyouthfc.com kirkheatonyouthfc.com
kqr936.cn kqr936.cn
lightwaterrfc.com lightwaterrfc.com
marplerugbyclub.com marplerugbyclub.com
mixmag.net mixmag.net
news18.com news18.com
nzxlmiaomu.com nzxlmiaomu.com
ovcricket.com ovcricket.com
raidboss.org raidboss.org
rpgsite.net rpgsite.net
shipstononstourcc.co.uk shipstononstourcc.co.uk
soft32.es soft32.es
013306.com 013306.com
streatham-croydonrfc.com streatham-croydonrfc.com
swaffhamrufc.co.uk swaffhamrufc.co.uk
ayrhockeyclub.com ayrhockeyclub.com
bemertonheathfc.com bemertonheathfc.com
beri201314.com beri201314.com
usportsmouthhockey.co.uk usportsmouthhockey.co.uk
web.de web.de
bradleystoketownfc.com bradleystoketownfc.com
cainscrossrfc.org cainscrossrfc.org
canterburycityfc.net canterburycityfc.net
ydrfc.com ydrfc.com
dastelefonbuch.de dastelefonbuch.de
dressuppink.com dressuppink.com
driffieldhockey.co.uk driffieldhockey.co.uk
durkarfc.co.uk durkarfc.co.uk
eghamcricketclub.com eghamcricketclub.com
gamingwonderland.com gamingwonderland.com
knutsfordfootballclub.com knutsfordfootballclub.com
nameness.com nameness.com
nottinghamcorsairsrfc.com nottinghamcorsairsrfc.com
parkwoodrangersfc.co.uk parkwoodrangersfc.co.uk
portisheadtownfc.com portisheadtownfc.com
sharepod.soft32.it sharepod.soft32.it
ammyy-admin.soft32.de ammyy-admin.soft32.de
soderetube.com soderetube.com
southperry.net southperry.net
starter-background-changer.soft32.it starter-background-changer.soft32.it
surgeon-simulator.soft32.de surgeon-simulator.soft32.de
teamspeak.soft32.com.br teamspeak.soft32.com.br
teamviewer.soft32.it teamviewer.soft32.it
avast-free-antivirus.soft32.it avast-free-antivirus.soft32.it
avg-antivirus-free.soft32.com.br avg-antivirus-free.soft32.com.br
avira-free-antivirus.soft32.de avira-free-antivirus.soft32.de
avira-free-antivirus.soft32.it avira-free-antivirus.soft32.it
thatchamrugby.co.uk thatchamrugby.co.uk
aylesburyunitedladiesgirlsfc.com aylesburyunitedladiesgirlsfc.com
turbo-c.soft32.it turbo-c.soft32.it
ultraedit.soft32.de ultraedit.soft32.de
vandalrandom.com vandalrandom.com
blender.soft32.es blender.soft32.es
viber.soft32.de viber.soft32.de
virtualdub.soft32.de virtualdub.soft32.de
bluestacks-app-player.soft32.de bluestacks-app-player.soft32.de
bluestacks-app-player.soft32.es bluestacks-app-player.soft32.es
vns33vns.com vns33vns.com
vlc-media-player.soft32.com.br vlc-media-player.soft32.com.br
vlc-media-player.soft32.it vlc-media-player.soft32.it
bonessunitedfc.co.uk bonessunitedfc.co.uk
bowdonrufc.co.uk bowdonrufc.co.uk
windows-7.soft32.de windows-7.soft32.de
windows-media-player-11.soft32.com.br windows-media-player-11.soft32.com.br
windows-media-player-11.soft32.de windows-media-player-11.soft32.de
windows-media-player-11.soft32.es windows-media-player-11.soft32.es
windows-xp-service-pack-2.soft32.de windows-xp-service-pack-2.soft32.de
windows-xp-service-pack-2.soft32.es windows-xp-service-pack-2.soft32.es
wisbechtownfc.co.uk wisbechtownfc.co.uk
winrar.soft32.de winrar.soft32.de
winrar.soft32.it winrar.soft32.it
winzip.soft32.com.br winzip.soft32.com.br
winzip.soft32.de winzip.soft32.de
wizard101.soft32.de wizard101.soft32.de
camtasia-studio.soft32.com.br camtasia-studio.soft32.com.br
camtasia-studio.soft32.es camtasia-studio.soft32.es
camtasia-studio.soft32.it camtasia-studio.soft32.it
chesterhc.co.uk chesterhc.co.uk
chris-hemsworth.net chris-hemsworth.net
climaxcraft.com climaxcraft.com
convertxtodvd.soft32.es convertxtodvd.soft32.es
cool-edit-pro.soft32.es cool-edit-pro.soft32.es
cprfc.com cprfc.com
cpu-z.soft32.it cpu-z.soft32.it
dressupgal.com dressupgal.com
everest.soft32.com.br everest.soft32.com.br
evernote.soft32.de evernote.soft32.de
fitnessformen.co.id fitnessformen.co.id
flip4mac-wmv-player.soft32.com.br flip4mac-wmv-player.soft32.com.br
foxit-reader.soft32.com.br foxit-reader.soft32.com.br
free-cuda-video-converter.soft32.it free-cuda-video-converter.soft32.it
free-studio.soft32.it free-studio.soft32.it
giulio-garaffa.co.uk giulio-garaffa.co.uk
gomezgallery.org gomezgallery.org
rainhillcc.com rainhillcc.com
half-life-2-garrys-mod.soft32.es half-life-2-garrys-mod.soft32.es
hamachi.soft32.de hamachi.soft32.de
hgujfc.co.uk hgujfc.co.uk
htmlgames.com htmlgames.com
hullwyke.com hullwyke.com
internet-download-manager.soft32.es internet-download-manager.soft32.es
irfanview.soft32.de irfanview.soft32.de
irfanview.soft32.es irfanview.soft32.es
java-runtime-environment.soft32.com.br java-runtime-environment.soft32.com.br
java-runtime-environment.soft32.it java-runtime-environment.soft32.it
jogo.cz jogo.cz
juegosaccion.es juegosaccion.es
kmplayer.soft32.de kmplayer.soft32.de
mackeeper.soft32.de mackeeper.soft32.de
mahjongjeux.com mahjongjeux.com
merrowcc.co.uk merrowcc.co.uk
microsoft-project-professional.soft32.com.br microsoft-project-professional.soft32.com.br
microsoft-project-professional.soft32.de microsoft-project-professional.soft32.de
microsoft-security-essentials.soft32.com.br microsoft-security-essentials.soft32.com.br
mozilla-thunderbird.soft32.com.br mozilla-thunderbird.soft32.com.br
msn-messenger.soft32.com.br msn-messenger.soft32.com.br
ojogos.com.br ojogos.com.br
onyx.soft32.it onyx.soft32.it
openoffice.soft32.com.br openoffice.soft32.com.br
openoffice.soft32.it openoffice.soft32.it
opera-web-browser.soft32.de opera-web-browser.soft32.de
outlook-express.soft32.com.br outlook-express.soft32.com.br
parkroyalfc.co.uk parkroyalfc.co.uk
picasa.soft32.it picasa.soft32.it
plants-vs-zombies.soft32.de plants-vs-zombies.soft32.de
powerarchiver.soft32.de powerarchiver.soft32.de
powerpoint.soft32.it powerpoint.soft32.it
proshow-gold.soft32.it proshow-gold.soft32.it
rickmansworthcc.co.uk rickmansworthcc.co.uk
rugbyclub9.be rugbyclub9.be
safari.soft32.es safari.soft32.es
safari.soft32.it safari.soft32.it
ad-aware-free-antivirus.soft32.com.br ad-aware-free-antivirus.soft32.com.br
advanced-systemcare.soft32.it advanced-systemcare.soft32.it
sckufu.com sckufu.com
ammyy-admin.soft32.com.br ammyy-admin.soft32.com.br
skype.soft32.de skype.soft32.de
skype.soft32.it skype.soft32.it
snagit.soft32.es snagit.soft32.es
012744.com 012744.com
sthelensfc.co.uk sthelensfc.co.uk
teamviewer.soft32.com.br teamviewer.soft32.com.br
avira-antivir-premium.soft32.com.br avira-antivir-premium.soft32.com.br
avrojfc.org avrojfc.org
aylesburyvaledynamos.co.uk aylesburyvaledynamos.co.uk
thelakewoodscoop.com thelakewoodscoop.com
badgersrugby.com badgersrugby.com
torpointafc.co.uk torpointafc.co.uk
berkswichfc.co.uk berkswichfc.co.uk
viber.soft32.com.br viber.soft32.com.br
bluestacks-app-player.soft32.com.br bluestacks-app-player.soft32.com.br
bluestacks-app-player.soft32.it bluestacks-app-player.soft32.it
wamp.soft32.it wamp.soft32.it
warhistoryonline.com warhistoryonline.com
windows-live-movie-maker.soft32.de windows-live-movie-maker.soft32.de
windows-xp-service-pack-2.soft32.com.br windows-xp-service-pack-2.soft32.com.br
