Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

PHOTLO.COM

PHOTLO.COM
Shared Attributes
Domain
foodbevg.com foodbevg.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 233 days
PRIM PRIM-22430 May 2019 Mar 2020 316 days
LIJI LIJI-236947 May 2019 Mar 2020 316 days
MEME MEME-209 May 2019 Mar 2020 316 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 316 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 316 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
UDOG UDOG-1000 May 2019 Mar 2020 316 days
SMAD SMAD-3198 May 2019 Mar 2020 316 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 316 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 316 days
VIDA VIDA-5181618553 May 2019 Mar 2020 316 days
CONV CONV-40802 May 2019 Mar 2020 304 days
IEX IEX-184282 May 2019 Mar 2020 304 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 304 days
MEDI MEDI-8CUKXS6PK Jul 2019 Mar 2020 257 days
TEAD TEAD-16795 Aug 2019 Mar 2020 237 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
IMON IMON-2287 Aug 2019 Feb 2020 190 days
CTX CTX-562165 Jan 2020 Mar 2020 89 days
MEDI MEDI-8CU8J33QS Oct 2019 Dec 2019 64 days
DM DM-100541 Aug 2019 Oct 2019 41 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 20 days
taxyc.com taxyc.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 245 days
PRIM PRIM-22430 May 2019 Mar 2020 309 days
LIJI LIJI-236947 May 2019 Mar 2020 309 days
MEME MEME-209 May 2019 Mar 2020 309 days
CONV CONV-40802 May 2019 Mar 2020 309 days
IEX IEX-184282 May 2019 Mar 2020 309 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 309 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 309 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 309 days
UDOG UDOG-1000 May 2019 Mar 2020 309 days
SMAD SMAD-3198 May 2019 Mar 2020 309 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 309 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 309 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 309 days
VIDA VIDA-5181618553 May 2019 Mar 2020 309 days
SVRN SVRN-236947 May 2019 Jan 2020 220 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 220 days
AOL AOL-10513 Sep 2019 Mar 2020 209 days
MEDI MEDI-8CUKXS6PK Sep 2019 Mar 2020 209 days
TEAD TEAD-16795 Sep 2019 Mar 2020 209 days
IMON IMON-2287 Sep 2019 Feb 2020 174 days
CTX CTX-562165 Mar 2020 Mar 2020 29 days
OL OL-2859-424-10-6714 Jul 2018 Jul 2018 One Off
DM DM-100541 Sep 2019 Sep 2019 One Off
voofla.com voofla.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Aug 2018 Mar 2020 1 year, 215 days
PRIM PRIM-22430 May 2019 Mar 2020 306 days
LIJI LIJI-236947 May 2019 Mar 2020 306 days
MEME MEME-209 May 2019 Mar 2020 306 days
CONV CONV-40802 May 2019 Mar 2020 306 days
IEX IEX-184282 May 2019 Mar 2020 306 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 306 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 306 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 306 days
UDOG UDOG-1000 May 2019 Mar 2020 306 days
SMAD SMAD-3198 May 2019 Mar 2020 306 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 306 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 306 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 306 days
VIDA VIDA-5181618553 May 2019 Mar 2020 306 days
IMON IMON-2287 May 2019 Feb 2020 271 days
TEAD TEAD-16795 Jul 2019 Mar 2020 258 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
SVRN SVRN-236947 May 2019 Jan 2020 217 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 217 days
MEDI MEDI-8CUKXS6PK Sep 2019 Mar 2020 204 days
CTX CTX-562165 Jan 2020 Mar 2020 74 days
OL OL-2859-424-10-6714 Aug 2018 Sep 2018 28 days
DM DM-100541 Aug 2019 Sep 2019 14 days
hwshopper.com hwshopper.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Aug 2018 Mar 2020 1 year, 215 days
PRIM PRIM-22430 Aug 2019 Mar 2020 224 days
LIJI LIJI-236947 Aug 2019 Mar 2020 224 days
MEME MEME-209 Aug 2019 Mar 2020 224 days
CONV CONV-40802 Aug 2019 Mar 2020 224 days
IEX IEX-184282 Aug 2019 Mar 2020 224 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Aug 2019 Mar 2020 224 days
YIMO YIMO-1823148729717916915 Aug 2019 Mar 2020 224 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Mar 2020 224 days
UDOG UDOG-1000 Aug 2019 Mar 2020 224 days
SMAD SMAD-3198 Aug 2019 Mar 2020 224 days
SHAR SHAR-AF3BDE15 Aug 2019 Mar 2020 224 days
LOCK LOCK-10852900247427328 Aug 2019 Mar 2020 224 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Aug 2019 Mar 2020 224 days
VIDA VIDA-5181618553 Aug 2019 Mar 2020 224 days
TEAD TEAD-16795 Aug 2019 Mar 2020 224 days
AOL AOL-10513 Aug 2019 Mar 2020 209 days
IMON IMON-2287 Oct 2019 Dec 2019 65 days
SVRN SVRN-236947 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUKXS6PK Aug 2019 Oct 2019 61 days
DM DM-100541 Aug 2019 Oct 2019 46 days
OL OL-2859-424-10-6714 Aug 2018 Sep 2018 26 days
MEDI MEDI-8CU8J33QS Dec 2019 Jan 2020 18 days
CTX CTX-562165 Mar 2020 Mar 2020 One Off
cleanyx.com cleanyx.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Aug 2018 Mar 2020 1 year, 221 days
PRIM PRIM-22430 May 2019 Mar 2020 299 days
LIJI LIJI-236947 May 2019 Mar 2020 299 days
MEME MEME-209 May 2019 Mar 2020 299 days
CONV CONV-40802 May 2019 Mar 2020 299 days
IEX IEX-184282 May 2019 Mar 2020 299 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 299 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 299 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 299 days
UDOG UDOG-1000 May 2019 Mar 2020 299 days
SMAD SMAD-3198 May 2019 Mar 2020 299 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 299 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 299 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 299 days
VIDA VIDA-5181618553 May 2019 Mar 2020 299 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 227 days
TEAD TEAD-16795 Jul 2019 Mar 2020 227 days
MEDI MEDI-8CUKXS6PK Jul 2019 Feb 2020 214 days
SVRN SVRN-236947 Jun 2019 Jan 2020 204 days
AOL AOL-10513 Aug 2019 Mar 2020 201 days
IMON IMON-2287 May 2019 Sep 2019 130 days
OL OL-2859-424-10-6714 Aug 2018 Sep 2018 32 days
CTX CTX-562165 Mar 2020 Mar 2020 One Off
zupermar.com zupermar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 245 days
PRIM PRIM-22430 Jul 2019 Mar 2020 255 days
LIJI LIJI-236947 Jul 2019 Mar 2020 255 days
MEME MEME-209 Jul 2019 Mar 2020 255 days
CONV CONV-40802 Jul 2019 Mar 2020 255 days
IEX IEX-184282 Jul 2019 Mar 2020 255 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jul 2019 Mar 2020 255 days
YIMO YIMO-1823148729717916915 Jul 2019 Mar 2020 255 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 255 days
UDOG UDOG-1000 Jul 2019 Mar 2020 255 days
SMAD SMAD-3198 Jul 2019 Mar 2020 255 days
SHAR SHAR-AF3BDE15 Jul 2019 Mar 2020 255 days
LOCK LOCK-10852900247427328 Jul 2019 Mar 2020 255 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Mar 2020 255 days
VIDA VIDA-5181618553 Jul 2019 Mar 2020 255 days
TEAD TEAD-16795 Jul 2019 Mar 2020 255 days
IMON IMON-2287 Jul 2019 Feb 2020 220 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
MEDI MEDI-8CU8J33QS Jul 2019 Jan 2020 166 days
MEDI MEDI-8CUKXS6PK Nov 2019 Mar 2020 110 days
CTX CTX-562165 Jan 2020 Mar 2020 69 days
OL OL-2859-424-10-6714 Jul 2018 Sep 2018 58 days
gleauty.com gleauty.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 234 days
PRIM PRIM-22430 May 2019 Mar 2020 305 days
LIJI LIJI-236947 May 2019 Mar 2020 305 days
MEME MEME-209 May 2019 Mar 2020 305 days
CONV CONV-40802 May 2019 Mar 2020 305 days
IEX IEX-184282 May 2019 Mar 2020 305 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 305 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 305 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 305 days
UDOG UDOG-1000 May 2019 Mar 2020 305 days
SMAD SMAD-3198 May 2019 Mar 2020 305 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 305 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 305 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 305 days
VIDA VIDA-5181618553 May 2019 Mar 2020 305 days
IMON IMON-2287 May 2019 Feb 2020 281 days
TEAD TEAD-16795 Jul 2019 Mar 2020 258 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 227 days
AOL AOL-10513 Aug 2019 Mar 2020 207 days
MEDI MEDI-8CUKXS6PK Aug 2019 Feb 2020 189 days
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
CTX CTX-562165 Jan 2020 Mar 2020 78 days
OL OL-2859-424-10-6714 Jul 2018 Sep 2018 46 days
glusiness.com glusiness.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 234 days
PRIM PRIM-22430 May 2019 Mar 2020 305 days
LIJI LIJI-236947 May 2019 Mar 2020 305 days
MEME MEME-209 May 2019 Mar 2020 305 days
CONV CONV-40802 May 2019 Mar 2020 305 days
IEX IEX-184282 May 2019 Mar 2020 305 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 305 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 305 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 305 days
UDOG UDOG-1000 May 2019 Mar 2020 305 days
SMAD SMAD-3198 May 2019 Mar 2020 305 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 305 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 305 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 305 days
VIDA VIDA-5181618553 May 2019 Mar 2020 305 days
IMON IMON-2287 May 2019 Feb 2020 270 days
MEDI MEDI-8CUKXS6PK Jul 2019 Mar 2020 258 days
TEAD TEAD-16795 Jul 2019 Mar 2020 258 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 227 days
AOL AOL-10513 Aug 2019 Mar 2020 207 days
SVRN SVRN-236947 Jun 2019 Jan 2020 196 days
OL OL-2859-424-10-6714 Jul 2018 Sep 2018 46 days
CTX CTX-562165 Jan 2020 Feb 2020 43 days
govserv.org govserv.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 234 days
PRIM PRIM-22430 May 2019 Mar 2020 305 days
LIJI LIJI-236947 May 2019 Mar 2020 305 days
MEME MEME-209 May 2019 Mar 2020 305 days
CONV CONV-40802 May 2019 Mar 2020 305 days
IEX IEX-184282 May 2019 Mar 2020 305 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 305 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 305 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 305 days
UDOG UDOG-1000 May 2019 Mar 2020 305 days
SMAD SMAD-3198 May 2019 Mar 2020 305 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 305 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 305 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 305 days
VIDA VIDA-5181618553 May 2019 Mar 2020 305 days
TEAD TEAD-16795 Jul 2019 Mar 2020 258 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 227 days
AOL AOL-10513 Aug 2019 Mar 2020 207 days
IMON IMON-2287 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUKXS6PK Aug 2019 Feb 2020 189 days
SVRN SVRN-236947 May 2019 Aug 2019 81 days
CTX CTX-562165 Jan 2020 Feb 2020 43 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 20 days
localgymsandfitness.com localgymsandfitness.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Feb 2020 1 year, 205 days
PRIM PRIM-22430 Aug 2019 Mar 2020 226 days
MEME MEME-209 Aug 2019 Mar 2020 226 days
IEX IEX-184282 Aug 2019 Mar 2020 226 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Aug 2019 Mar 2020 226 days
YIMO YIMO-1823148729717916915 Aug 2019 Mar 2020 226 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Mar 2020 226 days
UDOG UDOG-1000 Aug 2019 Mar 2020 226 days
SHAR SHAR-AF3BDE15 Aug 2019 Mar 2020 226 days
LOCK LOCK-10852900247427328 Aug 2019 Mar 2020 226 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Aug 2019 Mar 2020 226 days
VIDA VIDA-5181618553 Aug 2019 Mar 2020 226 days
TEAD TEAD-16795 Aug 2019 Mar 2020 226 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
IMON IMON-2287 Aug 2019 Feb 2020 191 days
LIJI LIJI-236947 Aug 2019 Feb 2020 186 days
CONV CONV-40802 Aug 2019 Feb 2020 186 days
SMAD SMAD-3198 Aug 2019 Feb 2020 186 days
OL OL-2859-424-10-6714 Jul 2018 Sep 2018 52 days
CTX CTX-562165 Jan 2020 Feb 2020 49 days
MEDI MEDI-8CU8J33QS Dec 2019 Jan 2020 10 days
MEDI MEDI-8CUKXS6PK Aug 2019 Aug 2019 One Off
globalnpo.org globalnpo.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Aug 2018 Oct 2019 1 year, 63 days
OL OL-2859-424-10-6714 Aug 2018 Aug 2018 1 day
AOL AOL-10513 Oct 2019 Oct 2019 One Off
DM DM-100541 Oct 2019 Oct 2019 One Off
PRIM PRIM-22430 Oct 2019 Oct 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
IMON IMON-2287 Oct 2019 Oct 2019 One Off
MEME MEME-209 Oct 2019 Oct 2019 One Off
CONV CONV-40802 Oct 2019 Oct 2019 One Off
IEX IEX-184282 Oct 2019 Oct 2019 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Oct 2019 Oct 2019 One Off
YIMO YIMO-1823148729717916915 Oct 2019 Oct 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Oct 2019 One Off
UDOG UDOG-1000 Oct 2019 Oct 2019 One Off
SMAD SMAD-3198 Oct 2019 Oct 2019 One Off
SHAR SHAR-AF3BDE15 Oct 2019 Oct 2019 One Off
LOCK LOCK-10852900247427328 Oct 2019 Oct 2019 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Oct 2019 Oct 2019 One Off
VIDA VIDA-5181618553 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUKXS6PK Oct 2019 Oct 2019 One Off
TEAD TEAD-16795 Oct 2019 Oct 2019 One Off
accoua.com accoua.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Aug 2018 Mar 2020 1 year, 233 days
LIJI LIJI-236947 May 2019 Mar 2020 316 days
IEX IEX-184282 May 2019 Mar 2020 316 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 316 days
VIDA VIDA-5181618553 May 2019 Mar 2020 316 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 316 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 316 days
PRIM PRIM-22430 May 2019 Mar 2020 316 days
MEME MEME-209 May 2019 Mar 2020 316 days
SMAD SMAD-3198 May 2019 Mar 2020 316 days
CONV CONV-40802 May 2019 Mar 2020 316 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 316 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 316 days
UDOG UDOG-1000 May 2019 Mar 2020 316 days
IMON IMON-2287 May 2019 Feb 2020 281 days
TEAD TEAD-16795 Jul 2019 Mar 2020 252 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
MEDI MEDI-8CU8J33QS May 2019 Jul 2019 64 days
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUKXS6PK Mar 2020 Mar 2020 22 days
OL OL-2859-424-10-6714 Aug 2018 Sep 2018 21 days
bakerias.com bakerias.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Sep 2018 Mar 2020 1 year, 209 days
PRIM PRIM-22430 May 2019 Mar 2020 316 days
LIJI LIJI-236947 May 2019 Mar 2020 316 days
MEME MEME-209 May 2019 Mar 2020 316 days
CONV CONV-40802 May 2019 Mar 2020 316 days
IEX IEX-184282 May 2019 Mar 2020 316 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 316 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 316 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
UDOG UDOG-1000 May 2019 Mar 2020 316 days
SMAD SMAD-3198 May 2019 Mar 2020 316 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 316 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 316 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 316 days
VIDA VIDA-5181618553 May 2019 Mar 2020 316 days
TEAD TEAD-16795 Jul 2019 Mar 2020 248 days
MEDI MEDI-8CUKXS6PK Jul 2019 Mar 2020 229 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 227 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
IMON IMON-2287 Sep 2019 Feb 2020 156 days
OL OL-2859-424-10-6714 Sep 2018 Sep 2018 22 days
yasteq.com yasteq.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 245 days
PRIM PRIM-22430 Jun 2019 Mar 2020 304 days
LIJI LIJI-236947 Jun 2019 Mar 2020 304 days
MEME MEME-209 Jun 2019 Mar 2020 304 days
CONV CONV-40802 Jun 2019 Mar 2020 304 days
IEX IEX-184282 Jun 2019 Mar 2020 304 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Mar 2020 304 days
YIMO YIMO-1823148729717916915 Jun 2019 Mar 2020 304 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 304 days
UDOG UDOG-1000 Jun 2019 Mar 2020 304 days
SMAD SMAD-3198 Jun 2019 Mar 2020 304 days
SHAR SHAR-AF3BDE15 Jun 2019 Mar 2020 304 days
LOCK LOCK-10852900247427328 Jun 2019 Mar 2020 304 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 304 days
VIDA VIDA-5181618553 Jun 2019 Mar 2020 304 days
IMON IMON-2287 Jun 2019 Feb 2020 269 days
TEAD TEAD-16795 Jul 2019 Mar 2020 256 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
SVRN SVRN-236947 Jun 2019 Jan 2020 215 days
MEDI MEDI-8CU8J33QS Jun 2019 Jan 2020 215 days
CTX CTX-562165 Jan 2020 Mar 2020 46 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 7 days
foodyas.com foodyas.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 233 days
AOL AOL-10513 Dec 2019 Mar 2020 101 days
PRIM PRIM-22430 Dec 2019 Mar 2020 101 days
LIJI LIJI-236947 Dec 2019 Mar 2020 101 days
MEME MEME-209 Dec 2019 Mar 2020 101 days
CONV CONV-40802 Dec 2019 Mar 2020 101 days
IEX IEX-184282 Dec 2019 Mar 2020 101 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Dec 2019 Mar 2020 101 days
YIMO YIMO-1823148729717916915 Dec 2019 Mar 2020 101 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Dec 2019 Mar 2020 101 days
UDOG UDOG-1000 Dec 2019 Mar 2020 101 days
SMAD SMAD-3198 Dec 2019 Mar 2020 101 days
SHAR SHAR-AF3BDE15 Dec 2019 Mar 2020 101 days
LOCK LOCK-10852900247427328 Dec 2019 Mar 2020 101 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Dec 2019 Mar 2020 101 days
VIDA VIDA-5181618553 Dec 2019 Mar 2020 101 days
TEAD TEAD-16795 Dec 2019 Mar 2020 101 days
IMON IMON-2287 Dec 2019 Feb 2020 78 days
CTX CTX-562165 Jan 2020 Feb 2020 42 days
MEDI MEDI-8CU8J33QS Dec 2019 Jan 2020 24 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 20 days
MEDI MEDI-8CUKXS6PK Feb 2020 Feb 2020 One Off
glecruit.com glecruit.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Feb 2019 Mar 2020 1 year, 40 days
PRIM PRIM-22430 May 2019 Mar 2020 305 days
LIJI LIJI-236947 May 2019 Mar 2020 305 days
MEME MEME-209 May 2019 Mar 2020 305 days
CONV CONV-40802 May 2019 Mar 2020 305 days
IEX IEX-184282 May 2019 Mar 2020 305 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 305 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 305 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 305 days
UDOG UDOG-1000 May 2019 Mar 2020 305 days
SMAD SMAD-3198 May 2019 Mar 2020 305 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 305 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 305 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 305 days
VIDA VIDA-5181618553 May 2019 Mar 2020 305 days
TEAD TEAD-16795 Jul 2019 Mar 2020 258 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 227 days
AOL AOL-10513 Aug 2019 Mar 2020 207 days
IMON IMON-2287 Aug 2019 Feb 2020 200 days
SVRN SVRN-236947 Jun 2019 Jan 2020 196 days
MEDI MEDI-8CUKXS6PK Oct 2019 Mar 2020 164 days
CTX CTX-562165 Jan 2020 Feb 2020 43 days
globuya.com globuya.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 234 days
PRIM PRIM-22430 Aug 2019 Mar 2020 224 days
LIJI LIJI-236947 Aug 2019 Mar 2020 224 days
MEME MEME-209 Aug 2019 Mar 2020 224 days
CONV CONV-40802 Aug 2019 Mar 2020 224 days
IEX IEX-184282 Aug 2019 Mar 2020 224 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Aug 2019 Mar 2020 224 days
YIMO YIMO-1823148729717916915 Aug 2019 Mar 2020 224 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Mar 2020 224 days
UDOG UDOG-1000 Aug 2019 Mar 2020 224 days
SMAD SMAD-3198 Aug 2019 Mar 2020 224 days
SHAR SHAR-AF3BDE15 Aug 2019 Mar 2020 224 days
LOCK LOCK-10852900247427328 Aug 2019 Mar 2020 224 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Aug 2019 Mar 2020 224 days
VIDA VIDA-5181618553 Aug 2019 Mar 2020 224 days
TEAD TEAD-16795 Aug 2019 Mar 2020 224 days
AOL AOL-10513 Aug 2019 Mar 2020 207 days
MEDI MEDI-8CUKXS6PK Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU8J33QS Dec 2019 Jan 2020 22 days
OL OL-2859-424-10-6714 Jul 2018 Jul 2018 One Off
IMON IMON-2287 Feb 2020 Feb 2020 One Off
CTX CTX-562165 Feb 2020 Feb 2020 One Off
juridipedia.com juridipedia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 238 days
AOL AOL-10513 Oct 2019 Mar 2020 161 days
PRIM PRIM-22430 Oct 2019 Mar 2020 161 days
LIJI LIJI-236947 Oct 2019 Mar 2020 161 days
MEME MEME-209 Oct 2019 Mar 2020 161 days
CONV CONV-40802 Oct 2019 Mar 2020 161 days
IEX IEX-184282 Oct 2019 Mar 2020 161 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Oct 2019 Mar 2020 161 days
YIMO YIMO-1823148729717916915 Oct 2019 Mar 2020 161 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Mar 2020 161 days
UDOG UDOG-1000 Oct 2019 Mar 2020 161 days
SMAD SMAD-3198 Oct 2019 Mar 2020 161 days
SHAR SHAR-AF3BDE15 Oct 2019 Mar 2020 161 days
LOCK LOCK-10852900247427328 Oct 2019 Mar 2020 161 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Oct 2019 Mar 2020 161 days
VIDA VIDA-5181618553 Oct 2019 Mar 2020 161 days
MEDI MEDI-8CUKXS6PK Oct 2019 Mar 2020 161 days
TEAD TEAD-16795 Oct 2019 Mar 2020 161 days
IMON IMON-2287 Oct 2019 Feb 2020 133 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 9 days
DM DM-100541 Oct 2019 Oct 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
medioq.com medioq.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 241 days
PRIM PRIM-22430 May 2019 Mar 2020 316 days
LIJI LIJI-236947 May 2019 Mar 2020 316 days
MEME MEME-209 May 2019 Mar 2020 316 days
IEX IEX-184282 May 2019 Mar 2020 316 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 316 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 316 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
UDOG UDOG-1000 May 2019 Mar 2020 316 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 316 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 316 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 316 days
VIDA VIDA-5181618553 May 2019 Mar 2020 316 days
CONV CONV-40802 May 2019 Mar 2020 312 days
SMAD SMAD-3198 May 2019 Mar 2020 312 days
IMON IMON-2287 May 2019 Feb 2020 277 days
TEAD TEAD-16795 Jul 2019 Mar 2020 269 days
MEDI MEDI-8CUKXS6PK Jul 2019 Mar 2020 265 days
MEDI MEDI-8CU8J33QS May 2019 Jan 2020 227 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
OL OL-2859-424-10-6714 Jul 2018 Sep 2018 54 days
gemlis.com gemlis.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Oct 2019 Feb 2020 130 days
AOL AOL-10513 Oct 2019 Feb 2020 130 days
TEAD TEAD-16795 Oct 2019 Feb 2020 130 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Oct 2019 Feb 2020 130 days
PRIM PRIM-22430 Oct 2019 Feb 2020 130 days
LIJI LIJI-236947 Oct 2019 Feb 2020 130 days
IMON IMON-2287 Oct 2019 Feb 2020 130 days
MEME MEME-209 Oct 2019 Feb 2020 130 days
CONV CONV-40802 Oct 2019 Feb 2020 130 days
IEX IEX-184282 Oct 2019 Feb 2020 130 days
YIMO YIMO-1823148729717916915 Oct 2019 Feb 2020 130 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Feb 2020 130 days
UDOG UDOG-1000 Oct 2019 Feb 2020 130 days
SMAD SMAD-3198 Oct 2019 Feb 2020 130 days
SHAR SHAR-AF3BDE15 Oct 2019 Feb 2020 130 days
LOCK LOCK-10852900247427328 Oct 2019 Feb 2020 130 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Oct 2019 Feb 2020 130 days
VIDA VIDA-5181618553 Oct 2019 Feb 2020 130 days
MEDI MEDI-8CU8J33QS Oct 2019 Jan 2020 87 days
MEDI MEDI-8CUKXS6PK Dec 2019 Dec 2019 One Off
CTX CTX-562165 Feb 2020 Feb 2020 One Off
glclubs.com glclubs.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 May 2019 Mar 2020 333 days
PRIM PRIM-22430 May 2019 Mar 2020 316 days
LIJI LIJI-236947 May 2019 Mar 2020 316 days
MEME MEME-209 May 2019 Mar 2020 316 days
CONV CONV-40802 May 2019 Mar 2020 316 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 316 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 316 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
UDOG UDOG-1000 May 2019 Mar 2020 316 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 316 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 316 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 316 days
VIDA VIDA-5181618553 May 2019 Mar 2020 316 days
IEX IEX-184282 May 2019 Mar 2020 305 days
SMAD SMAD-3198 May 2019 Mar 2020 305 days
TEAD TEAD-16795 Jul 2019 Mar 2020 269 days
MEDI MEDI-8CUKXS6PK Jul 2019 Mar 2020 258 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
SVRN SVRN-236947 Aug 2019 Jan 2020 146 days
IMON IMON-2287 Oct 2019 Feb 2020 140 days
CTX CTX-562165 Jan 2020 Feb 2020 43 days
ile-wiesz.pl ile-wiesz.pl
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Feb 2020 239 days
LIJI LIJI-236947 Jun 2019 Feb 2020 239 days
IMON IMON-2287 Jun 2019 Feb 2020 239 days
MEME MEME-209 Jun 2019 Feb 2020 239 days
CONV CONV-40802 Jun 2019 Feb 2020 239 days
IEX IEX-184282 Jun 2019 Feb 2020 239 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Feb 2020 239 days
YIMO YIMO-1823148729717916915 Jun 2019 Feb 2020 239 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Feb 2020 239 days
UDOG UDOG-1000 Jun 2019 Feb 2020 239 days
SMAD SMAD-3198 Jun 2019 Feb 2020 239 days
SHAR SHAR-AF3BDE15 Jun 2019 Feb 2020 239 days
LOCK LOCK-10852900247427328 Jun 2019 Feb 2020 239 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Feb 2020 239 days
VIDA VIDA-5181618553 Jun 2019 Feb 2020 239 days
TEAD TEAD-16795 Jul 2019 Feb 2020 226 days
SVRN SVRN-236947 Jun 2019 Jan 2020 193 days
MEDI MEDI-8CU8J33QS Jun 2019 Jan 2020 193 days
AOL AOL-10513 Aug 2019 Feb 2020 175 days
DM DM-100541 Aug 2019 Oct 2019 63 days
tudosobretdah.com.br tudosobretdah.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Sep 2019 Mar 2020 207 days
PRIM PRIM-22430 Sep 2019 Mar 2020 207 days
LIJI LIJI-236947 Sep 2019 Mar 2020 207 days
MEME MEME-209 Sep 2019 Mar 2020 207 days
CONV CONV-40802 Sep 2019 Mar 2020 207 days
IEX IEX-184282 Sep 2019 Mar 2020 207 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Sep 2019 Mar 2020 207 days
YIMO YIMO-1823148729717916915 Sep 2019 Mar 2020 207 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 207 days
UDOG UDOG-1000 Sep 2019 Mar 2020 207 days
SMAD SMAD-3198 Sep 2019 Mar 2020 207 days
SHAR SHAR-AF3BDE15 Sep 2019 Mar 2020 207 days
LOCK LOCK-10852900247427328 Sep 2019 Mar 2020 207 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 207 days
VIDA VIDA-5181618553 Sep 2019 Mar 2020 207 days
TEAD TEAD-16795 Sep 2019 Mar 2020 207 days
SVRN SVRN-236947 Sep 2019 Jan 2020 118 days
MEDI MEDI-8CU8J33QS Sep 2019 Jan 2020 118 days
IMON IMON-2287 Nov 2019 Feb 2020 107 days
DM DM-100541 Sep 2019 Oct 2019 52 days
glunis.com glunis.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Aug 2019 1 year, 10 days
PRIM PRIM-22430 May 2019 Aug 2019 81 days
SVRN SVRN-236947 May 2019 Aug 2019 81 days
LIJI LIJI-236947 May 2019 Aug 2019 81 days
IMON IMON-2287 May 2019 Aug 2019 81 days
MEME MEME-209 May 2019 Aug 2019 81 days
CONV CONV-40802 May 2019 Aug 2019 81 days
IEX IEX-184282 May 2019 Aug 2019 81 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Aug 2019 81 days
YIMO YIMO-1823148729717916915 May 2019 Aug 2019 81 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Aug 2019 81 days
UDOG UDOG-1000 May 2019 Aug 2019 81 days
SMAD SMAD-3198 May 2019 Aug 2019 81 days
SHAR SHAR-AF3BDE15 May 2019 Aug 2019 81 days
LOCK LOCK-10852900247427328 May 2019 Aug 2019 81 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Aug 2019 81 days
VIDA VIDA-5181618553 May 2019 Aug 2019 81 days
MEDI MEDI-8CU8J33QS May 2019 Aug 2019 81 days
TEAD TEAD-16795 Jul 2019 Aug 2019 34 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 7 days
gluseum.com gluseum.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Oct 2019 Dec 2019 64 days
AOL AOL-10513 Oct 2019 Dec 2019 64 days
PRIM PRIM-22430 Oct 2019 Dec 2019 64 days
LIJI LIJI-236947 Oct 2019 Dec 2019 64 days
MEME MEME-209 Oct 2019 Dec 2019 64 days
CONV CONV-40802 Oct 2019 Dec 2019 64 days
IEX IEX-184282 Oct 2019 Dec 2019 64 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Oct 2019 Dec 2019 64 days
YIMO YIMO-1823148729717916915 Oct 2019 Dec 2019 64 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Dec 2019 64 days
UDOG UDOG-1000 Oct 2019 Dec 2019 64 days
SMAD SMAD-3198 Oct 2019 Dec 2019 64 days
SHAR SHAR-AF3BDE15 Oct 2019 Dec 2019 64 days
LOCK LOCK-10852900247427328 Oct 2019 Dec 2019 64 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Oct 2019 Dec 2019 64 days
VIDA VIDA-5181618553 Oct 2019 Dec 2019 64 days
MEDI MEDI-8CU8J33QS Oct 2019 Dec 2019 64 days
TEAD TEAD-16795 Oct 2019 Dec 2019 64 days
DM DM-100541 Oct 2019 Oct 2019 One Off
SVRN SVRN-236947 Dec 2019 Dec 2019 One Off
lexulous.com lexulous.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Nov 2019 121 days
LIJI LIJI-236947 Jul 2019 Nov 2019 121 days
IEX IEX-184282 Jul 2019 Nov 2019 121 days
PRIM PRIM-22430 Jul 2019 Nov 2019 121 days
MEDI MEDI-8CU8J33QS Jul 2019 Nov 2019 121 days
TEAD TEAD-16795 Jul 2019 Nov 2019 121 days
YIMO YIMO-1823148729717916915 Jul 2019 Nov 2019 121 days
CONV CONV-40802 Jul 2019 Nov 2019 121 days
IMON IMON-2287 Jul 2019 Nov 2019 121 days
MEME MEME-209 Jul 2019 Nov 2019 121 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jul 2019 Nov 2019 121 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Nov 2019 121 days
UDOG UDOG-1000 Jul 2019 Nov 2019 121 days
SHAR SHAR-AF3BDE15 Jul 2019 Nov 2019 121 days
LOCK LOCK-10852900247427328 Jul 2019 Nov 2019 121 days
VIDA VIDA-5181618553 Jul 2019 Nov 2019 121 days
AOL AOL-10513 Aug 2019 Nov 2019 84 days
DM DM-100541 Aug 2019 Oct 2019 63 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Jul 2019 One Off
masoncontractors.org masoncontractors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU8J33QS Jun 2019 Sep 2019 103 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Sep 2019 103 days
IEX IEX-184282 Jun 2019 Sep 2019 103 days
PRIM PRIM-22430 Jun 2019 Sep 2019 103 days
SVRN SVRN-236947 Jun 2019 Sep 2019 103 days
LIJI LIJI-236947 Jun 2019 Sep 2019 103 days
MEME MEME-209 Jun 2019 Sep 2019 103 days
IMON IMON-2287 Jun 2019 Sep 2019 103 days
CONV CONV-40802 Jun 2019 Sep 2019 103 days
YIMO YIMO-1823148729717916915 Jun 2019 Sep 2019 103 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Sep 2019 103 days
UDOG UDOG-1000 Jun 2019 Sep 2019 103 days
SMAD SMAD-3198 Jun 2019 Sep 2019 103 days
LOCK LOCK-10852900247427328 Jun 2019 Sep 2019 103 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Sep 2019 103 days
VIDA VIDA-5181618553 Jun 2019 Sep 2019 103 days
AOL AOL-10513 Sep 2019 Sep 2019 One Off