windows-xp-service-pack-3.soft32.de windows-xp-service-pack-3.soft32.de
cdburnerxp.soft32.com.br cdburnerxp.soft32.com.br
convertxtodvd.soft32.com.br convertxtodvd.soft32.com.br
convertxtodvd.soft32.de convertxtodvd.soft32.de
cpu-z.soft32.de cpu-z.soft32.de
cyberlink-youcam.soft32.com.br cyberlink-youcam.soft32.com.br
didsburynorthernhc.co.uk didsburynorthernhc.co.uk
dressup.com dressup.com
drivermax.soft32.es drivermax.soft32.es
dropbox.soft32.com.br dropbox.soft32.com.br
facebook-messenger.soft32.it facebook-messenger.soft32.it
flip4mac-wmv-player.soft32.it flip4mac-wmv-player.soft32.it
gagapictures.com gagapictures.com
gameranger.com gameranger.com
google-earth.soft32.com.br google-earth.soft32.com.br
google-earth.soft32.de google-earth.soft32.de
google-earth.soft32.it google-earth.soft32.it
googlechrome.soft32.com.br googlechrome.soft32.com.br
googlechrome.soft32.de googlechrome.soft32.de
hamachi.soft32.es hamachi.soft32.es
hrajhry.sk hrajhry.sk
hugin.soft32.com.br hugin.soft32.com.br
icofx.soft32.com.br icofx.soft32.com.br
icofx.soft32.de icofx.soft32.de
indobig.ru indobig.ru
internet-download-manager.soft32.com.br internet-download-manager.soft32.com.br
internet-download-manager.soft32.de internet-download-manager.soft32.de
internet-explorer-for-mac.soft32.com.br internet-explorer-for-mac.soft32.com.br
internet-explorer-for-mac.soft32.es internet-explorer-for-mac.soft32.es
iobit-uninstaller.soft32.de iobit-uninstaller.soft32.de
itunes.soft32.it itunes.soft32.it
juegosgestiontiempo.com juegosgestiontiempo.com
kies.soft32.it kies.soft32.it
kingsoft-office-free.soft32.de kingsoft-office-free.soft32.de
kingsoft-office-free.soft32.it kingsoft-office-free.soft32.it
kmplayer.soft32.it kmplayer.soft32.it
lcpdfr.com lcpdfr.com
llandaffrugby.org llandaffrugby.org
lplchampionship.com lplchampionship.com
macx-dvd-ripper-pro.soft32.com.br macx-dvd-ripper-pro.soft32.com.br
macx-dvd-ripper-pro.soft32.it macx-dvd-ripper-pro.soft32.it
mallowrfc.com mallowrfc.com
match3spellen.nl match3spellen.nl
mathtype.soft32.com.br mathtype.soft32.com.br
microsoft-net-framework.soft32.es microsoft-net-framework.soft32.es
minecraft.soft32.it minecraft.soft32.it
mineheroes.net mineheroes.net
mozilla-firefox.soft32.de mozilla-firefox.soft32.de
nero-burning-rom-2.soft32.de nero-burning-rom-2.soft32.de
nzpools.com nzpools.com
openoffice.soft32.es openoffice.soft32.es
opera-web-browser-for-mac.soft32.it opera-web-browser-for-mac.soft32.it
outlook-express.soft32.de outlook-express.soft32.de
paltalk.soft32.es paltalk.soft32.es
parallels-desktop-for-mac.soft32.it parallels-desktop-for-mac.soft32.it
partition-magic.soft32.it partition-magic.soft32.it
pinnstarsfc.com pinnstarsfc.com
pokemon-emerald-version.soft32.de pokemon-emerald-version.soft32.de
powerpoint.soft32.es powerpoint.soft32.es
pspad-editor.soft32.de pspad-editor.soft32.de
quick-media-converter.soft32.it quick-media-converter.soft32.it
radcliffeolympic.co.uk radcliffeolympic.co.uk
rar-expander.soft32.com.br rar-expander.soft32.com.br
acoustica-mp3-audio-mixer.soft32.de acoustica-mp3-audio-mixer.soft32.de
safari.soft32.com.br safari.soft32.com.br
skype.soft32.com.br skype.soft32.com.br
slender.soft32.com.br slender.soft32.com.br
slender.soft32.de slender.soft32.de
skyforcefc2.com skyforcefc2.com
askeansrfc.com askeansrfc.com
0938zd.com 0938zd.com
steam.soft32.com.br steam.soft32.com.br
steam.soft32.it steam.soft32.it
supertux.soft32.it supertux.soft32.it
surgeon-simulator.soft32.es surgeon-simulator.soft32.es
szbcnsbmw.com szbcnsbmw.com
avg-antivirus-free.soft32.it avg-antivirus-free.soft32.it
theconcordinsider.com theconcordinsider.com
bandlfc.uk bandlfc.uk
beginwithsoftware.com beginwithsoftware.com
bishops.ch bishops.ch
bitlord.soft32.com.br bitlord.soft32.com.br
bitlord.soft32.it bitlord.soft32.it
viber.soft32.es viber.soft32.es
viber.soft32.it viber.soft32.it
virtual-dj.soft32.de virtual-dj.soft32.de
virtual-dj.soft32.it virtual-dj.soft32.it
vlc-media-player.soft32.de vlc-media-player.soft32.de
vlc-media-player.soft32.es vlc-media-player.soft32.es
windows-live-movie-maker.soft32.es windows-live-movie-maker.soft32.es
winrar.soft32.com.br winrar.soft32.com.br
wollatonhallyfc.co.uk wollatonhallyfc.co.uk
bullzip-pdf-printer.soft32.de bullzip-pdf-printer.soft32.de
bullzip-pdf-printer.soft32.it bullzip-pdf-printer.soft32.it
wwwshe.com wwwshe.com
caithnessrugbyfootballclub.com caithnessrugbyfootballclub.com
xnview.soft32.es xnview.soft32.es
camtasia-studio.soft32.de camtasia-studio.soft32.de
cheat-engine.soft32.it cheat-engine.soft32.it
corel-videostudio-pro.soft32.com.br corel-videostudio-pro.soft32.com.br
cuckfieldcosmosfc.co.uk cuckfieldcosmosfc.co.uk
detailfun.club detailfun.club
directx-redistributable.soft32.it directx-redistributable.soft32.it
drivermax.soft32.com.br drivermax.soft32.com.br
dropbox.soft32.it dropbox.soft32.it
elycityfc.co.uk elycityfc.co.uk
emdb-erics-movie-database.soft32.com.br emdb-erics-movie-database.soft32.com.br
emule.soft32.com.br emule.soft32.com.br
exmouthrugby.co.uk exmouthrugby.co.uk
filezilla.soft32.de filezilla.soft32.de
foxit-reader.soft32.it foxit-reader.soft32.it
ghacks.net ghacks.net
giochimahjong.it giochimahjong.it
glary-utilities.soft32.de glary-utilities.soft32.de
heddonjuniorsfootballclub.co.uk heddonjuniorsfootballclub.co.uk
internet-explorer-9.soft32.it internet-explorer-9.soft32.it
itunes.soft32.de itunes.soft32.de
izzygames.com izzygames.com
juegos-mentales.com juegos-mentales.com
kindle.soft32.com.br kindle.soft32.com.br
kindle.soft32.it kindle.soft32.it
kiz10.com kiz10.com
kmplayer.soft32.com.br kmplayer.soft32.com.br
libreoffice.soft32.de libreoffice.soft32.de
libreoffice.soft32.it libreoffice.soft32.it
mahee.com mahee.com
malvernvalefc.com malvernvalefc.com
match3.co.uk match3.co.uk
microsoft-net-framework.soft32.it microsoft-net-framework.soft32.it
mozilla-firefox.soft32.es mozilla-firefox.soft32.es
mozilla-thunderbird.soft32.de mozilla-thunderbird.soft32.de
mysearch.com mysearch.com
nesn.com nesn.com
netscape-navigator.soft32.de netscape-navigator.soft32.de
network-inventory-advisor.soft32.it network-inventory-advisor.soft32.it
orbit-downloader.soft32.com.br orbit-downloader.soft32.com.br
outlook-express.soft32.it outlook-express.soft32.it
pelikone.fi pelikone.fi
pocklingtoncc.com pocklingtoncc.com
powerpoint.soft32.com.br powerpoint.soft32.com.br
primopdf.soft32.de primopdf.soft32.de
qhdyryx.com qhdyryx.com
quicktime.soft32.com.br quicktime.soft32.com.br
quicktime.soft32.es quicktime.soft32.es
rar-expander.soft32.it rar-expander.soft32.it
relmz.io relmz.io
advanced-systemcare.soft32.com.br advanced-systemcare.soft32.com.br
aimp.soft32.de aimp.soft32.de
aktionspiele.de aktionspiele.de
snagit.soft32.de snagit.soft32.de
appcleaner.soft32.de appcleaner.soft32.de
012795.com 012795.com
013871.com 013871.com
super-mario-forever.soft32.com.br super-mario-forever.soft32.com.br
super-mario-forever.soft32.it super-mario-forever.soft32.it