TEAD TEAD-16795 Sep 2019 Sep 2019 One Off
DM DM-100541 Sep 2019 Sep 2019 One Off
updato.com updato.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Sep 2019 Mar 2020 206 days
PRIM PRIM-22430 Sep 2019 Mar 2020 206 days
MEME MEME-209 Sep 2019 Mar 2020 206 days
CONV CONV-40802 Sep 2019 Mar 2020 206 days
IEX IEX-184282 Sep 2019 Mar 2020 206 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Sep 2019 Mar 2020 206 days
YIMO YIMO-1823148729717916915 Sep 2019 Mar 2020 206 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 206 days
UDOG UDOG-1000 Sep 2019 Mar 2020 206 days
SHAR SHAR-AF3BDE15 Sep 2019 Mar 2020 206 days
LOCK LOCK-10852900247427328 Sep 2019 Mar 2020 206 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 206 days
VIDA VIDA-5181618553 Sep 2019 Mar 2020 206 days
TEAD TEAD-16795 Sep 2019 Mar 2020 206 days
IMON IMON-2287 Sep 2019 Feb 2020 171 days
MEDI MEDI-8CU8J33QS Sep 2019 Jan 2020 117 days
DM DM-100541 Sep 2019 Oct 2019 51 days
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
anagrammer.com anagrammer.com
Attribute Value First Detected Last Detected Overlap Duration
UDOG UDOG-1000 Jun 2019 Mar 2020 303 days
CONV CONV-40802 Jun 2019 Mar 2020 303 days
IEX IEX-184282 Jun 2019 Mar 2020 303 days
YIMO YIMO-1823148729717916915 Jun 2019 Mar 2020 303 days
PRIM PRIM-22430 Jun 2019 Mar 2020 303 days
LOCK LOCK-10852900247427328 Jun 2019 Mar 2020 303 days
MEME MEME-209 Jun 2019 Mar 2020 303 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Mar 2020 303 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
SMAD SMAD-3198 Jun 2019 Mar 2020 303 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 303 days
VIDA VIDA-5181618553 Jun 2019 Mar 2020 303 days
IMON IMON-2287 Jun 2019 Feb 2020 268 days
TEAD TEAD-16795 Jul 2019 Mar 2020 255 days
LIJI LIJI-236947 Jun 2019 Jan 2020 234 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
MEDI MEDI-8CU8J33QS Jun 2019 Jan 2020 214 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
DM DM-100541 Aug 2019 Oct 2019 63 days
wtffunfact.com wtffunfact.com
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Mar 2020 255 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jul 2019 Mar 2020 255 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
IEX IEX-184282 Jul 2019 Sep 2019 56 days
SVRN SVRN-236947 Jul 2019 Sep 2019 56 days
LIJI LIJI-236947 Jul 2019 Sep 2019 56 days
MEDI MEDI-8CU8J33QS Jul 2019 Sep 2019 56 days
TEAD TEAD-16795 Jul 2019 Sep 2019 56 days
CONV CONV-40802 Jul 2019 Sep 2019 56 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Sep 2019 56 days
IMON IMON-2287 Jul 2019 Sep 2019 56 days
LOCK LOCK-10852900247427328 Jul 2019 Sep 2019 56 days
SHAR SHAR-AF3BDE15 Jul 2019 Sep 2019 56 days
PRIM PRIM-22430 Jul 2019 Sep 2019 56 days
YIMO YIMO-1823148729717916915 Jul 2019 Sep 2019 56 days
MEME MEME-209 Jul 2019 Sep 2019 56 days
UDOG UDOG-1000 Jul 2019 Sep 2019 56 days
VIDA VIDA-5181618553 Jul 2019 Sep 2019 56 days
DM DM-100541 Aug 2019 Sep 2019 19 days
cleantechnica.com cleantechnica.com
Attribute Value First Detected Last Detected Overlap Duration
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jul 2019 Mar 2020 255 days
LOCK LOCK-10852900247427328 Jul 2019 Mar 2020 255 days
VIDA VIDA-5181618553 Jul 2019 Mar 2020 255 days
SMAD SMAD-3198 Jul 2019 Mar 2020 255 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 255 days
PRIM PRIM-22430 Jul 2019 Mar 2020 255 days
MEME MEME-209 Jul 2019 Mar 2020 255 days
UDOG UDOG-1000 Jul 2019 Mar 2020 255 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Mar 2020 255 days
IEX IEX-184282 Jul 2019 Mar 2020 231 days
LIJI LIJI-236947 Jul 2019 Mar 2020 231 days
IMON IMON-2287 Jul 2019 Feb 2020 220 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
AOL AOL-10513 Nov 2019 Mar 2020 134 days
CONV CONV-40802 Nov 2019 Mar 2020 134 days
TEAD TEAD-16795 Nov 2019 Mar 2020 110 days
DM DM-100541 Aug 2019 Oct 2019 63 days
YIMO YIMO-1823148729717916915 Jan 2020 Mar 2020 45 days
dicascaseiras.net dicascaseiras.net
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Dec 2019 Mar 2020 104 days
AOL AOL-10513 Dec 2019 Mar 2020 104 days
LIJI LIJI-236947 Dec 2019 Mar 2020 104 days
MEME MEME-209 Dec 2019 Mar 2020 104 days
CONV CONV-40802 Dec 2019 Mar 2020 104 days
IEX IEX-184282 Dec 2019 Mar 2020 104 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Dec 2019 Mar 2020 104 days
YIMO YIMO-1823148729717916915 Dec 2019 Mar 2020 104 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Dec 2019 Mar 2020 104 days
UDOG UDOG-1000 Dec 2019 Mar 2020 104 days
SHAR SHAR-AF3BDE15 Dec 2019 Mar 2020 104 days
LOCK LOCK-10852900247427328 Dec 2019 Mar 2020 104 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Dec 2019 Mar 2020 104 days
VIDA VIDA-5181618553 Dec 2019 Mar 2020 104 days
TEAD TEAD-16795 Dec 2019 Mar 2020 104 days
SVRN SVRN-236947 Dec 2019 Jan 2020 30 days
MEDI MEDI-8CU8J33QS Dec 2019 Jan 2020 30 days
IMON IMON-2287 Dec 2019 Dec 2019 One Off
fishlore.com fishlore.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jul 2019 Mar 2020 255 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jul 2019 Mar 2020 255 days
YIMO YIMO-1823148729717916915 Jul 2019 Mar 2020 255 days
PRIM PRIM-22430 Jul 2019 Mar 2020 255 days
MEME MEME-209 Jul 2019 Mar 2020 255 days
UDOG UDOG-1000 Jul 2019 Mar 2020 255 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 255 days
SMAD SMAD-3198 Jul 2019 Mar 2020 255 days
LOCK LOCK-10852900247427328 Jul 2019 Mar 2020 255 days
VIDA VIDA-5181618553 Jul 2019 Mar 2020 255 days
TEAD TEAD-16795 Jul 2019 Mar 2020 231 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Mar 2020 231 days
IMON IMON-2287 Jul 2019 Feb 2020 220 days
LIJI LIJI-236947 Sep 2019 Mar 2020 199 days
CONV CONV-40802 Sep 2019 Mar 2020 175 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
MEDI MEDI-8CU8J33QS Sep 2019 Jan 2020 110 days
DM DM-100541 Aug 2019 Oct 2019 63 days
cedec.com.br cedec.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Mar 2020 105 days
PRIM PRIM-22430 Nov 2019 Mar 2020 105 days
LIJI LIJI-236947 Nov 2019 Mar 2020 105 days
MEME MEME-209 Nov 2019 Mar 2020 105 days
CONV CONV-40802 Nov 2019 Mar 2020 105 days
IEX IEX-184282 Nov 2019 Mar 2020 105 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Nov 2019 Mar 2020 105 days
YIMO YIMO-1823148729717916915 Nov 2019 Mar 2020 105 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 105 days
UDOG UDOG-1000 Nov 2019 Mar 2020 105 days
SHAR SHAR-AF3BDE15 Nov 2019 Mar 2020 105 days
LOCK LOCK-10852900247427328 Nov 2019 Mar 2020 105 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Mar 2020 105 days
VIDA VIDA-5181618553 Nov 2019 Mar 2020 105 days
TEAD TEAD-16795 Nov 2019 Mar 2020 105 days
SVRN SVRN-236947 Nov 2019 Jan 2020 33 days
MEDI MEDI-8CU8J33QS Nov 2019 Jan 2020 33 days
IMON IMON-2287 Feb 2020 Feb 2020 21 days
ecycle.com.br ecycle.com.br
Attribute Value First Detected Last Detected Overlap Duration
TEAD TEAD-16795 Oct 2019 Oct 2019 One Off
IEX IEX-184282 Oct 2019 Oct 2019 One Off
AOL AOL-10513 Oct 2019 Oct 2019 One Off
PRIM PRIM-22430 Oct 2019 Oct 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
MEME MEME-209 Oct 2019 Oct 2019 One Off
IMON IMON-2287 Oct 2019 Oct 2019 One Off
CONV CONV-40802 Oct 2019 Oct 2019 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Oct 2019 Oct 2019 One Off
YIMO YIMO-1823148729717916915 Oct 2019 Oct 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Oct 2019 One Off
UDOG UDOG-1000 Oct 2019 Oct 2019 One Off
SMAD SMAD-3198 Oct 2019 Oct 2019 One Off
LOCK LOCK-10852900247427328 Oct 2019 Oct 2019 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Oct 2019 Oct 2019 One Off
VIDA VIDA-5181618553 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU8J33QS Oct 2019 Oct 2019 One Off
epic7x.com epic7x.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Mar 2020 289 days
LIJI LIJI-236947 Jun 2019 Mar 2020 289 days
MEME MEME-209 Jun 2019 Mar 2020 289 days
CONV CONV-40802 Jun 2019 Mar 2020 289 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Mar 2020 289 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 289 days
LOCK LOCK-10852900247427328 Jun 2019 Mar 2020 289 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 289 days
VIDA VIDA-5181618553 Jun 2019 Mar 2020 289 days
SHAR SHAR-AF3BDE15 Jun 2019 Feb 2020 240 days
TEAD TEAD-16795 Aug 2019 Mar 2020 239 days
IEX IEX-184282 Aug 2019 Mar 2020 226 days
AOL AOL-10513 Aug 2019 Mar 2020 205 days
MEDI MEDI-8CU8J33QS Jun 2019 Jan 2020 200 days
IMON IMON-2287 Oct 2019 Feb 2020 131 days
SVRN SVRN-236947 Jun 2019 Oct 2019 109 days
DM DM-100541 Aug 2019 Oct 2019 63 days
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 13 days
hipercurioso.co hipercurioso.co
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Oct 2019 Mar 2020 163 days
IEX IEX-184282 Oct 2019 Mar 2020 163 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Oct 2019 Mar 2020 163 days
MEDI MEDI-8CU8J33QS Oct 2019 Jan 2020 84 days
PRIM PRIM-22430 Oct 2019 Dec 2019 64 days
SVRN SVRN-236947 Oct 2019 Dec 2019 64 days
LIJI LIJI-236947 Oct 2019 Dec 2019 64 days
IMON IMON-2287 Oct 2019 Dec 2019 64 days
MEME MEME-209 Oct 2019 Dec 2019 64 days
CONV CONV-40802 Oct 2019 Dec 2019 64 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Oct 2019 Dec 2019 64 days
YIMO YIMO-1823148729717916915 Oct 2019 Dec 2019 64 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Dec 2019 64 days
UDOG UDOG-1000 Oct 2019 Dec 2019 64 days
SHAR SHAR-AF3BDE15 Oct 2019 Dec 2019 64 days
LOCK LOCK-10852900247427328 Oct 2019 Dec 2019 64 days
VIDA VIDA-5181618553 Oct 2019 Dec 2019 64 days
TEAD TEAD-16795 Oct 2019 Dec 2019 64 days
bramj4u.com bramj4u.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Feb 2020 66 days
TEAD TEAD-16795 Nov 2019 Feb 2020 66 days
IEX IEX-184282 Nov 2019 Feb 2020 66 days
PRIM PRIM-22430 Nov 2019 Feb 2020 66 days
LIJI LIJI-236947 Nov 2019 Feb 2020 66 days
MEME MEME-209 Nov 2019 Feb 2020 66 days
CONV CONV-40802 Nov 2019 Feb 2020 66 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Nov 2019 Feb 2020 66 days
YIMO YIMO-1823148729717916915 Nov 2019 Feb 2020 66 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Feb 2020 66 days
UDOG UDOG-1000 Nov 2019 Feb 2020 66 days
SHAR SHAR-AF3BDE15 Nov 2019 Feb 2020 66 days
LOCK LOCK-10852900247427328 Nov 2019 Feb 2020 66 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Feb 2020 66 days
VIDA VIDA-5181618553 Nov 2019 Feb 2020 66 days
SVRN SVRN-236947 Nov 2019 Jan 2020 35 days
MEDI MEDI-8CU8J33QS Nov 2019 Jan 2020 35 days
IMON IMON-2287 Nov 2019 Nov 2019 One Off
live-tennis.eu live-tennis.eu
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Mar 2020 271 days
MEME MEME-209 Jun 2019 Mar 2020 271 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Mar 2020 271 days
YIMO YIMO-1823148729717916915 Jun 2019 Mar 2020 271 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 271 days
UDOG UDOG-1000 Jun 2019 Mar 2020 271 days
SMAD SMAD-3198 Jun 2019 Mar 2020 271 days
LOCK LOCK-10852900247427328 Jun 2019 Mar 2020 271 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 271 days
VIDA VIDA-5181618553 Jun 2019 Mar 2020 271 days
TEAD TEAD-16795 Jul 2019 Mar 2020 264 days
IMON IMON-2287 Jun 2019 Feb 2020 241 days
LIJI LIJI-236947 Jun 2019 Feb 2020 236 days
AOL AOL-10513 Aug 2019 Mar 2020 213 days
CONV CONV-40802 Aug 2019 Feb 2020 186 days
MEDI MEDI-8CU8J33QS Oct 2019 Jan 2020 75 days
DM DM-100541 Aug 2019 Oct 2019 63 days
IEX IEX-184282 Feb 2020 Mar 2020 35 days
babynames.co.uk babynames.co.uk
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Mar 2020 279 days
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
MEME MEME-209 Jun 2019 Mar 2020 279 days
IEX IEX-184282 Jun 2019 Mar 2020 279 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Mar 2020 279 days
YIMO YIMO-1823148729717916915 Jun 2019 Mar 2020 279 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 279 days
UDOG UDOG-1000 Jun 2019 Mar 2020 279 days
SMAD SMAD-3198 Jun 2019 Mar 2020 279 days
LOCK LOCK-10852900247427328 Jun 2019 Mar 2020 279 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 279 days
VIDA VIDA-5181618553 Jun 2019 Mar 2020 279 days
IMON IMON-2287 Jun 2019 Feb 2020 268 days
TEAD TEAD-16795 Jul 2019 Mar 2020 230 days
MEDI MEDI-8CU8J33QS Jun 2019 Jan 2020 214 days
CONV CONV-40802 Jun 2019 Nov 2019 169 days
SVRN SVRN-236947 Jun 2019 Sep 2019 104 days
DM DM-100541 Aug 2019 Sep 2019 19 days
findany.biz findany.biz
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Feb 2020 Mar 2020 35 days
PRIM PRIM-22430 Feb 2020 Mar 2020 35 days
LIJI LIJI-236947 Feb 2020 Mar 2020 35 days
MEME MEME-209 Feb 2020 Mar 2020 35 days
CONV CONV-40802 Feb 2020 Mar 2020 35 days
IEX IEX-184282 Feb 2020 Mar 2020 35 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 35 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 35 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
UDOG UDOG-1000 Feb 2020 Mar 2020 35 days
SMAD SMAD-3198 Feb 2020 Mar 2020 35 days
SHAR SHAR-AF3BDE15 Feb 2020 Mar 2020 35 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 35 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 35 days
VIDA VIDA-5181618553 Feb 2020 Mar 2020 35 days
TEAD TEAD-16795 Feb 2020 Mar 2020 35 days
CTX CTX-562165 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUKXS6PK Mar 2020 Mar 2020 One Off
pay-box.in pay-box.in
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Aug 2019 Mar 2020 218 days
PRIM PRIM-22430 Aug 2019 Mar 2020 218 days
LOCK LOCK-10852900247427328 Aug 2019 Mar 2020 218 days
CONV CONV-40802 Aug 2019 Jan 2020 128 days
SVRN SVRN-236947 Aug 2019 Jan 2020 128 days
LIJI LIJI-236947 Aug 2019 Jan 2020 128 days
IMON IMON-2287 Aug 2019 Jan 2020 128 days
MEME MEME-209 Aug 2019 Jan 2020 128 days
IEX IEX-184282 Aug 2019 Jan 2020 128 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Aug 2019 Jan 2020 128 days
YIMO YIMO-1823148729717916915 Aug 2019 Jan 2020 128 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Jan 2020 128 days
UDOG UDOG-1000 Aug 2019 Jan 2020 128 days
SHAR SHAR-AF3BDE15 Aug 2019 Jan 2020 128 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Aug 2019 Jan 2020 128 days
TEAD TEAD-16795 Aug 2019 Jan 2020 128 days
MEDI MEDI-8CU8J33QS Jan 2020 Jan 2020 1 day
skyscraperpage.com skyscraperpage.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Sep 2019 104 days
LIJI LIJI-236947 Jun 2019 Sep 2019 104 days
MEME MEME-209 Jun 2019 Sep 2019 104 days
IMON IMON-2287 Jun 2019 Sep 2019 104 days
CONV CONV-40802 Jun 2019 Sep 2019 104 days
IEX IEX-184282 Jun 2019 Sep 2019 104 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Sep 2019 104 days
YIMO YIMO-1823148729717916915 Jun 2019 Sep 2019 104 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Sep 2019 104 days
UDOG UDOG-1000 Jun 2019 Sep 2019 104 days
SMAD SMAD-3198 Jun 2019 Sep 2019 104 days
LOCK LOCK-10852900247427328 Jun 2019 Sep 2019 104 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Sep 2019 104 days