teamviewer.soft32.de teamviewer.soft32.de
teamviewer.soft32.es teamviewer.soft32.es
arjun.tw arjun.tw
thamehockey.co.uk thamehockey.co.uk
avira-free-antivirus.soft32.com.br avira-free-antivirus.soft32.com.br
toast-titanium.soft32.it toast-titanium.soft32.it
tor.soft32.com.br tor.soft32.com.br
total-uninstall.soft32.de total-uninstall.soft32.de
tresenraya.com tresenraya.com
turbo-c.soft32.de turbo-c.soft32.de
ultrasurf.soft32.de ultrasurf.soft32.de
valleyadvocate.com valleyadvocate.com
blender.soft32.de blender.soft32.de
bletchleyrugby.com bletchleyrugby.com
virtual-dj.soft32.es virtual-dj.soft32.es
wbthc.org.uk wbthc.org.uk
wegotthiscovered.com wegotthiscovered.com
wimmelbildspiele.de wimmelbildspiele.de
winamp.soft32.de winamp.soft32.de
windows-7.soft32.com.br windows-7.soft32.com.br
windows-live-movie-maker.soft32.it windows-live-movie-maker.soft32.it
windows-xp-service-pack-2.soft32.it windows-xp-service-pack-2.soft32.it
windows-xp-service-pack-3.soft32.com.br windows-xp-service-pack-3.soft32.com.br
broughtonraversjfc.com broughtonraversjfc.com
winscp.soft32.com.br winscp.soft32.com.br
winscp.soft32.es winscp.soft32.es
bubbleshooter.net bubbleshooter.net
womenjoy.net womenjoy.net
worcestercityfc.org worcestercityfc.org
bungy.paris bungy.paris
wykearlfc.co.uk wykearlfc.co.uk
zeitmanagementspiel.de zeitmanagementspiel.de
chemsketch.soft32.com.br chemsketch.soft32.com.br
comptonfc.co.uk comptonfc.co.uk
ctshush.co.uk ctshush.co.uk
deltacommunityu.com deltacommunityu.com
drgbristol.com drgbristol.com
eraser.soft32.com.br eraser.soft32.com.br
everest.soft32.it everest.soft32.it
evernote.soft32.es evernote.soft32.es
filezilla.soft32.es filezilla.soft32.es
full-dvd-ripper-free.soft32.it full-dvd-ripper-free.soft32.it
gamefront.com gamefront.com
gillinghamgreenfc.com gillinghamgreenfc.com
gimp.soft32.com.br gimp.soft32.com.br
giochi.it giochi.it
gmx.net gmx.net
half-life-2-garrys-mod.soft32.de half-life-2-garrys-mod.soft32.de
hamachi.soft32.com.br hamachi.soft32.com.br
heskethcoltsjfc.co.uk heskethcoltsjfc.co.uk
hiddenobjectgames.com hiddenobjectgames.com
hma-pro-vpn.soft32.es hma-pro-vpn.soft32.es
hryzadarmo.sk hryzadarmo.sk
internet-explorer-10.soft32.de internet-explorer-10.soft32.de
internet-explorer-for-mac.soft32.it internet-explorer-for-mac.soft32.it
kindle.soft32.de kindle.soft32.de
mhotspot.soft32.com.br mhotspot.soft32.com.br
microsoft-project-professional.soft32.it microsoft-project-professional.soft32.it
microsoft-security-essentials.soft32.de microsoft-security-essentials.soft32.de
microsoft-security-essentials.soft32.it microsoft-security-essentials.soft32.it
mindgames.com mindgames.com
minecraft.soft32.de minecraft.soft32.de
minelink.net minelink.net
mozilla-firefox.soft32.com.br mozilla-firefox.soft32.com.br
mozilla-firefox.soft32.it mozilla-firefox.soft32.it
mozilla-thunderbird.soft32.es mozilla-thunderbird.soft32.es
network-inventory-advisor.soft32.com.br network-inventory-advisor.soft32.com.br
notepad.soft32.de notepad.soft32.de
ollertontownfc.co.uk ollertontownfc.co.uk
opera-web-browser.soft32.com.br opera-web-browser.soft32.com.br
opera-web-browser.soft32.it opera-web-browser.soft32.it
paint-net.soft32.it paint-net.soft32.it
paintbrush.soft32.it paintbrush.soft32.it
paltalk.soft32.de paltalk.soft32.de
partition-magic.soft32.com.br partition-magic.soft32.com.br
partition-magic.soft32.de partition-magic.soft32.de
photoscape.soft32.es photoscape.soft32.es
picasa.soft32.de picasa.soft32.de
pokemon-emerald-version.soft32.es pokemon-emerald-version.soft32.es
prideparkfc.com prideparkfc.com
raidcall.soft32.com.br raidcall.soft32.com.br
rickey.org rickey.org
roachdynamosjfc.com roachdynamosjfc.com
advanced-systemcare.soft32.de advanced-systemcare.soft32.de
aireboroughrugby.com aireboroughrugby.com
al3abmizo.com al3abmizo.com
alodokter.com alodokter.com
cari-kos.com cari-kos.com
shugaban.com shugaban.com
sihape.com sihape.com
silverlight.soft32.es silverlight.soft32.es
smelty.net smelty.net
songr.soft32.com.br songr.soft32.com.br
sphax-purebdcraft-craft.soft32.de sphax-purebdcraft-craft.soft32.de
spelletje.nl spelletje.nl
1001jeuxenligne.fr 1001jeuxenligne.fr
1001jogos.com.br 1001jogos.com.br
1001spiele.jetzt 1001spiele.jetzt
suaramudanews.com suaramudanews.com
sumutpos.co sumutpos.co
superhry.cz superhry.cz
swakarya.com swakarya.com
swara-bengkulu.com swara-bengkulu.com
atmeplay.com atmeplay.com
babyfynsy.com babyfynsy.com
baohomnay.com baohomnay.com
batamxinwen.com batamxinwen.com
total-video.soft32.it total-video.soft32.it
berowrafco35.com berowrafco35.com
tvblik.nl tvblik.nl
ubomoney.net ubomoney.net
utdt.net utdt.net
visual-basic-express.soft32.com.br visual-basic-express.soft32.com.br
vseigru.net vseigru.net
vynagame.com vynagame.com
boredomtherapy.com boredomtherapy.com
waspada.co.id waspada.co.id
weeklycurrents.com weeklycurrents.com
weeklyrecordherald.com weeklyrecordherald.com
wickedgoodgames.com wickedgoodgames.com
windows-7.soft32.es windows-7.soft32.es
woozworld.com woozworld.com
wowgame24.com wowgame24.com
xacsx.de xacsx.de
xeniagazette.com xeniagazette.com
xsmb.vn xsmb.vn
yof.com yof.com
yupoutlet.nl yupoutlet.nl
cdn-app.freevpn.us cdn-app.freevpn.us
zustelldienst-graz.at zustelldienst-graz.at
id.jobplanet.com id.jobplanet.com
cinema-4d.soft32.es cinema-4d.soft32.es
coffeebreakarcade.com coffeebreakarcade.com
cool-edit-pro.soft32.de cool-edit-pro.soft32.de
cyberlink-powerdirector.soft32.it cyberlink-powerdirector.soft32.it
dijelas.in dijelas.in
directx-redistributable.soft32.com.br directx-redistributable.soft32.com.br
enjoydressup.com enjoydressup.com
eraser.soft32.de eraser.soft32.de
fairborndailyherald.com fairborndailyherald.com
farah.id farah.id
flight-simulator-x.soft32.de flight-simulator-x.soft32.de
flight-simulator-x.soft32.es flight-simulator-x.soft32.es
fokusjabar.id fokusjabar.id
free-cuda-video-converter.soft32.com.br free-cuda-video-converter.soft32.com.br
free-cuda-video-converter.soft32.es free-cuda-video-converter.soft32.es
fynsy.ru fynsy.ru
gamasexual.com gamasexual.com
gamebrott.com gamebrott.com
gamexran.com gamexran.com
genpi.co genpi.co
girlieplay.net girlieplay.net
glary-utilities.soft32.es glary-utilities.soft32.es
goldhillfc.co.uk goldhillfc.co.uk
gsflash.ru gsflash.ru
haluansumatera.com haluansumatera.com
harapanrakyat.com harapanrakyat.com
hellodog.eu hellodog.eu
hepy.be hepy.be
hepy.es hepy.es
hepy.fr hepy.fr
hepy.games hepy.games
hepy.it hepy.it
hhcourier.com hhcourier.com
hoc247.vn hoc247.vn
horizon.soft32.de horizon.soft32.de
hrydnes.cz hrydnes.cz
hryprodivky.cz hryprodivky.cz
ilovearcade.com ilovearcade.com
ingyenesjatekok.hu ingyenesjatekok.hu
internet-explorer-for-mac.soft32.de internet-explorer-for-mac.soft32.de
iotqdu.com iotqdu.com
isoladeigiochi.it isoladeigiochi.it
istat-pro.soft32.it istat-pro.soft32.it
itunes.soft32.com.br itunes.soft32.com.br
izzyjeux.fr izzyjeux.fr
jagoanssh.com jagoanssh.com
java-runtime-environment.soft32.de java-runtime-environment.soft32.de
jocuriin2.ro jocuriin2.ro
joernalinakor.com joernalinakor.com
juegosdedescendientes.com juegosdedescendientes.com
juegosdefutbol2020.com juegosdefutbol2020.com
kabargames.id kabargames.id
kids-n-fun.de kids-n-fun.de
kikirti.com kikirti.com
koalahero.com koalahero.com
kompastimur.com kompastimur.com
kreativv.com kreativv.com
kukispiele.de kukispiele.de
lensajatengnews.com lensajatengnews.com
libreoffice.soft32.com.br libreoffice.soft32.com.br
limaohio.com limaohio.com
lylagames.com lylagames.com
mackeeper.soft32.com.br mackeeper.soft32.com.br
mahjong-spiele.at mahjong-spiele.at
mahjongspelen.nl mahjongspelen.nl
mary.com mary.com
mathtype.soft32.it mathtype.soft32.it
mediaempatlawang.com mediaempatlawang.com
microsoft-net-framework.soft32.com.br microsoft-net-framework.soft32.com.br
microsoft-project-professional.soft32.es microsoft-project-professional.soft32.es
midhurstandeasebournefc.co.uk midhurstandeasebournefc.co.uk
mngdoom.com mngdoom.com
moneyfazz.id moneyfazz.id
mozilla-thunderbird.soft32.it mozilla-thunderbird.soft32.it
mubapostnews.com mubapostnews.com
onews-id.com onews-id.com
onyx.soft32.com.br onyx.soft32.com.br
ooredooplay.com ooredooplay.com
pandagila.com pandagila.com
playcombo.com playcombo.com
playmob.tv playmob.tv
playzzz.com playzzz.com
pomu.com pomu.com
pomu.dk pomu.dk
pomu.no pomu.no
popa.hk popa.hk
pregnancy.co.id pregnancy.co.id
publiksatu.co publiksatu.co
quick-media-converter.soft32.com.br quick-media-converter.soft32.com.br
registerherald.com registerherald.com
ruangrakyat.com ruangrakyat.com
acdsee.soft32.de acdsee.soft32.de
seasia.co seasia.co
selipan.com selipan.com
selembardigital.com selembardigital.com
serumpi.com serumpi.com
shayef.net shayef.net
shefford-saints.com shefford-saints.com
ammyy-admin.soft32.es ammyy-admin.soft32.es
mimin.tv mimin.tv
skype.soft32.es skype.soft32.es
stacyontheright.com stacyontheright.com
014931.com 014931.com
1001jeux.ca 1001jeux.ca
1001jeux.fr 1001jeux.fr
1001juegos.com.co 1001juegos.com.co
1001juegos.com.mx 1001juegos.com.mx
abadikini.com abadikini.com
sultranews.co.id sultranews.co.id
supertux.soft32.com.br supertux.soft32.com.br
suratkabar.id suratkabar.id
atbakfit.com atbakfit.com
tdn-net.com tdn-net.com
audacity.soft32.es audacity.soft32.es
terkini.id terkini.id
avira-antivir-premium.soft32.es avira-antivir-premium.soft32.es
bacaterus.com bacaterus.com
topfree.de topfree.de
tor-browser.soft32.com.br tor-browser.soft32.com.br
bebingtonhockeyclub.com bebingtonhockeyclub.com
tudonav.com tudonav.com
blockchainmedia.id blockchainmedia.id
vtworld.co vtworld.co
weatherbug.soft32.es weatherbug.soft32.es
brankaspedia.com brankaspedia.com
bronav.com bronav.com
windows-xp-service-pack-3.soft32.it windows-xp-service-pack-3.soft32.it
winzip.soft32.es winzip.soft32.es
wnewsj.com wnewsj.com
wowgame.jp wowgame.jp
wroxhamfc.club wroxhamfc.club
ccleaner.soft32.es ccleaner.soft32.es
zoxok.com zoxok.com
m.jawaracorpo.com m.jawaracorpo.com
claycrosstownfc.com claycrosstownfc.com
communitycommon.com communitycommon.com
corel-videostudio-pro.soft32.es corel-videostudio-pro.soft32.es
cpu-z.soft32.es cpu-z.soft32.es
cstore.mobi cstore.mobi
dailycall.com dailycall.com
deteksionline.com deteksionline.com
elib.vn elib.vn
fcnews.org fcnews.org
femaledaily.net femaledaily.net
fhm.co.id fhm.co.id
fraps.soft32.de fraps.soft32.de
friv-2020.com friv-2020.com
friv2020.us friv2020.us
futuristarchitecture.com futuristarchitecture.com
fynsy.com fynsy.com
gameee.ru gameee.ru
gamesclub.com gamesclub.com
gimp.soft32.it gimp.soft32.it
gioco.it gioco.it
gmo.jp gmo.jp
gom-player.soft32.com.br gom-player.soft32.com.br
hellokids.com hellokids.com
hhrfc.co.uk hhrfc.co.uk
hrajted.cz hrajted.cz
ibm-spss-statistics.soft32.it ibm-spss-statistics.soft32.it
ichannel.mobi ichannel.mobi
igreya.ru igreya.ru
internet-explorer-10.soft32.es internet-explorer-10.soft32.es
iplayer.com.ua iplayer.com.ua
jawaracorpo.com jawaracorpo.com
jeanettegy.com jeanettegy.com
jejakpiknik.com jejakpiknik.com
joacajocuri.ro joacajocuri.ro
jocuriaparate.com jocuriaparate.com
jocuridefotbal.com jocuridefotbal.com
jocurionline.ro jocurionline.ro
jogosbr.net jogosbr.net
jogosdeplantasvszumbis.co jogosdeplantasvszumbis.co
joomla.soft32.it joomla.soft32.it
juegosderalpheldemoledor.net juegosderalpheldemoledor.net
kakkun.jp kakkun.jp
keepo.me keepo.me
ketquasieutoc.com ketquasieutoc.com
kids-n-fun.co.uk kids-n-fun.co.uk
kids-n-fun.nl kids-n-fun.nl
lahathotline.com lahathotline.com
lampung.co lampung.co
lensajabar.com lensajabar.com
listph.com listph.com
lokerjakarta.id lokerjakarta.id
lowonganhoteljakarta.com lowonganhoteljakarta.com
magdalene.co magdalene.co
mahee.es mahee.es
mankiz.com mankiz.com
mediasulsel.com mediasulsel.com
mobitekno.com mobitekno.com
mosalsalat.online mosalsalat.online
moviestarplanet.ca moviestarplanet.ca
moviestarplanet.pl moviestarplanet.pl
mydailysentinel.com mydailysentinel.com
najjox.com najjox.com
nurfc.com nurfc.com
okaytab.com okaytab.com
onghutgao.net onghutgao.net
panduaji.net panduaji.net
penjaranews.com penjaranews.com
photoscape.soft32.it photoscape.soft32.it
pomu.at pomu.at
pomu.de pomu.de
pomu.vn pomu.vn
ponsy.net ponsy.net
portsmouth-dailytimes.com portsmouth-dailytimes.com
puzzleguys.com puzzleguys.com
pvpro.com pvpro.com
rcmmj.com rcmmj.com
reviews.femaledaily.com reviews.femaledaily.com
abouttng.com abouttng.com
adwickwarriorsjfc.co.uk adwickwarriorsjfc.co.uk
selular.id selular.id
sigap88.co sigap88.co
siwalimanews.com siwalimanews.com
skojspel.se skojspel.se
sneakers.co.id sneakers.co.id
sodereondemand.com sodereondemand.com
spielkarussell.de spielkarussell.de
avast-free-antivirus.soft32.com.br avast-free-antivirus.soft32.com.br
011546.com 011546.com
014250.com 014250.com
striker.id striker.id
sultrademo.co sultrademo.co
analisaaceh.com analisaaceh.com
asumsi.co asumsi.co
teamspeak.soft32.it teamspeak.soft32.it
autocarindonesia.com autocarindonesia.com
avira-free-antivirus.soft32.es avira-free-antivirus.soft32.es
ayahbunda.co.id ayahbunda.co.id
ayokuliah.id ayokuliah.id
badtameezdilweb.net badtameezdilweb.net
bananagiveaway.com bananagiveaway.com
tobasatu.com tobasatu.com
totanav.com totanav.com
bedworthrfc.co.uk bedworthrfc.co.uk
transportumum.com transportumum.com
belajarmtk.com belajarmtk.com
beritabitcoin.id beritabitcoin.id
bewarajabar.com bewarajabar.com
urbanasia.com urbanasia.com
bishopsstortfordcc.com bishopsstortfordcc.com
warda.com warda.com
btczone.xyz btczone.xyz
windows-live-messenger.soft32.com.br windows-live-messenger.soft32.com.br
windows-live-movie-maker.soft32.com.br windows-live-movie-maker.soft32.com.br
windows-xp-service-pack-3.soft32.es windows-xp-service-pack-3.soft32.es
bubugames.com bubugames.com
bukamatanews.id bukamatanews.id
wowgame.tv wowgame.tv
wuki.com wuki.com
wyspagier.pl wyspagier.pl
xem.vn xem.vn
xosodaiviet.net xosodaiviet.net