VIDA VIDA-5181618553 Jun 2019 Sep 2019 104 days
MEDI MEDI-8CU8J33QS Jun 2019 Sep 2019 104 days
TEAD TEAD-16795 Jul 2019 Sep 2019 56 days
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
dicio.com.br dicio.com.br
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 May 2019 Mar 2020 301 days
CONV CONV-40802 May 2019 Mar 2020 301 days
LOCK LOCK-10852900247427328 Aug 2019 Mar 2020 227 days
MEME MEME-209 Aug 2019 Mar 2020 227 days
YIMO YIMO-1823148729717916915 Aug 2019 Mar 2020 227 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Mar 2020 227 days
UDOG UDOG-1000 Aug 2019 Mar 2020 227 days
SHAR SHAR-AF3BDE15 Aug 2019 Mar 2020 227 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Aug 2019 Mar 2020 227 days
VIDA VIDA-5181618553 Aug 2019 Mar 2020 227 days
AOL AOL-10513 Aug 2019 Mar 2020 203 days
TEAD TEAD-16795 Aug 2019 Feb 2020 190 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Aug 2019 Feb 2020 190 days
MEDI MEDI-8CU8J33QS Sep 2019 Jan 2020 94 days
SVRN SVRN-236947 Aug 2019 Sep 2019 59 days
IMON IMON-2287 Aug 2019 Sep 2019 59 days
LIJI LIJI-236947 Feb 2020 Mar 2020 37 days
licoesdefe.com.br licoesdefe.com.br
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 Feb 2020 Mar 2020 40 days
IEX IEX-184282 Feb 2020 Mar 2020 40 days
AOL AOL-10513 Feb 2020 Mar 2020 40 days
PRIM PRIM-22430 Feb 2020 Mar 2020 40 days
LIJI LIJI-236947 Feb 2020 Mar 2020 40 days
MEME MEME-209 Feb 2020 Mar 2020 40 days
CONV CONV-40802 Feb 2020 Mar 2020 40 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 40 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 40 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 40 days
UDOG UDOG-1000 Feb 2020 Mar 2020 40 days
SHAR SHAR-AF3BDE15 Feb 2020 Mar 2020 40 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 40 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 40 days
VIDA VIDA-5181618553 Feb 2020 Mar 2020 40 days
TEAD TEAD-16795 Feb 2020 Mar 2020 40 days
IMON IMON-2287 Feb 2020 Feb 2020 5 days
unum.com.br unum.com.br
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Nov 2019 Mar 2020 141 days
LIJI LIJI-236947 Nov 2019 Mar 2020 141 days
MEME MEME-209 Nov 2019 Mar 2020 141 days
CONV CONV-40802 Nov 2019 Mar 2020 141 days
IEX IEX-184282 Nov 2019 Mar 2020 141 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Nov 2019 Mar 2020 141 days
YIMO YIMO-1823148729717916915 Nov 2019 Mar 2020 141 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 141 days
UDOG UDOG-1000 Nov 2019 Mar 2020 141 days
SHAR SHAR-AF3BDE15 Nov 2019 Mar 2020 141 days
LOCK LOCK-10852900247427328 Nov 2019 Mar 2020 141 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Mar 2020 141 days
VIDA VIDA-5181618553 Nov 2019 Mar 2020 141 days
TEAD TEAD-16795 Nov 2019 Mar 2020 141 days
AOL AOL-10513 Nov 2019 Jan 2020 65 days
SVRN SVRN-236947 Nov 2019 Jan 2020 52 days
MEDI MEDI-8CU8J33QS Nov 2019 Jan 2020 52 days
vagasucesso.com vagasucesso.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Mar 2020 140 days
PRIM PRIM-22430 Nov 2019 Mar 2020 140 days
LIJI LIJI-236947 Nov 2019 Mar 2020 140 days
MEME MEME-209 Nov 2019 Mar 2020 140 days
CONV CONV-40802 Nov 2019 Mar 2020 140 days
IEX IEX-184282 Nov 2019 Mar 2020 140 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Nov 2019 Mar 2020 140 days
YIMO YIMO-1823148729717916915 Nov 2019 Mar 2020 140 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 140 days
UDOG UDOG-1000 Nov 2019 Mar 2020 140 days
SHAR SHAR-AF3BDE15 Nov 2019 Mar 2020 140 days
LOCK LOCK-10852900247427328 Nov 2019 Mar 2020 140 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Mar 2020 140 days
VIDA VIDA-5181618553 Nov 2019 Mar 2020 140 days
TEAD TEAD-16795 Nov 2019 Mar 2020 140 days
SVRN SVRN-236947 Nov 2019 Jan 2020 51 days
MEDI MEDI-8CU8J33QS Nov 2019 Jan 2020 51 days
ytdb.co ytdb.co
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
IMON IMON-2287 Jun 2019 Jun 2019 One Off
MEME MEME-209 Jun 2019 Jun 2019 One Off
CONV CONV-40802 Jun 2019 Jun 2019 One Off
IEX IEX-184282 Jun 2019 Jun 2019 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Jun 2019 One Off
YIMO YIMO-1823148729717916915 Jun 2019 Jun 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
UDOG UDOG-1000 Jun 2019 Jun 2019 One Off
SMAD SMAD-3198 Jun 2019 Jun 2019 One Off
SHAR SHAR-AF3BDE15 Jun 2019 Jun 2019 One Off
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Jun 2019 One Off
VIDA VIDA-5181618553 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CU8J33QS Jun 2019 Jun 2019 One Off
jogalo.com jogalo.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Aug 2019 Mar 2020 230 days
LIJI LIJI-236947 Aug 2019 Mar 2020 230 days
MEME MEME-209 Aug 2019 Mar 2020 230 days
CONV CONV-40802 Aug 2019 Mar 2020 230 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Aug 2019 Mar 2020 230 days
YIMO YIMO-1823148729717916915 Aug 2019 Mar 2020 230 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Mar 2020 230 days
UDOG UDOG-1000 Aug 2019 Mar 2020 230 days
SMAD SMAD-3198 Aug 2019 Mar 2020 230 days
LOCK LOCK-10852900247427328 Aug 2019 Mar 2020 230 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Aug 2019 Mar 2020 230 days
VIDA VIDA-5181618553 Aug 2019 Mar 2020 230 days
TEAD TEAD-16795 Aug 2019 Mar 2020 230 days
IMON IMON-2287 Aug 2019 Feb 2020 195 days
MEDI MEDI-8CU8J33QS Aug 2019 Jan 2020 141 days
IEX IEX-184282 Dec 2019 Mar 2020 104 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
this-quiz.com this-quiz.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 29 days
PRIM PRIM-22430 Mar 2020 Mar 2020 29 days
LIJI LIJI-236947 Mar 2020 Mar 2020 29 days
MEME MEME-209 Mar 2020 Mar 2020 29 days
CONV CONV-40802 Mar 2020 Mar 2020 29 days
IEX IEX-184282 Mar 2020 Mar 2020 29 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Mar 2020 Mar 2020 29 days
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 29 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 29 days
UDOG UDOG-1000 Mar 2020 Mar 2020 29 days
SMAD SMAD-3198 Mar 2020 Mar 2020 29 days
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 29 days
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 29 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 29 days
VIDA VIDA-5181618553 Mar 2020 Mar 2020 29 days
TEAD TEAD-16795 Mar 2020 Mar 2020 29 days
financiamentoecredito.com financiamentoecredito.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Feb 2020 Mar 2020 35 days
PRIM PRIM-22430 Feb 2020 Mar 2020 35 days
LIJI LIJI-236947 Feb 2020 Mar 2020 35 days
MEME MEME-209 Feb 2020 Mar 2020 35 days
CONV CONV-40802 Feb 2020 Mar 2020 35 days
IEX IEX-184282 Feb 2020 Mar 2020 35 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 35 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 35 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
UDOG UDOG-1000 Feb 2020 Mar 2020 35 days
SHAR SHAR-AF3BDE15 Feb 2020 Mar 2020 35 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 35 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 35 days
VIDA VIDA-5181618553 Feb 2020 Mar 2020 35 days
TEAD TEAD-16795 Feb 2020 Mar 2020 35 days
IMON IMON-2287 Feb 2020 Feb 2020 One Off
jamaicaobserver.com jamaicaobserver.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Mar 2020 279 days
IEX IEX-184282 Jun 2019 Mar 2020 279 days
MEME MEME-209 Jun 2019 Mar 2020 279 days
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jun 2019 Mar 2020 279 days
YIMO YIMO-1823148729717916915 Jun 2019 Mar 2020 279 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 279 days
UDOG UDOG-1000 Jun 2019 Mar 2020 279 days
SMAD SMAD-3198 Jun 2019 Mar 2020 279 days
LOCK LOCK-10852900247427328 Jun 2019 Mar 2020 279 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 279 days
VIDA VIDA-5181618553 Jun 2019 Mar 2020 279 days
IMON IMON-2287 Jun 2019 Feb 2020 268 days
CONV CONV-40802 Jul 2019 Mar 2020 231 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
DM DM-100541 Aug 2019 Oct 2019 63 days
jobsbotswana.info jobsbotswana.info
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Dec 2019 Mar 2020 97 days
MEME MEME-209 Dec 2019 Mar 2020 97 days
CONV CONV-40802 Dec 2019 Mar 2020 97 days
YIMO YIMO-1823148729717916915 Dec 2019 Mar 2020 97 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Dec 2019 Mar 2020 97 days
UDOG UDOG-1000 Dec 2019 Mar 2020 97 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Dec 2019 Mar 2020 97 days
SHAR SHAR-AF3BDE15 Dec 2019 Feb 2020 62 days
SVRN SVRN-236947 Dec 2019 Jan 2020 15 days
IMON IMON-2287 Feb 2020 Feb 2020 7 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
LIJI LIJI-236947 Dec 2019 Dec 2019 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Dec 2019 Dec 2019 One Off
LOCK LOCK-10852900247427328 Dec 2019 Dec 2019 One Off
VIDA VIDA-5181618553 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU8J33QS Dec 2019 Dec 2019 One Off
joinfo.ua joinfo.ua
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Oct 2019 Dec 2019 64 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Oct 2019 Dec 2019 64 days
PRIM PRIM-22430 Oct 2019 Dec 2019 64 days
MEME MEME-209 Oct 2019 Dec 2019 64 days
CONV CONV-40802 Oct 2019 Dec 2019 64 days
YIMO YIMO-1823148729717916915 Oct 2019 Dec 2019 64 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Dec 2019 64 days
UDOG UDOG-1000 Oct 2019 Dec 2019 64 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Oct 2019 Dec 2019 64 days
VIDA VIDA-5181618553 Oct 2019 Dec 2019 64 days
LOCK LOCK-10852900247427328 Oct 2019 Oct 2019 One Off
IMON IMON-2287 Oct 2019 Oct 2019 One Off
SHAR SHAR-AF3BDE15 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU8J33QS Oct 2019 Oct 2019 One Off
TEAD TEAD-16795 Oct 2019 Oct 2019 One Off
SVRN SVRN-236947 Dec 2019 Dec 2019 One Off
jrfinancas.com jrfinancas.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Feb 2020 Mar 2020 42 days
PRIM PRIM-22430 Feb 2020 Mar 2020 35 days
LIJI LIJI-236947 Feb 2020 Mar 2020 35 days
MEME MEME-209 Feb 2020 Mar 2020 35 days
CONV CONV-40802 Feb 2020 Mar 2020 35 days
IEX IEX-184282 Feb 2020 Mar 2020 35 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 35 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 35 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
UDOG UDOG-1000 Feb 2020 Mar 2020 35 days
SHAR SHAR-AF3BDE15 Feb 2020 Mar 2020 35 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 35 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 35 days
VIDA VIDA-5181618553 Feb 2020 Mar 2020 35 days
TEAD TEAD-16795 Feb 2020 Mar 2020 35 days
IMON IMON-2287 Feb 2020 Feb 2020 7 days
sizzlepixs.com sizzlepixs.com
Attribute Value First Detected Last Detected Overlap Duration
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 311 days
YIMO YIMO-1823148729717916915 May 2019 Mar 2020 311 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 311 days
LOCK LOCK-10852900247427328 May 2019 Mar 2020 311 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 311 days
SMAD SMAD-3198 May 2019 Feb 2020 280 days
IMON IMON-2287 May 2019 Feb 2020 276 days
TEAD TEAD-16795 Jul 2019 Feb 2020 233 days
VIDA VIDA-5181618553 May 2019 Nov 2019 163 days
PRIM PRIM-22430 May 2019 Sep 2019 99 days
LIJI LIJI-236947 May 2019 Sep 2019 99 days
MEME MEME-209 May 2019 Sep 2019 99 days
UDOG UDOG-1000 May 2019 Jul 2019 47 days
IEX IEX-184282 May 2019 May 2019 One Off
MEDI MEDI-8CU8J33QS Sep 2019 Sep 2019 One Off
CONV CONV-40802 Nov 2019 Nov 2019 One Off
financescredit.com financescredit.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Feb 2020 Mar 2020 35 days
PRIM PRIM-22430 Feb 2020 Mar 2020 35 days
LIJI LIJI-236947 Feb 2020 Mar 2020 35 days
MEME MEME-209 Feb 2020 Mar 2020 35 days
CONV CONV-40802 Feb 2020 Mar 2020 35 days
IEX IEX-184282 Feb 2020 Mar 2020 35 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 35 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 35 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
UDOG UDOG-1000 Feb 2020 Mar 2020 35 days
SHAR SHAR-AF3BDE15 Feb 2020 Mar 2020 35 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 35 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 35 days
VIDA VIDA-5181618553 Feb 2020 Mar 2020 35 days
TEAD TEAD-16795 Feb 2020 Mar 2020 35 days
IMON IMON-2287 Feb 2020 Feb 2020 One Off
mundokpmg.com.br mundokpmg.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
MEME MEME-209 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Mar 2020 Mar 2020 One Off
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
UDOG UDOG-1000 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
VIDA VIDA-5181618553 Mar 2020 Mar 2020 One Off
TEAD TEAD-16795 Mar 2020 Mar 2020 One Off
ourbitcoinnews.com ourbitcoinnews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Oct 2019 Mar 2020 156 days
LIJI LIJI-236947 Oct 2019 Mar 2020 156 days
MEME MEME-209 Oct 2019 Mar 2020 156 days
CONV CONV-40802 Oct 2019 Mar 2020 156 days
IEX IEX-184282 Oct 2019 Mar 2020 156 days
YIMO YIMO-1823148729717916915 Oct 2019 Mar 2020 156 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Mar 2020 156 days
UDOG UDOG-1000 Oct 2019 Mar 2020 156 days
SHAR SHAR-AF3BDE15 Oct 2019 Mar 2020 156 days
LOCK LOCK-10852900247427328 Oct 2019 Mar 2020 156 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Oct 2019 Mar 2020 156 days
VIDA VIDA-5181618553 Oct 2019 Mar 2020 156 days
SVRN SVRN-236947 Oct 2019 Jan 2020 67 days
MEDI MEDI-8CU8J33QS Oct 2019 Jan 2020 67 days
IMON IMON-2287 Feb 2020 Feb 2020 One Off
lidaho.com lidaho.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 5 days
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
MEME MEME-209 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Mar 2020 Mar 2020 One Off
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
UDOG UDOG-1000 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
VIDA VIDA-5181618553 Mar 2020 Mar 2020 One Off
TEAD TEAD-16795 Mar 2020 Mar 2020 One Off
oseriador.com.br oseriador.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 One Off
TEAD TEAD-16795 Mar 2020 Mar 2020 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
MEME MEME-209 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
UDOG UDOG-1000 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
VIDA VIDA-5181618553 Mar 2020 Mar 2020 One Off
soebola.com soebola.com
Attribute Value First Detected Last Detected Overlap Duration
TEAD TEAD-16795 Jan 2020 Mar 2020 82 days
IEX IEX-184282 Jan 2020 Mar 2020 82 days
LIJI LIJI-236947 Jan 2020 Mar 2020 82 days
AOL AOL-10513 Jan 2020 Mar 2020 82 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jan 2020 Mar 2020 82 days
LOCK LOCK-10852900247427328 Jan 2020 Mar 2020 82 days
PRIM PRIM-22430 Jan 2020 Mar 2020 82 days
MEME MEME-209 Jan 2020 Mar 2020 82 days
CONV CONV-40802 Jan 2020 Mar 2020 82 days
YIMO YIMO-1823148729717916915 Jan 2020 Mar 2020 82 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jan 2020 Mar 2020 82 days
UDOG UDOG-1000 Jan 2020 Mar 2020 82 days
SHAR SHAR-AF3BDE15 Jan 2020 Mar 2020 82 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jan 2020 Mar 2020 82 days