cdburnerxp.soft32.de cdburnerxp.soft32.de
zoo-tycoon.soft32.de zoo-tycoon.soft32.de
zoo-tycoon.soft32.es zoo-tycoon.soft32.es
cookly.mobi cookly.mobi
debut-pro-edition-for-mac.soft32.it debut-pro-edition-for-mac.soft32.it
delgazette.com delgazette.com
dimaspratama20.com dimaspratama20.com
eastlancsleague.com eastlancsleague.com
englewoodindependent.com englewoodindependent.com
facetofeet.com facetofeet.com
fog-game.ru fog-game.ru
free-studio.soft32.com.br free-studio.soft32.com.br
free-studio.soft32.es free-studio.soft32.es
friv.ro friv.ro
friv2020.com.br friv2020.com.br
gadjian.com gadjian.com
gaiviettraitay.com gaiviettraitay.com
galioninquirer.com galioninquirer.com
gamesya.com gamesya.com
gamex.co.in gamex.co.in
genpinews.com genpinews.com
ghozaliq.com ghozaliq.com
gimp.soft32.de gimp.soft32.de
giocare.it giocare.it
girlieplay.com girlieplay.com
gom-player.soft32.it gom-player.soft32.it
goodhousekeeping.co.id goodhousekeeping.co.id
googlechrome.soft32.es googlechrome.soft32.es
grabfreegame.com grabfreegame.com
hepy.at hepy.at
hepy.pl hepy.pl
hepy.ro hepy.ro
higo.id higo.id
hma-pro-vpn.soft32.de hma-pro-vpn.soft32.de
hoofa.net hoofa.net
horizon.soft32.es horizon.soft32.es
hryprebaby.sk hryprebaby.sk
icanplay.ru icanplay.ru
icarusfc.co.uk icarusfc.co.uk
icofx.soft32.es icofx.soft32.es
indonesiadesign.com indonesiadesign.com
inilahmuaraenim.co.id inilahmuaraenim.co.id
istat-pro.soft32.de istat-pro.soft32.de
itunes.soft32.es itunes.soft32.es
java-runtime-environment.soft32.es java-runtime-environment.soft32.es
jeux-jeu.fr jeux-jeu.fr
jocuri-fete.ro jocuri-fete.ro
jocurimasini.ro jocurimasini.ro
juegosjuegos.com juegosjuegos.com
juegossolitario.com juegossolitario.com
kepri.haluan.co kepri.haluan.co
kmplayer.soft32.es kmplayer.soft32.es
knobelspiele.com knobelspiele.com
kuliahkechina.com kuliahkechina.com
lokerbali.info lokerbali.info
lulaot.co.il lulaot.co.il
mackeeper.soft32.it mackeeper.soft32.it
mahirphotoshop.com mahirphotoshop.com
mahjonganime.com mahjonganime.com
mediakendari.com mediakendari.com
microsoft-3d-pinball-space-cadet.soft32.de microsoft-3d-pinball-space-cadet.soft32.de
microsoft-security-essentials.soft32.es microsoft-security-essentials.soft32.es
mommiesdaily.com mommiesdaily.com
moodspike.com moodspike.com
morrowcountysentinel.com morrowcountysentinel.com
moviestarplanet.co.uk moviestarplanet.co.uk
moviestarplanet.com moviestarplanet.com
moviestarplanet.dk moviestarplanet.dk
mydailytribune.com mydailytribune.com
mymacsense.com mymacsense.com
najox.com najox.com
nangunsatkerthilokabali.com nangunsatkerthilokabali.com
niaga.asia niaga.asia
okeyboz.com okeyboz.com
reviews.femaledaily.net reviews.femaledaily.net
outlook-express.soft32.es outlook-express.soft32.es
parenting.co.id parenting.co.id
pelitabanten.com pelitabanten.com
rimma.co rimma.co
pilarsumsel.com pilarsumsel.com
pomu.fr pomu.fr
pomu.nl pomu.nl
pomu.uk pomu.uk
powerpoint.soft32.de powerpoint.soft32.de
recordherald.com recordherald.com
safari.soft32.de safari.soft32.de
dotmsr.com dotmsr.com
saibumi.com saibumi.com
advanced-systemcare.soft32.es advanced-systemcare.soft32.es
aldridgerfc.co.uk aldridgerfc.co.uk
sidneydailynews.com sidneydailynews.com
ameks.id ameks.id
ammyy-admin.soft32.it ammyy-admin.soft32.it
skor.id skor.id
smartphoneku.com smartphoneku.com
solitaire.com solitaire.com
spiele-umsonst.de spiele-umsonst.de
spielpanda.de spielpanda.de
suarasurabaya.net suarasurabaya.net
swantonenterprise.com swantonenterprise.com
sxmb.vn sxmb.vn
tagar.id tagar.id
atmegame.com atmegame.com
technologytimes.pk technologytimes.pk
tek.id tek.id
auto-car.co.id auto-car.co.id
tetris.soft32.com.br tetris.soft32.com.br
theedgesingapore.com theedgesingapore.com
thuvienmienphi.com thuvienmienphi.com
timesindonesia.co.id timesindonesia.co.id
tokagames.com tokagames.com
traxmagz.com traxmagz.com
tuikhonmuondoi.com tuikhonmuondoi.com
turbo-c.soft32.com.br turbo-c.soft32.com.br
ugonki.ru ugonki.ru
urbanacitizen.com urbanacitizen.com
vandaliadrummernews.com vandaliadrummernews.com
bishopscanningsfc.com bishopscanningsfc.com
bisniswisata.co.id bisniswisata.co.id
blacknews.com blacknews.com
virtual-dj.soft32.com.br virtual-dj.soft32.com.br
vosjeux.fr vosjeux.fr
wartainspirasi.com wartainspirasi.com
breatheheavy.com breatheheavy.com
winrar.soft32.es winrar.soft32.es
bullzip-pdf-printer.soft32.es bullzip-pdf-printer.soft32.es
wowgirls.jp wowgirls.jp
burgtelegram.com burgtelegram.com
bzuu.com.br bzuu.com.br
yangcanggih.com yangcanggih.com
zonautara.com zonautara.com
cinemags.co.id cinemags.co.id
corel-paint-shop-pro.soft32.es corel-paint-shop-pro.soft32.es
counter-strike.soft32.com.br counter-strike.soft32.com.br
ctbet3.com ctbet3.com
cutezee.com cutezee.com
dailyadvocate.com dailyadvocate.com
disposisi.com disposisi.com
droitwichspaladiesfc.co.uk droitwichspaladiesfc.co.uk
dropbox.soft32.de dropbox.soft32.de
emahjong.ro emahjong.ro
escapeclub.jp escapeclub.jp
farfeshplus.com farfeshplus.com
fidonav.com fidonav.com
hepy.de hepy.de
hepy.dk hepy.dk
hepy.nl hepy.nl
foto.co.id foto.co.id
freevpn.us freevpn.us
fruity-loops.soft32.com.br fruity-loops.soft32.com.br
gaagjescraft.net gaagjescraft.net
gadgetren.com gadgetren.com
gamasexual.ru gamasexual.ru
gameesusgudd.fun gameesusgudd.fun
gameloft.com gameloft.com
gamezebo.com gamezebo.com
giochisolitario.it giochisolitario.it
gladespil.dk gladespil.dk
gurugeografi.id gurugeografi.id
hancinema.net hancinema.net
hargabulanini.com hargabulanini.com
hma-pro-vpn.soft32.it hma-pro-vpn.soft32.it
howieandbelle.com howieandbelle.com
hrypredivky.sk hrypredivky.sk
httptools.net httptools.net
humorwx.net humorwx.net
independensi.com independensi.com
infojepang.net infojepang.net
internet-download-manager.soft32.it internet-download-manager.soft32.it
internet-explorer-9.soft32.es internet-explorer-9.soft32.es
inwepo.co inwepo.co
jocuriminiclip.ro jocuriminiclip.ro
joio.com joio.com
juegosmahjong.com juegosmahjong.com
kabaroto.com kabaroto.com
karhoot.com karhoot.com
keluargasamawa.com keluargasamawa.com
kenali.co.id kenali.co.id
kids-n-fun.com kids-n-fun.com
kindle.soft32.es kindle.soft32.es
klikpositif.com klikpositif.com
koosaj.com koosaj.com
krjogja.com krjogja.com
kuatmlarat.com kuatmlarat.com
langcuoi.vn langcuoi.vn
langgam.id langgam.id
lensajakarta.com lensajakarta.com
lowonganhotelbali.com lowonganhotelbali.com
microsite.facetofeet.com microsite.facetofeet.com
moorsidecbc.org.uk moorsidecbc.org.uk
moviestarplanet.com.tr moviestarplanet.com.tr
mrthaya.com mrthaya.com
msn-messenger.soft32.es msn-messenger.soft32.es
mydailyregister.com mydailyregister.com
ngalam.co ngalam.co
nontunai.com nontunai.com
notepad.soft32.es notepad.soft32.es
nusupan.best nusupan.best
nyonyor.com nyonyor.com
obahsambat.com obahsambat.com
openoffice.soft32.de openoffice.soft32.de
oyundedem.com oyundedem.com
partition-magic.soft32.es partition-magic.soft32.es
pelatihan-prmn.com pelatihan-prmn.com
persepsi.co.id persepsi.co.id
phatgiao.org.vn phatgiao.org.vn
picasa.soft32.es picasa.soft32.es
plucki.com plucki.com
pomu.ie pomu.ie
pomu.pl pomu.pl
raidcall.soft32.it raidcall.soft32.it
redbourncc.com redbourncc.com
rekano.com rekano.com
rmolbanten.com rmolbanten.com
roda2blog.com roda2blog.com
sabervivirtv.com sabervivirtv.com
sahabatmaroko.com sahabatmaroko.com
saintif.com saintif.com
arcadehippo.com arcadehippo.com
seattlepi.com seattlepi.com
serikatnews.com serikatnews.com
akisitv.com akisitv.com
seruni.id seruni.id
alborsaanews.com alborsaanews.com
almashhad-alyemeni.com almashhad-alyemeni.com
sospergola.net sospergola.net
artjakarta.com artjakarta.com
10minutemail.net 10minutemail.net
suarapasundan.com suarapasundan.com
adobe-flash-player-non-ie.soft32.com.br adobe-flash-player-non-ie.soft32.com.br
tainhanh.vn tainhanh.vn
assawsana.com assawsana.com
techorz.com techorz.com
tekno.harianjogja.com tekno.harianjogja.com
teknojurnal.com teknojurnal.com
thehour.com thehour.com
babyhome.com.tw babyhome.com.tw
baducanu.eu baducanu.eu
thestandnews.com thestandnews.com
baotintuc.vn baotintuc.vn
todojuegosgratis.es todojuegosgratis.es
tor-browser.soft32.es tor-browser.soft32.es
bellator.com bellator.com
beritabeta.com beritabeta.com
beritafakta.id beritafakta.id
beritajawabarat.com beritajawabarat.com
beritarafflesia.com beritarafflesia.com
tuviphongthuy.net tuviphongthuy.net
tvland.com tvland.com
bibhp.com bibhp.com
ultimagz.com ultimagz.com
unica.ro unica.ro
bidiktangsel.com bidiktangsel.com
biga.com.tw biga.com.tw
bimmer.id bimmer.id
vedit.co.id vedit.co.id
blogo.id blogo.id
vinted.com vinted.com
vinted.es vinted.es
vinted.pl vinted.pl
webphimmoi.net webphimmoi.net
bravacasa.co.id bravacasa.co.id
brecorder.com brecorder.com
werewolf.com werewolf.com
widnescricketclub.com widnescricketclub.com
wizard101.com wizard101.com
wizard101.soft32.es wizard101.soft32.es
yombie.net yombie.net
yukepo.com yukepo.com
cbhounslowunitedfc.com cbhounslowunitedfc.com
gq.com.tw gq.com.tw
hd.vl.com.tw hd.vl.com.tw
christabelle.idv.tw christabelle.idv.tw
vn.running.biji.co vn.running.biji.co
m.fhm.co.id m.fhm.co.id
cjay.cc cjay.cc
cms.facetofeet.com cms.facetofeet.com
convertisseur-youtube.net convertisseur-youtube.net
crm.jtb.inginim.com crm.jtb.inginim.com
ctee.com.tw ctee.com.tw
cyborg-tl.snowbeartranslation.com cyborg-tl.snowbeartranslation.com
darientimes.com darientimes.com
deherba.com deherba.com
dengi.ua dengi.ua
deportes.canalrcn.com deportes.canalrcn.com
dropbox.soft32.es dropbox.soft32.es
dulohupa.id dulohupa.id
earth.com earth.com
edaweb.id edaweb.id
epaper.brecorder.com epaper.brecorder.com
eva.vn eva.vn
fajarbanten.beritaone.com fajarbanten.beritaone.com
fajarbanten.com fajarbanten.com
fanpiece.com fanpiece.com
fashionwaltzfw.com fashionwaltzfw.com
fixsnews.co.id fixsnews.co.id
foodievegans.com foodievegans.com
friv250.net friv250.net
ftv.com.tw ftv.com.tw
ftvnews.com.tw ftvnews.com.tw
game24s.com game24s.com
gamesoyo.com gamesoyo.com
garudapos.com garudapos.com
gds.ro gds.ro
harianjogja.com harianjogja.com
headcramp.com headcramp.com
inmywordz.com inmywordz.com
iradiofm.com iradiofm.com
iwastesomuchmoney.com iwastesomuchmoney.com
jeux-gratuits.com jeux-gratuits.com
jeux.org jeux.org
jogosgabi.com jogosgabi.com
juegosdegta5.com juegosdegta5.com
juegosdepou.co juegosdepou.co
juegosdesoyluna.com juegosdesoyluna.com
karawang.poskota.co.id karawang.poskota.co.id
katamutiara.org katamutiara.org
kepobio.com kepobio.com
kliksajariau.co kliksajariau.co
kolobok.ua kolobok.ua
labottegadeiservizi.com labottegadeiservizi.com
lensasriwijaya.lensajabar.com lensasriwijaya.lensajabar.com
libreoffice.soft32.es libreoffice.soft32.es
lokerku.net lokerku.net
macromedia-dreamweaver.soft32.com.br macromedia-dreamweaver.soft32.com.br
macromedia-dreamweaver.soft32.it macromedia-dreamweaver.soft32.it
matahidup.com matahidup.com
maxmanroe.com maxmanroe.com
medanbisnisdaily.com medanbisnisdaily.com
metro7.co.id metro7.co.id
meuspremiosnick.com.br meuspremiosnick.com.br
mirrormedia.mg mirrormedia.mg
moonsally.com moonsally.com
mport.ua mport.ua
mrjogos.net mrjogos.net
raketka.cz raketka.cz
mtv.pt mtv.pt
musictory.it musictory.it
news.harianjogja.com news.harianjogja.com
news.master.sabay.com.kh news.master.sabay.com.kh
newsnusantara.com newsnusantara.com
ohkopak.com ohkopak.com
ohman.vn ohman.vn
opini.harianjogja.com opini.harianjogja.com
otomotif.harianjogja.com otomotif.harianjogja.com
padang-today.com padang-today.com
padangkita.com padangkita.com
padangmedia.com padangmedia.com
paginainizio.com paginainizio.com
rcnnovelas.com rcnnovelas.com
penaku.id penaku.id
penguingames.info penguingames.info
petel.bg petel.bg
play123.in play123.in
pomu.co.it pomu.co.it
pomu.com.ar pomu.com.ar
pomu.com.co pomu.com.co
pomu.com.ec pomu.com.ec
pomu.gr pomu.gr
pomu.se pomu.se
prod-cdn.reviews.femaledaily.com prod-cdn.reviews.femaledaily.com
qgames.org qgames.org
registercitizen.com registercitizen.com
mimbarumum.co.id mimbarumum.co.id
rtl2.de rtl2.de
rundschau-online.de rundschau-online.de
adobe-flash-player-non-ie.soft32.es adobe-flash-player-non-ie.soft32.es
adventurebucko.com adventurebucko.com
sehajmal.com sehajmal.com
alhadthonline.com alhadthonline.com
sfgate.com sfgate.com
sheltonherald.com sheltonherald.com
aljaras.com aljaras.com
albumbaru.com albumbaru.com
sidikpost.com sidikpost.com
sijoritoday.com sijoritoday.com
readingonthefarm.com readingonthefarm.com
smak.ua smak.ua
sme.gig.hk sme.gig.hk
spiele123.com spiele123.com
sport.vl.com.tw sport.vl.com.tw
stamfordadvocate.com stamfordadvocate.com
1001giochi.it 1001giochi.it
1001spiele.at 1001spiele.at
stirescu.ro stirescu.ro
abingdonrufc.co.uk abingdonrufc.co.uk
success.gig.hk success.gig.hk
sultengterkini.com sultengterkini.com
sumselnet.com sumselnet.com
sushi.id sushi.id
altermedia.id altermedia.id
sweetrip.id sweetrip.id
taiwan17go.com taiwan17go.com
tangerangonline.id tangerangonline.id
auto-bild.ro auto-bild.ro
terasmaluku.com terasmaluku.com
tetris.soft32.it tetris.soft32.it
theridgefieldpress.com theridgefieldpress.com
thestorypedia.com thestorypedia.com
baladnaelyoum.com baladnaelyoum.com
baliandbeyond.co.id baliandbeyond.co.id
balifactualnews.com balifactualnews.com
tiebreakertimes.com.ph tiebreakertimes.com.ph
tmox.ml tmox.ml
tor.soft32.es tor.soft32.es
beaumontenterprise.com beaumontenterprise.com
triaspolitika.id triaspolitika.id
truckerscafefood4soul.org truckerscafefood4soul.org
berindonews.com berindonews.com
best-game.co best-game.co
bestkiwi.ru bestkiwi.ru
bestreviews.pk bestreviews.pk
betintl.co.uk betintl.co.uk
betshoof.com betshoof.com
bincangsyariah.com bincangsyariah.com
bisnis.com bisnis.com
vcreative.sg vcreative.sg
viablog.okmall.tw viablog.okmall.tw
vidcon.com vidcon.com
blog.higo.id blog.higo.id
blok-a.com blok-a.com
vinted.cz vinted.cz
visual-basic-express.soft32.it visual-basic-express.soft32.it
vozpopuli.com vozpopuli.com