VIDA VIDA-5181618553 Jan 2020 Mar 2020 82 days
utua.com.br utua.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Jan 2020 Mar 2020 76 days
PRIM PRIM-22430 Jan 2020 Mar 2020 76 days
LIJI LIJI-236947 Jan 2020 Mar 2020 76 days
MEME MEME-209 Jan 2020 Mar 2020 76 days
CONV CONV-40802 Jan 2020 Mar 2020 76 days
IEX IEX-184282 Jan 2020 Mar 2020 76 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Jan 2020 Mar 2020 76 days
YIMO YIMO-1823148729717916915 Jan 2020 Mar 2020 76 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jan 2020 Mar 2020 76 days
UDOG UDOG-1000 Jan 2020 Mar 2020 76 days
SHAR SHAR-AF3BDE15 Jan 2020 Mar 2020 76 days
LOCK LOCK-10852900247427328 Jan 2020 Mar 2020 76 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jan 2020 Mar 2020 76 days
VIDA VIDA-5181618553 Jan 2020 Mar 2020 76 days
TEAD TEAD-16795 Jan 2020 Mar 2020 76 days
financiamentocredito.com financiamentocredito.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Feb 2020 Mar 2020 35 days
PRIM PRIM-22430 Feb 2020 Mar 2020 35 days
LIJI LIJI-236947 Feb 2020 Mar 2020 35 days
MEME MEME-209 Feb 2020 Mar 2020 35 days
CONV CONV-40802 Feb 2020 Mar 2020 35 days
IEX IEX-184282 Feb 2020 Mar 2020 35 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 35 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 35 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
UDOG UDOG-1000 Feb 2020 Mar 2020 35 days
SHAR SHAR-AF3BDE15 Feb 2020 Mar 2020 35 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 35 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 35 days
VIDA VIDA-5181618553 Feb 2020 Mar 2020 35 days
TEAD TEAD-16795 Feb 2020 Mar 2020 35 days
suvsite.net suvsite.net
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 210 days
UDOG UDOG-1000 Sep 2019 Mar 2020 210 days
PRIM PRIM-22430 Sep 2019 Mar 2020 210 days
MEME MEME-209 Sep 2019 Mar 2020 210 days
CONV CONV-40802 Sep 2019 Mar 2020 210 days
IEX IEX-184282 Sep 2019 Mar 2020 210 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Sep 2019 Mar 2020 210 days
YIMO YIMO-1823148729717916915 Sep 2019 Mar 2020 210 days
SMAD SMAD-3198 Sep 2019 Mar 2020 210 days
LOCK LOCK-10852900247427328 Sep 2019 Mar 2020 210 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 210 days
VIDA VIDA-5181618553 Sep 2019 Mar 2020 210 days
SVRN SVRN-236947 Sep 2019 Jan 2020 121 days
IMON IMON-2287 Jan 2020 Feb 2020 45 days
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
viraliq.com viraliq.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jul 2019 48 days
PRIM PRIM-22430 May 2019 May 2019 One Off
SVRN SVRN-236947 May 2019 May 2019 One Off
LIJI LIJI-236947 May 2019 May 2019 One Off
MEME MEME-209 May 2019 May 2019 One Off
CONV CONV-40802 May 2019 May 2019 One Off
IEX IEX-184282 May 2019 May 2019 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 May 2019 One Off
YIMO YIMO-1823148729717916915 May 2019 May 2019 One Off
UDOG UDOG-1000 May 2019 May 2019 One Off
SHAR SHAR-AF3BDE15 May 2019 May 2019 One Off
LOCK LOCK-10852900247427328 May 2019 May 2019 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 May 2019 One Off
VIDA VIDA-5181618553 May 2019 May 2019 One Off
MEDI MEDI-8CU8J33QS May 2019 May 2019 One Off
financeiroconsulte.com financeiroconsulte.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Feb 2020 Mar 2020 35 days
PRIM PRIM-22430 Feb 2020 Mar 2020 35 days
LIJI LIJI-236947 Feb 2020 Mar 2020 35 days
MEME MEME-209 Feb 2020 Mar 2020 35 days
CONV CONV-40802 Feb 2020 Mar 2020 35 days
IEX IEX-184282 Feb 2020 Mar 2020 35 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 35 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 35 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
UDOG UDOG-1000 Feb 2020 Mar 2020 35 days
SHAR SHAR-AF3BDE15 Feb 2020 Mar 2020 35 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 35 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 35 days
VIDA VIDA-5181618553 Feb 2020 Mar 2020 35 days
TEAD TEAD-16795 Feb 2020 Mar 2020 35 days
guiamexico.mx guiamexico.mx
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Aug 2019 Mar 2020 224 days
MEME MEME-209 Aug 2019 Mar 2020 224 days
CONV CONV-40802 Aug 2019 Mar 2020 224 days
YIMO YIMO-1823148729717916915 Aug 2019 Mar 2020 224 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Mar 2020 224 days
UDOG UDOG-1000 Aug 2019 Mar 2020 224 days
LOCK LOCK-10852900247427328 Aug 2019 Mar 2020 224 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Aug 2019 Mar 2020 224 days
VIDA VIDA-5181618553 Aug 2019 Mar 2020 224 days
IMON IMON-2287 Aug 2019 Feb 2020 200 days
IEX IEX-184282 Aug 2019 Oct 2019 60 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Aug 2019 Oct 2019 60 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
SMAD SMAD-3198 Oct 2019 Oct 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
buhamster.com buhamster.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Feb 2020 Mar 2020 40 days
MEME MEME-209 Feb 2020 Mar 2020 40 days
CONV CONV-40802 Feb 2020 Mar 2020 40 days
IEX IEX-184282 Feb 2020 Mar 2020 40 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 40 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 40 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 40 days
UDOG UDOG-1000 Feb 2020 Mar 2020 40 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 40 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 40 days
TEAD TEAD-16795 Feb 2020 Mar 2020 40 days
LIJI LIJI-236947 Feb 2020 Feb 2020 One Off
VIDA VIDA-5181618553 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
daily-story.com daily-story.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Feb 2020 Mar 2020 37 days
MEME MEME-209 Feb 2020 Mar 2020 37 days
CONV CONV-40802 Feb 2020 Mar 2020 37 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 37 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 37 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 37 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 37 days
TEAD TEAD-16795 Feb 2020 Mar 2020 37 days
IMON IMON-2287 Feb 2020 Feb 2020 18 days
AOL AOL-10513 Feb 2020 Feb 2020 One Off
IEX IEX-184282 Feb 2020 Feb 2020 One Off
LIJI LIJI-236947 Feb 2020 Feb 2020 One Off
VIDA VIDA-5181618553 Feb 2020 Feb 2020 One Off
SMAD SMAD-3198 Mar 2020 Mar 2020 One Off
librodeisogni.net librodeisogni.net
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Feb 2020 Mar 2020 40 days
LIJI LIJI-236947 Feb 2020 Mar 2020 40 days
MEME MEME-209 Feb 2020 Mar 2020 40 days
CONV CONV-40802 Feb 2020 Mar 2020 40 days
IEX IEX-184282 Feb 2020 Mar 2020 40 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Feb 2020 Mar 2020 40 days
YIMO YIMO-1823148729717916915 Feb 2020 Mar 2020 40 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 40 days
UDOG UDOG-1000 Feb 2020 Mar 2020 40 days
LOCK LOCK-10852900247427328 Feb 2020 Mar 2020 40 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Mar 2020 40 days
VIDA VIDA-5181618553 Feb 2020 Mar 2020 40 days
TEAD TEAD-16795 Feb 2020 Mar 2020 40 days
IMON IMON-2287 Feb 2020 Feb 2020 5 days
fustany.com fustany.com
Attribute Value First Detected Last Detected Overlap Duration
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Sep 2019 Mar 2020 199 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 199 days
UDOG UDOG-1000 Sep 2019 Mar 2020 199 days
LOCK LOCK-10852900247427328 Sep 2019 Mar 2020 199 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 199 days
IEX IEX-184282 Sep 2019 Mar 2020 175 days
TEAD TEAD-16795 Sep 2019 Jan 2020 130 days
MEDI MEDI-8CU8J33QS Sep 2019 Jan 2020 110 days
SVRN SVRN-236947 Sep 2019 Jan 2020 110 days
CONV CONV-40802 Sep 2019 Nov 2019 65 days
DM DM-100541 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Nov 2019 Nov 2019 One Off
AOL AOL-10513 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
revolvy.com revolvy.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Mar 2020 314 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 314 days
PRIM PRIM-22430 May 2019 Mar 2020 314 days
MEME MEME-209 May 2019 Mar 2020 314 days
IEX IEX-184282 May 2019 Mar 2020 314 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 314 days
UDOG UDOG-1000 May 2019 Mar 2020 314 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 314 days
VIDA VIDA-5181618553 May 2019 Mar 2020 314 days
IMON IMON-2287 May 2019 Feb 2020 279 days
SHAR SHAR-AF3BDE15 Oct 2019 Mar 2020 152 days
YIMO YIMO-1823148729717916915 Aug 2019 Jan 2020 129 days
MEDI MEDI-8CU8J33QS May 2019 Aug 2019 99 days
TEAD TEAD-16795 Jan 2020 Mar 2020 86 days
rtvonline.com rtvonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEME MEME-209 May 2019 Mar 2020 313 days
IEX IEX-184282 May 2019 Mar 2020 313 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020 313 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 313 days
UDOG UDOG-1000 May 2019 Mar 2020 313 days
SHAR SHAR-AF3BDE15 May 2019 Mar 2020 313 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 313 days
VIDA VIDA-5181618553 May 2019 Mar 2020 313 days
IMON IMON-2287 May 2019 Feb 2020 278 days
PRIM PRIM-22430 Aug 2019 Mar 2020 214 days
YIMO YIMO-1823148729717916915 Aug 2019 Mar 2020 214 days
TEAD TEAD-16795 Aug 2019 Mar 2020 214 days
CONV CONV-40802 Aug 2019 Feb 2020 182 days
msry.org msry.org
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 One Off
AOL AOL-10513 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
MEME MEME-209 Mar 2020 Mar 2020 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Mar 2020 Mar 2020 One Off
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
UDOG UDOG-1000 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
VIDA VIDA-5181618553 Mar 2020 Mar 2020 One Off
TEAD TEAD-16795 Mar 2020 Mar 2020 One Off
phertiiparta.ml phertiiparta.ml
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Mar 2020 Mar 2020 One Off
VIDA VIDA-5181618553 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
MEME MEME-209 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
UDOG UDOG-1000 Mar 2020 Mar 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
freereg.org.uk freereg.org.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Sep 2019 Mar 2020 199 days
CONV CONV-40802 Sep 2019 Mar 2020 199 days
PRIM PRIM-22430 Sep 2019 Mar 2020 199 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Sep 2019 Mar 2020 199 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 199 days
UDOG UDOG-1000 Sep 2019 Mar 2020 199 days
LOCK LOCK-10852900247427328 Sep 2019 Mar 2020 199 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 199 days
TEAD TEAD-16795 Sep 2019 Mar 2020 175 days
AOL AOL-10513 Sep 2019 Mar 2020 175 days
MEDI MEDI-8CU8J33QS Sep 2019 Jan 2020 110 days
DM DM-100541 Sep 2019 Oct 2019 44 days
freebmd.org.uk freebmd.org.uk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Sep 2019 Mar 2020 175 days
AOL AOL-10513 Sep 2019 Mar 2020 175 days
TEAD TEAD-16795 Sep 2019 Mar 2020 175 days
PRIM PRIM-22430 Sep 2019 Mar 2020 175 days
CONV CONV-40802 Sep 2019 Mar 2020 175 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Sep 2019 Mar 2020 175 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 175 days
UDOG UDOG-1000 Sep 2019 Mar 2020 175 days
LOCK LOCK-10852900247427328 Sep 2019 Mar 2020 175 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 175 days
MEDI MEDI-8CU8J33QS Sep 2019 Jan 2020 110 days
insidelacrosse.com insidelacrosse.com
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Nov 2019 Mar 2020 110 days
CONV CONV-40802 Nov 2019 Mar 2020 110 days
LIJI LIJI-236947 Nov 2019 Mar 2020 110 days
IEX IEX-184282 Nov 2019 Mar 2020 110 days
AOL AOL-10513 Nov 2019 Mar 2020 110 days
SHAR SHAR-AF3BDE15 Nov 2019 Mar 2020 110 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Nov 2019 Mar 2020 110 days
MEME MEME-209 Nov 2019 Mar 2020 110 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Mar 2020 110 days
VIDA VIDA-5181618553 Nov 2019 Mar 2020 110 days
SVRN SVRN-236947 Nov 2019 Jan 2020 45 days
dkpittsburghsports.com dkpittsburghsports.com
Attribute Value First Detected Last Detected Overlap Duration
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
MEME MEME-209 Mar 2020 Mar 2020 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Mar 2020 Mar 2020 One Off
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
UDOG UDOG-1000 Mar 2020 Mar 2020 One Off
VIDA VIDA-5181618553 Mar 2020 Mar 2020 One Off
TEAD TEAD-16795 Mar 2020 Mar 2020 One Off
ebulicao.news ebulicao.news
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Mar 2020 276 days
MEME MEME-209 Jun 2019 Mar 2020 276 days
CONV CONV-40802 Jun 2019 Mar 2020 276 days
IEX IEX-184282 Jun 2019 Mar 2020 276 days
SHAR SHAR-AF3BDE15 Jun 2019 Mar 2020 276 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 276 days
VIDA VIDA-5181618553 Jun 2019 Mar 2020 276 days
TEAD TEAD-16795 Aug 2019 Mar 2020 226 days
MEDI MEDI-8CU8J33QS Jun 2019 Jan 2020 201 days
DM DM-100541 Oct 2019 Oct 2019 26 days
mymeditravel.com mymeditravel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
MEME MEME-209 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
TEAD TEAD-16795 Mar 2020 Mar 2020 One Off
smallbizdaily.com smallbizdaily.com
Attribute Value First Detected Last Detected Overlap Duration
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Sep 2019 Sep 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Sep 2019 One Off
IMON IMON-2287 Sep 2019 Sep 2019 One Off
LOCK LOCK-10852900247427328 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CU8J33QS Sep 2019 Sep 2019 One Off
MEME MEME-209 Sep 2019 Sep 2019 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Sep 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
VIDA VIDA-5181618553 Sep 2019 Sep 2019 One Off
YIMO YIMO-1823148729717916915 Sep 2019 Sep 2019 One Off
flyheight.com flyheight.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Mar 2020 Mar 2020 One Off
YIMO YIMO-1823148729717916915 Mar 2020 Mar 2020 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
UDOG UDOG-1000 Mar 2020 Mar 2020 One Off
SMAD SMAD-3198 Mar 2020 Mar 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
VIDA VIDA-5181618553 Mar 2020 Mar 2020 One Off
velvetmag.it velvetmag.it
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Nov 2019 One Off
PRIM PRIM-22430 Nov 2019 Nov 2019 One Off
CONV CONV-40802 Nov 2019 Nov 2019 One Off
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Nov 2019 Nov 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Nov 2019 One Off
UDOG UDOG-1000 Nov 2019 Nov 2019 One Off
LOCK LOCK-10852900247427328 Nov 2019 Nov 2019 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Nov 2019 One Off
MEDI MEDI-8CU8J33QS Nov 2019 Nov 2019 One Off
dainikamadershomoy.com dainikamadershomoy.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Sep 2019 Mar 2020 184 days
MEME MEME-209 Sep 2019 Mar 2020 184 days
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Sep 2019 Mar 2020 184 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 184 days