wartasolo.com wartasolo.com
watan.com watan.com
wwwclicks.com wwwclicks.com
captionkata.com captionkata.com
ylpt838.net ylpt838.net
yombie.com yombie.com
youm7.com youm7.com
youngster.id youngster.id
cauthu.com.vn cauthu.com.vn
cerpenmu.com cerpenmu.com
zonakeren.com zonakeren.com
cherry123.com cherry123.com
gg.pl gg.pl
iq.com iq.com
me.phununet.com me.phununet.com
m.xoso.wap.vn m.xoso.wap.vn
cocux.com cocux.com
cokitos.com cokitos.com
coreldraw-graphics-suite.soft32.it coreldraw-graphics-suite.soft32.it
counter-strike.soft32.it counter-strike.soft32.it
creditwayup.com creditwayup.com
ctinsider.com ctinsider.com
cuerpomente.com cuerpomente.com
curation.lianhonghong.com curation.lianhonghong.com
daydayplay.hk daydayplay.hk
digination.id digination.id
easeus-partition-master-free-edition.soft32.it easeus-partition-master-free-edition.soft32.it
editorial.femaledaily.net editorial.femaledaily.net
eranews.co.id eranews.co.id
eraser.soft32.es eraser.soft32.es
estoybiendesalud.com estoybiendesalud.com
expressnews.com expressnews.com
feminis.ro feminis.ro
financiarul.ro financiarul.ro
fokustekno.com fokustekno.com
freekaamaal.com freekaamaal.com
galamedianews.com galamedianews.com
gamebase.com.tw gamebase.com.tw
gamez6.com gamez6.com
gizmologi.id gizmologi.id
global.teknologi.id global.teknologi.id
gom-player.soft32.es gom-player.soft32.es
ground-combat-technology.com ground-combat-technology.com
gsp.ro gsp.ro
habari.id habari.id
haluan.co haluan.co
health.gig.hk health.gig.hk
heronsyfc.co.uk heronsyfc.co.uk
heyquiz.com heyquiz.com
hiburan.harianjogja.com hiburan.harianjogja.com
igre123.net igre123.net
inilahkoran.com inilahkoran.com
iprofesional.com iprofesional.com
irunning.com.ua irunning.com.ua
islampos.com islampos.com
jadigamers.com jadigamers.com
jagossh.com jagossh.com
japan.vl.com.tw japan.vl.com.tw
jatim.poskota.co.id jatim.poskota.co.id
jogjapolitan.harianjogja.com jogjapolitan.harianjogja.com
jogosfriv2020.net jogosfriv2020.net
juegosdeloola.com juegosdeloola.com
juegosjuegos.com.co juegosjuegos.com.co
kiatfit.com kiatfit.com
konut.mediakendari.com konut.mediakendari.com
koooraarabia.com koooraarabia.com
kooralive.info kooralive.info
ksta.de ksta.de
ladies.gig.hk ladies.gig.hk
lampungjaya.news lampungjaya.news
lebahndut.net lebahndut.net
lensajatengnews.lensajabar.com lensajatengnews.lensajabar.com
libertatea.ro libertatea.ro
libertateapentrufemei.ro libertateapentrufemei.ro
lothiancoltsfc.co.uk lothiancoltsfc.co.uk
madriddiferente.com madriddiferente.com
manadobaswara.com manadobaswara.com
realplayer.soft32.es realplayer.soft32.es
realplayer.soft32.it realplayer.soft32.it
mediaterbittimornews.com mediaterbittimornews.com
metro.mediakendari.com metro.mediakendari.com
money.com.tw money.com.tw
moneydj.com moneydj.com
motherandbabyfair.com motherandbabyfair.com
mtv.be mtv.be
mtv.it mtv.it
mtv.nl mtv.nl
mysanantonio.com mysanantonio.com
news.sabay.com.kh news.sabay.com.kh
next-level-arcade.com next-level-arcade.com
niusnews.com niusnews.com
noisegarage.id noisegarage.id
ntdtv.com.tw ntdtv.com.tw
ntn24.com ntn24.com
ofdbr.femaledaily.net ofdbr.femaledaily.net
olx.com.sv olx.com.sv
opera-web-browser.soft32.es opera-web-browser.soft32.es
patrolipost.com patrolipost.com
pdf24-creator.soft32.de pdf24-creator.soft32.de
penangfoodie.com penangfoodie.com
pengabdianumy.harianjogja.com pengabdianumy.harianjogja.com
pmu-resultat.net pmu-resultat.net
pohadkyonline.eu pohadkyonline.eu
pomu.ch pomu.ch
pomu.com.br pomu.com.br
pomu.com.do pomu.com.do
pomu.com.py pomu.com.py
pomu.com.uy pomu.com.uy
pomu.jp pomu.jp
pomu.ro pomu.ro
pomu.ru pomu.ru
qqkelly.com qqkelly.com
raaga.com raaga.com
raidcall.soft32.es raidcall.soft32.es
randomsaladgames.com randomsaladgames.com
rba.es rba.es
arcadehole.com arcadehole.com
sahsoxid.info sahsoxid.info
aif.ua aif.ua
sekilasjabar.co sekilasjabar.co
servicepaymntinfrmtnvalidatecnfg97233.com servicepaymntinfrmtnvalidatecnfg97233.com
setanmerah.org setanmerah.org
shop.cosmopolitan.co.id shop.cosmopolitan.co.id
almaany.com almaany.com
amica.co.id amica.co.id
sipse.com sipse.com
ambonkita.com ambonkita.com
slideshare.vn slideshare.vn
animeshow.tv animeshow.tv
annybear.com annybear.com
ants.vn ants.vn
antsprogrammatic.com antsprogrammatic.com
sports.camerabay.tv sports.camerabay.tv
asiawiki.net asiawiki.net
staging.cosmogirl.co.id staging.cosmogirl.co.id
0223.com.ar 0223.com.ar
1001freefonts.com 1001freefonts.com
stebvv.com stebvv.com
analisadaily.com analisadaily.com
tailieuhoctap.com tailieuhoctap.com
tavesper.tech tavesper.tech
tetris.soft32.de tetris.soft32.de
themaclife.com themaclife.com
bali-travelnews.com bali-travelnews.com
baodautu.vn baodautu.vn
beritalima.com beritalima.com
beritasembilan.com beritasembilan.com
tucajogos.com.br tucajogos.com.br
uat.ayokuliah.id uat.ayokuliah.id
uphillrun.io uphillrun.io
usdgg.cn usdgg.cn
veganpunch.com veganpunch.com
vgorode.ua vgorode.ua
verywed.com verywed.com
vogue.com.tw vogue.com.tw
wiltonbulletin.com wiltonbulletin.com
canalrcn.com canalrcn.com
yoobgames.org yoobgames.org
cebu.hireme.ph cebu.hireme.ph
channelbali.com channelbali.com
chron.com chron.com
tv.mread.info tv.mread.info
ciudad.com.ar ciudad.com.ar
m.techorz.com m.techorz.com
cna.com.tw cna.com.tw
cokitos.net cokitos.net
cokitos.pt cokitos.pt
comdag.de comdag.de
cosmopolitanfm.com cosmopolitanfm.com
ctitv.com.tw ctitv.com.tw
dailycryptoblast.com dailycryptoblast.com
doanhnghiepvn.vn doanhnghiepvn.vn
duwitmu.com duwitmu.com
easeus-partition-master-home-edition.soft32.it easeus-partition-master-home-edition.soft32.it
ecapsgames.com ecapsgames.com
elbehiraanews.com elbehiraanews.com
eltrecetv.com.ar eltrecetv.com.ar
emdep.vn emdep.vn
eprice.com.tw eprice.com.tw
finansialku.com finansialku.com
foes.io foes.io
foodie.gig.hk foodie.gig.hk
football.ua football.ua
freeonlinegames.com freeonlinegames.com
frivyoob.com frivyoob.com
futurofinancial.xyz futurofinancial.xyz
gadu-gadu.pl gadu-gadu.pl
game2p.com game2p.com
gierkionline.pl gierkionline.pl
gingsul.com gingsul.com
giokando.net giokando.net
gogoblog.tw gogoblog.tw
google-earth.soft32.es google-earth.soft32.es
guidejeux.fr guidejeux.fr
health.tvbs.com.tw health.tvbs.com.tw
heha.gig.hk heha.gig.hk
hiking.biji.co hiking.biji.co
hireme.ph hireme.ph
histock.tw histock.tw
hkofficedaily.com hkofficedaily.com
houstonchronicle.com houstonchronicle.com
ibm-spss-statistics.soft32.com.br ibm-spss-statistics.soft32.com.br
igrulez.net igrulez.net
imcnews.id imcnews.id
indonesiadaily.co.id indonesiadaily.co.id
investigasinusantara.com investigasinusantara.com
istat-pro.soft32.com.br istat-pro.soft32.com.br
jaringinfo.com jaringinfo.com
jateng.poskota.co.id jateng.poskota.co.id
jogloabang.com jogloabang.com
jogosonlineapps.com.br jogosonlineapps.com.br
juantambayan.me juantambayan.me
juegos-de-dos-jugadores.com juegos-de-dos-jugadores.com
juegos-de-zombies.net juegos-de-zombies.net
juegosdedragonballsuper.com juegosdedragonballsuper.com
juegosdefortnite.net juegosdefortnite.net
juegosdeyanderesimulator.com juegosdeyanderesimulator.com
juegosfriv2019com.com juegosfriv2019com.com
kabarseleb.id kabarseleb.id
kawula.id kawula.id
ketbanlamquen.com ketbanlamquen.com
kingsoft-office-free.soft32.es kingsoft-office-free.soft32.es
kleiderkreisel.de kleiderkreisel.de
klikpapua.com klikpapua.com
kliksajamaluku.co kliksajamaluku.co
kopitekno.com kopitekno.com
korea-lover.com korea-lover.com
lapinou.com lapinou.com
lebanese-forces.com lebanese-forces.com
lecturas.com lecturas.com
leighgenesis.co.uk leighgenesis.co.uk
linetv.tw linetv.tw
livenews.vn livenews.vn
lmtonline.com lmtonline.com
lollipop168.com lollipop168.com
ludosmg.com ludosmg.com
mambee.com mambee.com
mdewiresmi.com mdewiresmi.com
mtv.co.za mtv.co.za
mtv.de mtv.de
mtvasia.com mtvasia.com
muffingraphics.com muffingraphics.com
muylinux.com muylinux.com
myfreegames.online myfreegames.online
myplainview.com myplainview.com
nawalakarsa.id nawalakarsa.id
ohayo.co.id ohayo.co.id
ohplaygames.com ohplaygames.com
otakuverse.id otakuverse.id
pcactual.com pcactual.com
phew.tw phew.tw
phimvn2.net phimvn2.net
playbaseballgames.org playbaseballgames.org
pomu.com.pa pomu.com.pa
pomu.com.pe pomu.com.pe
pomu.cr pomu.cr
pomu.pt pomu.pt
popmagz.com popmagz.com
poskota.co.id poskota.co.id
postku.web.id postku.web.id
presisinews.com presisinews.com
qooky.com qooky.com
rakyatpos.com rakyatpos.com
raovat.vietnamnet.vn raovat.vietnamnet.vn
ruangmuda.com ruangmuda.com
running.biji.co running.biji.co
sales-frontier.com sales-frontier.com
santuy.club santuy.club
sapagreen.com sapagreen.com
saungnews.co saungnews.co
sehatq.com sehatq.com
sepakbola.harianjogja.com sepakbola.harianjogja.com
aksalser.com aksalser.com
alwafd.news alwafd.news
shine.gig.hk shine.gig.hk
alinea.id alinea.id
aljaras.me aljaras.me
sogi.com.tw sogi.com.tw
anclacormlad.ml anclacormlad.ml
sourcesindonesia.com sourcesindonesia.com
sphax-purebdcraft-craft.soft32.es sphax-purebdcraft-craft.soft32.es
spielen.de spielen.de
1000heronline.cz 1000heronline.cz
101games.gr 101games.gr
101games.it 101games.it
101paixnidia.gr 101paixnidia.gr
aaj.tv aaj.tv
supertaste.tvbs.com.tw supertaste.tvbs.com.tw
sweepon.com sweepon.com
tecnofilos.es tecnofilos.es
teknologi.id teknologi.id
tendenciasdebelleza.com tendenciasdebelleza.com
tinmoi.vn tinmoi.vn
banten.poskota.co.id banten.poskota.co.id
bantenhits.com bantenhits.com
tochka.net tochka.net
beauty321.com beauty321.com
beckenhamwaterpolo.com beckenhamwaterpolo.com
trends.gig.hk trends.gig.hk
trurocityfc.net trurocityfc.net
beredukasi.com beredukasi.com
turbo-c.soft32.es turbo-c.soft32.es
beritamalut.co beritamalut.co
tvmania.ro tvmania.ro
twpkinfo.com twpkinfo.com
updater-new.soft32.com.br updater-new.soft32.com.br
bleepingcomputer.com bleepingcomputer.com
viddl.me viddl.me
vihrogon.bg vihrogon.bg
vinted.fr vinted.fr
vorzeit.mobi vorzeit.mobi
bolaskor.com bolaskor.com
waspada.id waspada.id
watanserb.com watanserb.com
bravaradio.com bravaradio.com
wiradesa.co wiradesa.co
yahoo-messenger.soft32.es yahoo-messenger.soft32.es
yapo.cl yapo.cl
yeutretho.vn yeutretho.vn
carisinyal.com carisinyal.com
yoob3.com yoob3.com
youngesteight.com youngesteight.com
yquetecuento.com yquetecuento.com
yucaipaapartments.com yucaipaapartments.com
yunoya.id yunoya.id
zamo.vn zamo.vn
zdarma-online-hry.eu zdarma-online-hry.eu
ceksite.id ceksite.id
centralbatam.co.id centralbatam.co.id
zoxygames.com zoxygames.com
chiblog.tw chiblog.tw
chocolive.ru chocolive.ru
chovui.com chovui.com
tv.ua tv.ua
cocopedia.id cocopedia.id
cofax.ru cofax.ru
comedycentralasia.com comedycentralasia.com
cryptoharian.com cryptoharian.com
cucinare.tv cucinare.tv
cycling.biji.co cycling.biji.co
cyparblog.com cyparblog.com
designlisticle.com designlisticle.com
directplus.fr directplus.fr
doisongphapluat.com doisongphapluat.com
drama.vl.com.tw drama.vl.com.tw
fitness.co.id fitness.co.id
egypttoday.com egypttoday.com
eljueves.es eljueves.es
elmueble.com elmueble.com
estampas.com estampas.com
fabiosa.com fabiosa.com
fajar.co.id fajar.co.id
fashionwaltz.com fashionwaltz.com
fashionwaltz.net fashionwaltz.net
foxit-pdf-reader.soft32.com.br foxit-pdf-reader.soft32.com.br
foxit-pdf-reader.soft32.it foxit-pdf-reader.soft32.it
franpolempi.ml franpolempi.ml
futureparenting.cwgv.com.tw futureparenting.cwgv.com.tw
gadis.co.id gadis.co.id
gamev6.com gamev6.com
gig.hk gig.hk
girlsocool.com girlsocool.com
globalisttravels.com globalisttravels.com
gogofirenze.it gogofirenze.it
gogoterme.com gogoterme.com
gotv.ctitv.com.tw gotv.ctitv.com.tw
gwan.tw gwan.tw
hairideas.co.id hairideas.co.id
healthforall.com.tw healthforall.com.tw
hellomagazine.co.id hellomagazine.co.id
hothk.com hothk.com
incub8pi.com incub8pi.com
infosurabaya.id infosurabaya.id
inilahnews.com inilahnews.com
inote.tw inote.tw
inponsel.com inponsel.com
isport.ua isport.ua
iwastesomuchtime.com iwastesomuchtime.com
jadwalbis.com jadwalbis.com
jeux123.fr jeux123.fr
jiemr.me jiemr.me
jogopop.com.br jogopop.com.br
jogos123.net jogos123.net
jogosfriv2019.com jogosfriv2019.com
jogosgratis.online jogosgratis.online
juegos123.net juegos123.net
juegosgabi.com juegosgabi.com
jydtlw.cn jydtlw.cn
kamini.id kamini.id
kanha.sabay.com.kh kanha.sabay.com.kh
keketravel.cc keketravel.cc
ketbanbonphuong.vn ketbanbonphuong.vn
ketbanlamquen.net ketbanlamquen.net
khotrithuc.org khotrithuc.org
kliksajajabar.co kliksajajabar.co
kliksajapapua.co kliksajapapua.co
lampuhijau.co.id lampuhijau.co.id
latinus.us latinus.us
league-funny.com league-funny.com
lensajakarta.lensajabar.com lensajakarta.lensajabar.com
lifestyle.harianjogja.com lifestyle.harianjogja.com
luyengame.com luyengame.com
marieclaire.com.tw marieclaire.com.tw
matchness.com matchness.com
maxtv.vl.com.tw maxtv.vl.com.tw
mcpharmaceuticals.com mcpharmaceuticals.com
mediaasuransinews.co.id mediaasuransinews.co.id
mohot.com mohot.com
mommiesdaily.net mommiesdaily.net
moviestarplanet.fr moviestarplanet.fr
moviexplorers.com moviexplorers.com
mtv.fr mtv.fr
musicmatch-jukebox.soft32.com.br musicmatch-jukebox.soft32.com.br
mygiftsfromabove.com mygiftsfromabove.com
mykiru.ph mykiru.ph
news.testing.sabay.com.kh news.testing.sabay.com.kh
nhregister.com nhregister.com
nuestrateleinternacional.com nuestrateleinternacional.com
nusadaily.com nusadaily.com
ogramy.pl ogramy.pl
olgclub.com olgclub.com
ontv.videoland.com.tw ontv.videoland.com.tw
ontv.vl.com.tw ontv.vl.com.tw
ospika.net ospika.net
oyundenizi.com oyundenizi.com
pesantrenluhur.or.id pesantrenluhur.or.id
playfootballgames.org playfootballgames.org
pomu.cl pomu.cl
pomu.co.ve pomu.co.ve
pomu.com.mx pomu.com.mx
pomu.cz pomu.cz
pomu.hu pomu.hu
pomu.sk pomu.sk
pramborsfm.com pramborsfm.com
reason.com reason.com
refaccionesperez.com refaccionesperez.com
resepbyta.com resepbyta.com
riau.haluan.co riau.haluan.co
MOTHERANDBABY.CO.ID
IP History

Click the IP addresses to see over domains using them.