SHAR SHAR-AF3BDE15 Sep 2019 Mar 2020 184 days
VIDA VIDA-5181618553 Sep 2019 Mar 2020 184 days
IMON IMON-2287 Sep 2019 Feb 2020 149 days
UDOG UDOG-1000 Sep 2019 Sep 2019 One Off
TEAD TEAD-16795 Sep 2019 Sep 2019 One Off
velvetgossip.it velvetgossip.it
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Nov 2019 Mar 2020 140 days
CONV CONV-40802 Nov 2019 Mar 2020 140 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 140 days
UDOG UDOG-1000 Nov 2019 Mar 2020 140 days
LOCK LOCK-10852900247427328 Nov 2019 Mar 2020 140 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Mar 2020 140 days
TEAD TEAD-16795 Jan 2020 Mar 2020 75 days
MEDI MEDI-8CU8J33QS Nov 2019 Jan 2020 51 days
IEX IEX-184282 Mar 2020 Mar 2020 27 days
goodreturns.in goodreturns.in
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Jan 2020 Mar 2020 69 days
SHAR SHAR-AF3BDE15 Jan 2020 Mar 2020 69 days
LOCK LOCK-10852900247427328 Jan 2020 Mar 2020 69 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jan 2020 Mar 2020 69 days
MEME MEME-209 Jan 2020 Mar 2020 69 days
PRIM PRIM-22430 Jan 2020 Mar 2020 45 days
CONV CONV-40802 Mar 2020 Mar 2020 24 days
LIJI LIJI-236947 Jan 2020 Jan 2020 One Off
mykhel.com mykhel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Feb 2020 Feb 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
MEME MEME-209 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
dailyconservative.com dailyconservative.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Mar 2020 276 days
SMAD SMAD-3198 Jun 2019 Mar 2020 276 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 276 days
IEX IEX-184282 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CU8J33QS Jun 2019 Jan 2020 203 days
LOCK LOCK-10852900247427328 Jun 2019 Sep 2019 108 days
TEAD TEAD-16795 Sep 2019 Dec 2019 64 days
filehippo.com filehippo.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 279 days
IMON IMON-2287 Jun 2019 Jan 2020 234 days
PRIM PRIM-22430 Jun 2019 Jan 2020 234 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
CONV CONV-40802 Nov 2019 Mar 2020 110 days
MEME MEME-209 Jun 2019 Jul 2019 48 days
wuxiaworld.com wuxiaworld.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Nov 2019 168 days
CONV CONV-40802 May 2019 Nov 2019 168 days
SVRN SVRN-236947 May 2019 Jul 2019 48 days
MEME MEME-209 May 2019 May 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
PRIM PRIM-22430 Nov 2019 Nov 2019 One Off
SMAD SMAD-3198 Nov 2019 Nov 2019 One Off
usingenglish.com usingenglish.com
Attribute Value First Detected Last Detected Overlap Duration
MEME MEME-209 Jul 2019 Mar 2020 255 days
LOCK LOCK-10852900247427328 Jul 2019 Mar 2020 231 days
MEDI MEDI-8CU8J33QS Jul 2019 Jan 2020 166 days
CONV CONV-40802 Jul 2019 Nov 2019 121 days
AOL AOL-10513 Aug 2019 Nov 2019 84 days
DM DM-100541 Aug 2019 Sep 2019 19 days
foiatualizado.com foiatualizado.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
apost.com apost.com
Attribute Value First Detected Last Detected Overlap Duration
SHAR SHAR-AF3BDE15 Nov 2019 Mar 2020 128 days
IEX IEX-184282 Nov 2019 Mar 2020 128 days
TEAD TEAD-16795 Nov 2019 Mar 2020 128 days
CONV CONV-40802 Nov 2019 Mar 2020 128 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Mar 2020 128 days
AOL AOL-10513 Nov 2019 Mar 2020 128 days
thehimalayantimes.com thehimalayantimes.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 254 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Mar 2020 254 days
CONV CONV-40802 Sep 2019 Mar 2020 199 days
SVRN SVRN-236947 Jul 2019 Jan 2020 165 days
AOL AOL-10513 Aug 2019 Jan 2020 149 days
IEX IEX-184282 Jan 2020 Mar 2020 69 days
drivespark.com drivespark.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jan 2020 Mar 2020 69 days
LIJI LIJI-236947 Jan 2020 Mar 2020 69 days
SHAR SHAR-AF3BDE15 Jan 2020 Mar 2020 69 days
MEME MEME-209 Jan 2020 Mar 2020 69 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 24 days
AOL AOL-10513 Mar 2020 Mar 2020 One Off
whynews.com whynews.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Sep 2019 54 days
CONV CONV-40802 Jul 2019 Sep 2019 54 days
LOCK LOCK-10852900247427328 Jul 2019 Sep 2019 54 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Sep 2019 54 days
TEAD TEAD-16795 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CU8J33QS Sep 2019 Sep 2019 One Off
wordfind.com wordfind.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Mar 2020 279 days
CONV CONV-40802 Jul 2019 Mar 2020 257 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Sep 2019 102 days
MEME MEME-209 May 2019 Sep 2019 102 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 26 days
PRIM PRIM-22430 May 2019 May 2019 One Off
meatualizei.com meatualizei.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
educationrjb.com educationrjb.com
Attribute Value First Detected Last Detected Overlap Duration
SHAR SHAR-AF3BDE15 Feb 2020 Mar 2020 36 days
LIJI LIJI-236947 Feb 2020 Feb 2020 One Off
LOCK LOCK-10852900247427328 Feb 2020 Feb 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Feb 2020 Feb 2020 One Off
CONV CONV-40802 Mar 2020 Mar 2020 One Off
audiogon.com audiogon.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jun 2019 Mar 2020 303 days
CONV CONV-40802 Jun 2019 Mar 2020 303 days
SMAD SMAD-3198 Jun 2019 Mar 2020 303 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
DM DM-100541 Sep 2019 Oct 2019 44 days
bibliacatolica.com.br bibliacatolica.com.br
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 190 days
AOL AOL-10513 Sep 2019 Mar 2020 190 days
IEX IEX-184282 Sep 2019 Mar 2020 190 days
SHAR SHAR-AF3BDE15 Sep 2019 Mar 2020 190 days
DM DM-100541 Sep 2019 Sep 2019 One Off
boredpanda.com boredpanda.com
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 279 days
MEDI MEDI-8CU8J33QS Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jun 2019 Jul 2019 48 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LOCK LOCK-10852900247427328 Nov 2019 Nov 2019 One Off
dicionariobiblico.com.br dicionariobiblico.com.br
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Feb 2020 131 days
AOL AOL-10513 Sep 2019 Feb 2020 131 days
IEX IEX-184282 Sep 2019 Feb 2020 131 days
SHAR SHAR-AF3BDE15 Sep 2019 Feb 2020 131 days
DM DM-100541 Sep 2019 Oct 2019 28 days
dramabeans.com dramabeans.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 231 days
CONV CONV-40802 Jul 2019 Mar 2020 231 days
AOL AOL-10513 Aug 2019 Mar 2020 194 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
IEX IEX-184282 Jan 2020 Mar 2020 45 days
scrabblewordfinder.org scrabblewordfinder.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Aug 2019 Aug 2019 One Off
CONV CONV-40802 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
PRIM PRIM-22430 Aug 2019 Aug 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Aug 2019 One Off
bibbiacattolica.com bibbiacattolica.com
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 190 days
AOL AOL-10513 Sep 2019 Mar 2020 190 days
IEX IEX-184282 Sep 2019 Mar 2020 190 days
SHAR SHAR-AF3BDE15 Sep 2019 Mar 2020 190 days
DM DM-100541 Sep 2019 Sep 2019 One Off
bibliacatolica.es bibliacatolica.es
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Sep 2019 One Off
DM DM-100541 Sep 2019 Sep 2019 One Off
AOL AOL-10513 Sep 2019 Sep 2019 One Off
IEX IEX-184282 Sep 2019 Sep 2019 One Off
SHAR SHAR-AF3BDE15 Sep 2019 Sep 2019 One Off
investorvillage.com investorvillage.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jul 2019 Mar 2020 255 days
IEX IEX-184282 Jul 2019 Mar 2020 255 days
SMAD SMAD-3198 Jul 2019 Mar 2020 255 days
AOL AOL-10513 Nov 2019 Mar 2020 134 days
LOCK LOCK-10852900247427328 Nov 2019 Mar 2020 134 days
panlasangpinoy.com panlasangpinoy.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jul 2019 Mar 2020 255 days
SMAD SMAD-3198 Jul 2019 Mar 2020 255 days
LOCK LOCK-10852900247427328 Jul 2019 Mar 2020 255 days
CONV CONV-40802 Jul 2019 Mar 2020 255 days
IEX IEX-184282 Jul 2019 Sep 2019 56 days
rolloid.net rolloid.net
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Jan 2020 228 days
MEME MEME-209 May 2019 Jan 2020 228 days
AOL AOL-10513 Aug 2019 Jan 2020 129 days
DM DM-100541 Aug 2019 Oct 2019 59 days
anandabazar.com anandabazar.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Nov 2019 169 days
MEME MEME-209 Jun 2019 Nov 2019 169 days
IEX IEX-184282 Jun 2019 Jul 2019 48 days
DM DM-100541 Aug 2019 Sep 2019 19 days
nativeplanet.com nativeplanet.com
Attribute Value First Detected Last Detected Overlap Duration
MEME MEME-209 Jan 2020 Mar 2020 45 days
SHAR SHAR-AF3BDE15 Jan 2020 Mar 2020 45 days
AOL AOL-10513 Jan 2020 Jan 2020 One Off
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
ajel.dev ajel.dev
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 Sep 2019 Mar 2020 194 days
IEX IEX-184282 Sep 2019 Mar 2020 194 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Sep 2019 Mar 2020 194 days
DM DM-100541 Sep 2019 Oct 2019 39 days
sharejoyb.club sharejoyb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Mar 2020 212 days
DM DM-100541 Sep 2019 Oct 2019 57 days
AOL AOL-10513 Feb 2020 Feb 2020 One Off
IEX IEX-184282 Feb 2020 Feb 2020 One Off
biblecatholique.org biblecatholique.org
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Mar 2020 125 days
AOL AOL-10513 Nov 2019 Mar 2020 125 days
IEX IEX-184282 Nov 2019 Mar 2020 125 days
SHAR SHAR-AF3BDE15 Nov 2019 Mar 2020 125 days
wwfoldschool.com wwfoldschool.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Nov 2019 168 days
IEX IEX-184282 May 2019 Sep 2019 103 days
DM DM-100541 Sep 2019 Sep 2019 One Off
AOL AOL-10513 Nov 2019 Nov 2019 One Off
destinationtips.com destinationtips.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jun 2019 Sep 2019 104 days
MEDI MEDI-8CU8J33QS Jun 2019 Sep 2019 104 days
CONV CONV-40802 Jul 2019 Jul 2019 One Off
LOCK LOCK-10852900247427328 Sep 2019 Sep 2019 One Off
bhaz.com.br bhaz.com.br
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jul 2019 Mar 2020 247 days
SHAR SHAR-AF3BDE15 Jul 2019 Mar 2020 247 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Mar 2020 247 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
free-power-point-templates.com free-power-point-templates.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Mar 2020 303 days
IEX IEX-184282 Jun 2019 Mar 2020 279 days
DM DM-100541 Sep 2019 Sep 2019 One Off
LOCK LOCK-10852900247427328 Sep 2019 Sep 2019 One Off
freebies.com freebies.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Mar 2020 231 days
PRIM PRIM-22430 Jul 2019 Mar 2020 231 days
AOL AOL-10513 Jan 2020 Mar 2020 45 days
IEX IEX-184282 Jan 2020 Mar 2020 45 days
ajel.sa ajel.sa
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 Jun 2019 Mar 2020 299 days
IEX IEX-184282 Jun 2019 Mar 2020 299 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 299 days
DM DM-100541 Aug 2019 Oct 2019 63 days
crichq.com crichq.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Dec 2019 Mar 2020 121 days
SVRN SVRN-236947 May 2019 Aug 2019 73 days
LIJI LIJI-236947 May 2019 Aug 2019 73 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Aug 2019 73 days
homemadetools.net homemadetools.net
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Mar 2020 279 days
AOL AOL-10513 Aug 2019 Mar 2020 194 days
LOCK LOCK-10852900247427328 Sep 2019 Mar 2020 175 days
DM DM-100541 Aug 2019 Oct 2019 63 days
jcnet.com.br jcnet.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Oct 2019 Mar 2020 169 days
IEX IEX-184282 Oct 2019 Mar 2020 169 days
MEDI MEDI-8CU8J33QS Oct 2019 Jan 2020 80 days
DM DM-100541 Oct 2019 Oct 2019 14 days
kwongwah.com.my kwongwah.com.my
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Aug 2019 Dec 2019 126 days
MEME MEME-209 Aug 2019 Dec 2019 126 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Dec 2019 Dec 2019 One Off
minilua.com minilua.com
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 313 days
AOL AOL-10513 Aug 2019 Dec 2019 122 days
IEX IEX-184282 Dec 2019 Mar 2020 93 days
DM DM-100541 Aug 2019 Oct 2019 63 days
pnrstatusbuzz.in pnrstatusbuzz.in
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jul 2019 Oct 2019 115 days
AOL AOL-10513 Feb 2020 Mar 2020 34 days
IEX IEX-184282 Feb 2020 Mar 2020 34 days
CONV CONV-40802 Feb 2020 Mar 2020 34 days
notimexpr.com notimexpr.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Mar 2020 157 days
SVRN SVRN-236947 Oct 2019 Jan 2020 69 days
LIJI LIJI-236947 Feb 2020 Mar 2020 35 days
pravda-tv.com pravda-tv.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 302 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 302 days
SVRN SVRN-236947 Jun 2019 Jan 2020 213 days
pravda-tv.de pravda-tv.de
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
LIJI LIJI-236947 May 2019 Feb 2020 282 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
roloteca.com roloteca.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Mar 2020 214 days
MEME MEME-209 Aug 2019 Mar 2020 214 days
DM DM-100541 Aug 2019 Oct 2019 59 days
allafrica.com allafrica.com
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jun 2019 Mar 2020 303 days
IEX IEX-184282 Jun 2019 Mar 2020 303 days
PRIM PRIM-22430 Jan 2020 Mar 2020 69 days
siasat.pk siasat.pk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jun 2019 Jan 2020 234 days
AOL AOL-10513 Jan 2020 Mar 2020 69 days
DM DM-100541 Aug 2019 Oct 2019 63 days
stage-crichq.com stage-crichq.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Mar 2020 147 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Jul 2019 One Off
basketball-addict.com basketball-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Nov 2019 One Off
AOL AOL-10513 Nov 2019 Nov 2019 One Off
LOCK LOCK-10852900247427328 Nov 2019 Nov 2019 One Off
bridoz.com bridoz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 298 days
IEX IEX-184282 May 2019 Nov 2019 192 days
TEAD TEAD-16795 Feb 2020 Feb 2020 One Off
wmlcloud.com wmlcloud.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
calcio-addict.com calcio-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Nov 2019 193 days
LOCK LOCK-10852900247427328 May 2019 Nov 2019 193 days
IEX IEX-184282 Jul 2019 Jul 2019 One Off
chococrazeo.club chococrazeo.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 56 days
AOL AOL-10513 Feb 2020 Feb 2020 One Off
IEX IEX-184282 Feb 2020 Feb 2020 One Off
cltampa.com cltampa.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 255 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
CTX CTX-562165 Mar 2020 Mar 2020 24 days
consumercomplaints.in consumercomplaints.in
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jun 2019 Mar 2020 303 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
DM DM-100541 Aug 2019 Oct 2019 63 days
cowfunz.com cowfunz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jun 2019 23 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
crowdstorm.co.uk crowdstorm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 254 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 254 days
SVRN SVRN-236947 Jul 2019 Jan 2020 165 days
dailysquib.co.uk dailysquib.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
designsponge.com designsponge.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Mar 2020 279 days
IEX IEX-184282 Jun 2019 Mar 2020 279 days
TEAD TEAD-16795 Jul 2019 Mar 2020 231 days
fetees.com fetees.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Dec 2019 Feb 2020 67 days
SMAD SMAD-3198 Dec 2019 Feb 2020 67 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Dec 2019 Feb 2020 67 days
feuerschalen-online.com feuerschalen-online.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Mar 2020 178 days
LIJI LIJI-236947 Oct 2019 Feb 2020 131 days
SVRN SVRN-236947 Oct 2019 Jan 2020 89 days
fruchtkorb.info fruchtkorb.info
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Mar 2020 177 days
LIJI LIJI-236947 Dec 2019 Mar 2020 113 days
SVRN SVRN-236947 Dec 2019 Jan 2020 24 days
gadgethim.com gadgethim.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 304 days
LIJI LIJI-236947 May 2019 Mar 2020 304 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
gospelprime.com.br gospelprime.com.br
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 May 2019 Jun 2019 31 days
IEX IEX-184282 May 2019 Jun 2019 31 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Jun 2019 31 days
happypostb.club happypostb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Mar 2020 174 days
DM DM-100541 Oct 2019 Oct 2019 19 days
AOL AOL-10513 Feb 2020 Feb 2020 One Off
istgesund.net istgesund.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Dec 2019 Mar 2020 97 days
IEX IEX-184282 Dec 2019 Mar 2020 97 days
LOCK LOCK-10852900247427328 Dec 2019 Mar 2020 97 days
laguiadelsur.es laguiadelsur.es
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 311 days
SVRN SVRN-236947 May 2019 Dec 2019 215 days
LIJI LIJI-236947 May 2019 Aug 2019 89 days
laprensa.com.ni laprensa.com.ni
Attribute Value First Detected Last Detected Overlap Duration
SHAR SHAR-AF3BDE15 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
mathrubhumi.com mathrubhumi.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Sep 2019 Sep 2019 One Off
CONV CONV-40802 Sep 2019 Sep 2019 One Off
IEX IEX-184282 Sep 2019 Sep 2019 One Off
mdundo.com mdundo.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Mar 2020 316 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
DM DM-100541 Aug 2019 Oct 2019 63 days
orlandoweekly.com orlandoweekly.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
LIJI LIJI-236947 Jun 2019 Nov 2019 169 days
CTX CTX-562165 Jan 2020 Jan 2020 One Off
purejoyd.club purejoyd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 88 days
AOL AOL-10513 Feb 2020 Mar 2020 34 days
IEX IEX-184282 Feb 2020 Feb 2020 One Off
reshish.com reshish.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Aug 2019 Mar 2020 218 days
IEX IEX-184282 Jan 2020 Mar 2020 86 days
DM DM-100541 Aug 2019 Oct 2019 63 days
riverfronttimes.com riverfronttimes.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
CTX CTX-562165 Jan 2020 Mar 2020 45 days
tennis-addict.net tennis-addict.net
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Nov 2019 116 days
LOCK LOCK-10852900247427328 Jul 2019 Nov 2019 116 days
IEX IEX-184282 Jul 2019 Jul 2019 One Off
bdjobs.com bdjobs.com
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 May 2019 Mar 2020 297 days
IEX IEX-184282 May 2019 Jan 2020 256 days
DM DM-100541 Aug 2019 Oct 2019 63 days
transplo.com transplo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-113139964 May 2018 Aug 2020 2 years, 68 days
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 7 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 7 days
viralized.com viralized.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jul 2019 Sep 2019 54 days
CONV CONV-40802 Jul 2019 Sep 2019 54 days
MEME MEME-209 Jul 2019 Sep 2019 54 days
bmw2002faq.com bmw2002faq.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 255 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 255 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
clevescene.com clevescene.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Nov 2019 Mar 2020 134 days
CTX CTX-562165 Jan 2020 Mar 2020 69 days
SVRN SVRN-236947 Nov 2019 Jan 2020 45 days
complaintsboard.com complaintsboard.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jun 2019 Mar 2020 279 days
PRIM PRIM-22430 Jun 2019 Mar 2020 279 days
LOCK LOCK-10852900247427328 Nov 2019 Mar 2020 110 days
dogpawsg.club dogpawsg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 52 days
AOL AOL-10513 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
dosmiechu.com dosmiechu.com
Attribute Value First Detected Last Detected Overlap Duration
TEAD TEAD-16795 Feb 2020 Mar 2020 36 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 36 days
IEX IEX-184282 Mar 2020 Mar 2020 One Off
doyouremember.com doyouremember.com
Attribute Value First Detected Last Detected Overlap Duration
MEME MEME-209 Jun 2019 Mar 2020 303 days
LOCK LOCK-10852900247427328 Jun 2019 Mar 2020 303 days
AOL AOL-10513 Nov 2019 Jan 2020 65 days
ebonus.gg ebonus.gg
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 May 2019 Mar 2020 302 days
IEX IEX-184282 May 2019 Dec 2019 199 days
SMAD SMAD-3198 Oct 2019 Mar 2020 167 days
eightieskids.com eightieskids.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Mar 2020 167 days
DM DM-100541 Oct 2019 Oct 2019 26 days
PRIM PRIM-22430 Oct 2019 Oct 2019 One Off
esnoticiaveracruz.com esnoticiaveracruz.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 316 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
SVRN SVRN-236947 May 2019 Oct 2019 137 days
esports-addict.com esports-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Jun 2019 28 days
LOCK LOCK-10852900247427328 May 2019 Jun 2019 28 days
IEX IEX-184282 Jun 2019 Jun 2019 One Off
fallbrook247.com fallbrook247.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Aug 2019 78 days
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 May 2019 Jun 2019 28 days
futbol-addict.com futbol-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Oct 2019 139 days
LOCK LOCK-10852900247427328 May 2019 Oct 2019 139 days
AOL AOL-10513 Aug 2019 Oct 2019 41 days
futebol-addict.com futebol-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Dec 2019 204 days
LOCK LOCK-10852900247427328 May 2019 Dec 2019 204 days
AOL AOL-10513 Oct 2019 Oct 2019 One Off
gadgether.com gadgether.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 254 days
LIJI LIJI-236947 Jul 2019 Mar 2020 254 days
SVRN SVRN-236947 Jul 2019 Jan 2020 165 days
gemuesekorb.info gemuesekorb.info
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Mar 2020 176 days
LIJI LIJI-236947 Oct 2019 Mar 2020 165 days
SVRN SVRN-236947 Oct 2019 Jan 2020 87 days
girlstalkinsmack.com girlstalkinsmack.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jul 2019 48 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jul 2019 48 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
igranada.es igranada.es
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 273 days
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
sacurrent.com sacurrent.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
CTX CTX-562165 Jan 2020 Mar 2020 45 days
sciencebuddies.org sciencebuddies.org
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 134 days
AOL AOL-10513 Nov 2019 Mar 2020 134 days
IEX IEX-184282 Jan 2020 Mar 2020 69 days
sclouddownloader.com sclouddownloader.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 May 2019 One Off
LIJI LIJI-236947 May 2019 May 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
walyou.com walyou.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jan 2020 234 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
watchmecraft.com watchmecraft.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Mar 2020 306 days
IEX IEX-184282 May 2019 Mar 2020 280 days
AOL AOL-10513 Sep 2019 Sep 2019 One Off
broadwayworld.com broadwayworld.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jul 2019 Mar 2020 231 days
DM DM-100541 Aug 2019 Oct 2019 63 days
CONV CONV-40802 Jun 2019 Jun 2019 One Off
buzzbuzzhome.com buzzbuzzhome.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Sep 2019 Mar 2020 175 days
AOL AOL-10513 Sep 2019 Mar 2020 175 days
CONV CONV-40802 Sep 2019 Mar 2020 175 days
defatoonline.com.br defatoonline.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Jan 2020 Mar 2020 68 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jan 2020 Mar 2020 68 days
IEX IEX-184282 Mar 2020 Mar 2020 One Off
dogloversd.club dogloversd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 118 days
AOL AOL-10513 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
ebela.in ebela.in
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 May 2019 Mar 2020 302 days
CONV CONV-40802 Aug 2019 Mar 2020 226 days
DM DM-100541 Aug 2019 Oct 2019 63 days
finduslocal.com finduslocal.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
happypostk.club happypostk.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 109 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
IEX IEX-184282 Dec 2019 Dec 2019 One Off
lucianne.com lucianne.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 231 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 231 days
SVRN SVRN-236947 Nov 2019 Jan 2020 45 days
metrotimes.com metrotimes.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Sep 2019 Jan 2020 110 days
CTX CTX-562165 Jan 2020 Mar 2020 69 days
onlydogsf.club onlydogsf.club
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Dec 2019 Mar 2020 90 days
CONV CONV-40802 Dec 2019 Mar 2020 90 days
IEX IEX-184282 Dec 2019 Dec 2019 One Off
outinstl.com outinstl.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Feb 2020 235 days
CTX CTX-562165 Feb 2020 Mar 2020 35 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
pravda-tv.net pravda-tv.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 316 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
ptebooks.com ptebooks.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Oct 2019 115 days
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
rensongbj.com rensongbj.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Feb 2020 234 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
CTX CTX-562165 Feb 2020 Feb 2020 One Off
al3abar.com al3abar.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Mar 2020 316 days
IEX IEX-184282 May 2019 Mar 2020 316 days
DM DM-100541 Aug 2019 Oct 2019 63 days
sportige.com sportige.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 255 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Jan 2020 186 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
supercook.com supercook.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Jan 2020 186 days
AOL AOL-10513 Nov 2019 Jan 2020 65 days
DM DM-100541 Sep 2019 Oct 2019 44 days
techshout.com techshout.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 231 days
LIJI LIJI-236947 Sep 2019 Mar 2020 175 days
SVRN SVRN-236947 Sep 2019 Jan 2020 110 days
thaismf.com thaismf.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 309 days
LIJI LIJI-236947 May 2019 Jan 2020 230 days
SVRN SVRN-236947 Sep 2019 Jan 2020 119 days
tiny.cc tiny.cc
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jun 2019 Mar 2020 279 days
AOL AOL-10513 Nov 2019 Jan 2020 65 days
DM DM-100541 Aug 2019 Oct 2019 63 days
buzzdrives.com buzzdrives.com
Attribute Value First Detected Last Detected Overlap Duration
MEME MEME-209 Mar 2020 Mar 2020 One Off
PRIM PRIM-22430 Mar 2020 Mar 2020 One Off
LOCK LOCK-10852900247427328 Mar 2020 Mar 2020 One Off
canadianlisted.com canadianlisted.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jul 2019 Jan 2020 186 days
MEME MEME-209 Jul 2019 Jan 2020 186 days
DM DM-100541 Sep 2019 Sep 2019 One Off
checkoutspy.com checkoutspy.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
LIJI LIJI-236947 Jan 2020 Mar 2020 69 days
citybeat.com citybeat.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
CTX CTX-562165 Mar 2020 Mar 2020 24 days
djremixalbums.com djremixalbums.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 301 days
SVRN SVRN-236947 Jun 2019 Dec 2019 173 days
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
dogpawsf.club dogpawsf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 52 days
AOL AOL-10513 Feb 2020 Feb 2020 One Off
IEX IEX-184282 Feb 2020 Feb 2020 One Off
drrtyr.mx drrtyr.mx
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 301 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 301 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
edmontongazette.com edmontongazette.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Aug 2019 One Off
gospelmais.com.br gospelmais.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Mar 2020 134 days
IEX IEX-184282 Nov 2019 Mar 2020 134 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Nov 2019 Mar 2020 134 days
guyhut.com guyhut.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Dec 2019 Dec 2019 One Off
LIJI LIJI-236947 Dec 2019 Dec 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Dec 2019 Dec 2019 One Off
irchk.com irchk.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 One Off
IEX IEX-184282 Mar 2020 Mar 2020 One Off
TEAD TEAD-16795 Mar 2020 Mar 2020 One Off
netdania.com netdania.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Mar 2020 279 days
MEME MEME-209 Jun 2019 Mar 2020 279 days
DM DM-100541 Aug 2019 Oct 2019 63 days
olharcurioso.net olharcurioso.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 1 day
IEX IEX-184282 Mar 2020 Mar 2020 1 day
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 1 day
leasticoulddo.com leasticoulddo.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
lghsathletics.com lghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 113 days
LIJI LIJI-236947 Jun 2019 Aug 2019 51 days
lifelooksb.club lifelooksb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Dec 2019 126 days
DM DM-100541 Oct 2019 Oct 2019 9 days
lifelooksf.club lifelooksf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 40 days
IEX IEX-184282 Feb 2020 Feb 2020 One Off
lifelooksp.info lifelooksp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 62 days
DM DM-100541 Oct 2019 Oct 2019 One Off
lifequotesm.info lifequotesm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 113 days
DM DM-100541 Oct 2019 Oct 2019 One Off
logic-immo-nieuwbouw.be logic-immo-nieuwbouw.be
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Feb 2020 236 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
lovemydogk.info lovemydogk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Oct 2019 153 days
DM DM-100541 Aug 2019 Oct 2019 55 days
maraudersathletics.com maraudersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
mcamustangsathletics.org mcamustangsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 113 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
memorialhsathletics.com memorialhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 113 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
mountainhouseathletics.com mountainhouseathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 63 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
mundijuegosweb.com mundijuegosweb.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jan 2020 184 days
LIJI LIJI-236947 Dec 2019 Mar 2020 93 days
musketeersathletics.com musketeersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
mwhswildcats.com mwhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
nchsathletics.com nchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Oct 2019 114 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
newspresb.club newspresb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 65 days
IEX IEX-184282 Dec 2019 Dec 2019 One Off
nlaeagles.org nlaeagles.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 56 days
SVRN SVRN-236947 Jul 2019 Sep 2019 56 days
oakmountainathletics.org oakmountainathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
onlydogsd.club onlydogsd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Mar 2020 156 days
DM DM-100541 Oct 2019 Oct 2019 1 day
ooltewahathletics.com ooltewahathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 52 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
oremhighathletics.com oremhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
owlsathletics.org owlsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
pennysaverusa.com pennysaverusa.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Mar 2020 303 days
DM DM-100541 Aug 2019 Oct 2019 63 days
philnews.ph philnews.ph
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jul 2019 Mar 2020 230 days
SMAD SMAD-3198 Jul 2019 Mar 2020 230 days
phoronix.com phoronix.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
phswarriors.com phswarriors.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
LIJI LIJI-236947 Jul 2019 Aug 2019 51 days
purejoyf.club purejoyf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 88 days
AOL AOL-10513 Feb 2020 Feb 2020 One Off
purejoyo.info purejoyo.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Aug 2019 52 days
DM DM-100541 Aug 2019 Aug 2019 One Off
purejoyp.info purejoyp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Aug 2019 52 days
DM DM-100541 Aug 2019 Aug 2019 One Off
questionablecontent.net questionablecontent.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
redbankathletics.com redbankathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 52 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
ritenourathletics.com ritenourathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
riverbluffathletics.com riverbluffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 52 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
rugby-addict.com rugby-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Jan 2020 228 days
LOCK LOCK-10852900247427328 May 2019 Jan 2020 228 days
russellvilleathletics.com russellvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
samakal.com samakal.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Mar 2020 313 days
LOCK LOCK-10852900247427328 Jan 2020 Feb 2020 52 days
aggiustatutto.it aggiustatutto.it
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 316 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
aikenstandard.com aikenstandard.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
seatexpert.com seatexpert.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
sharejoyb.info sharejoyb.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Sep 2019 Sep 2019 One Off
CONV CONV-40802 Sep 2019 Sep 2019 One Off
sharejoyd.info sharejoyd.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Sep 2019 Sep 2019 One Off
CONV CONV-40802 Sep 2019 Sep 2019 One Off
slidehunter.com slidehunter.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Mar 2020 303 days
AOL AOL-10513 Mar 2020 Mar 2020 24 days
sunloungeh.club sunloungeh.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 146 days
AOL AOL-10513 Mar 2020 Mar 2020 30 days
telemundocc.com telemundocc.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 May 2019 One Off
SVRN SVRN-236947 May 2019 May 2019 One Off
theroyaldogk.info theroyaldogk.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Sep 2019 Sep 2019 One Off
CONV CONV-40802 Sep 2019 Sep 2019 One Off
torah.org torah.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Nov 2019 65 days
LIJI LIJI-236947 Sep 2019 Nov 2019 65 days
beautynailhairsalons.com beautynailhairsalons.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 7 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 7 days
travelagenciesfinder.com travelagenciesfinder.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Jul 2018 One Off
OL OL-2859-424-10-6714 Jul 2018 Jul 2018 One Off
trophymanager.com trophymanager.com
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 Sep 2019 Mar 2020 199 days
DM DM-100541 Sep 2019 Oct 2019 44 days
bibleapps.com bibleapps.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Mar 2020 175 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
uprepathletics.net uprepathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
biology-online.org biology-online.org
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Sep 2019 104 days
PRIM PRIM-22430 Sep 2019 Sep 2019 One Off
verip.es verip.es
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Mar 2020 205 days
SVRN SVRN-236947 Sep 2019 Jan 2020 116 days
viralsharebee.com viralsharebee.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Jan 2020 Mar 2020 75 days
CONV CONV-40802 Jan 2020 Mar 2020 75 days
visualswithmicroscopeg.club visualswithmicroscopeg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 75 days
IEX IEX-184282 Jan 2020 Jan 2020 One Off
vrwolvesathletics.com vrwolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 54 days
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
waldronathletics.com waldronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
wandr.me wandr.me
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
wcpo.com wcpo.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Nov 2019 Mar 2020 110 days
SVRN SVRN-236947 Nov 2019 Jan 2020 45 days
btolat.com btolat.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Mar 2020 298 days
DM DM-100541 Aug 2019 Oct 2019 63 days
worldpopulationreview.com worldpopulationreview.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
UDOG UDOG-1000 Jun 2019 Jun 2019 One Off
cajathletics.com cajathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
xdatalife.com xdatalife.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 May 2019 One Off
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
canyonathletics.org canyonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 56 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
zacks.com zacks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
chococrazem.club chococrazem.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 56 days
AOL AOL-10513 Feb 2020 Mar 2020 39 days
chscoyotes.org chscoyotes.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
ciceroprepathletics.com ciceroprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
cornersoftheworldb.club cornersoftheworldb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Mar 2020 185 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
cornersoftheworldd.club cornersoftheworldd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Dec 2019 64 days
DM DM-100541 Sep 2019 Sep 2019 One Off
cross-currents.com cross-currents.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Nov 2019 120 days
LIJI LIJI-236947 Jul 2019 Sep 2019 55 days
crriverhawks.com crriverhawks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Sep 2019 58 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
dailyheyd.club dailyheyd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Dec 2019 64 days
DM DM-100541 Sep 2019 Sep 2019 One Off
dailyheyp.club dailyheyp.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 53 days
AOL AOL-10513 Mar 2020 Mar 2020 One Off
decoracion2.com decoracion2.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jan 2020 227 days
LIJI LIJI-236947 Jun 2019 Dec 2019 173 days
difundir.org difundir.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Mar 2020 134 days
IEX IEX-184282 Jan 2020 Mar 2020 68 days
diywatcho.info diywatcho.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Sep 2019 Sep 2019 One Off
CONV CONV-40802 Sep 2019 Sep 2019 One Off
dogloversp.info dogloversp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 59 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dogpawsp.info dogpawsp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 59 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dolartoday.org dolartoday.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 301 days
SVRN SVRN-236947 May 2019 Oct 2019 134 days
dpsdunbarathletics.com dpsdunbarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
dukkahrestaurant.com dukkahrestaurant.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
dulcenavidad.com dulcenavidad.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Dec 2019 199 days
LIJI LIJI-236947 Oct 2019 Mar 2020 182 days
ecvbraves.com ecvbraves.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 109 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
egotastic.com egotastic.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jan 2020 234 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
ehhsathletics.com ehhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
elgrifoinformacion.com elgrifoinformacion.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Oct 2019 One Off
eltoroathletics.com eltoroathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 109 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
emeraldathletics.com emeraldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
evansvilleharrisonathletics.com evansvilleharrisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
eveningclassifieds.com eveningclassifieds.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
eventyas.com eventyas.com
Attribute Value First Detected Last Detected Overlap Duration
OL OL-2859-424-10-6714 Sep 2018 Sep 2018 One Off
CA CA-PUB-5579869737189846 Sep 2018 Sep 2018 One Off
fashyas.com fashyas.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 19 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 19 days
fearthestingihs.org fearthestingihs.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
feelgoodquotesm.info feelgoodquotesm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 110 days
DM DM-100541 Oct 2019 Oct 2019 One Off
feelgoodquotesn.info feelgoodquotesn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 110 days
DM DM-100541 Aug 2019 Oct 2019 40 days
feelgoodquotesp.info feelgoodquotesp.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Oct 2019 Oct 2019 One Off
CONV CONV-40802 Oct 2019 Oct 2019 One Off
finehomebuilding.com finehomebuilding.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
frequenciesb.club frequenciesb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 64 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
gaylordathletics.com gaylordathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
ghathletics.org ghathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
gjhssports.com gjhssports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 109 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
glartent.com glartent.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 20 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 20 days
glencoeathletics.com glencoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 60 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
gocometsathletics.com gocometsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
goheightsbulldogs.com goheightsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 60 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
golancerssports.com golancerssports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
gomilbybuffs.com gomilbybuffs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
goodmenproject.com goodmenproject.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
gopatriotpride.com gopatriotpride.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
goschscougars.com goschscougars.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
goshermanbearcats.com goshermanbearcats.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gouctigers.com gouctigers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 60 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
happypostc.info happypostc.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 60 days
DM DM-100541 Oct 2019 Oct 2019 One Off
heraldathletics.com heraldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
hillsboroathletics.org hillsboroathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
jrhsathletics.com jrhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
hurontigerathletics.com hurontigerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
hvlathletics.com hvlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
idahosports.com idahosports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
ipcalc.info ipcalc.info
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Dec 2019 210 days
LIJI LIJI-236947 May 2019 Oct 2019 146 days
islanderathletics.com islanderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
jewishworldreview.com jewishworldreview.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jun 2019 36 days
LIJI LIJI-236947 May 2019 Jun 2019 36 days
johnmarshallathletics.com johnmarshallathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
jourdantonathletics.com jourdantonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 112 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
journalscene.com journalscene.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Jan 2020 130 days
SVRN SVRN-236947 Sep 2019 Jan 2020 110 days
juegosweb.com juegosweb.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Mar 2020 161 days
SVRN SVRN-236947 Aug 2019 Jan 2020 140 days
kearnykomets.com kearnykomets.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
kingstreenews.com kingstreenews.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Mar 2020 175 days
SVRN SVRN-236947 Sep 2019 Jan 2020 110 days
kmmountaineers.com kmmountaineers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
knightsathletics.net knightsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
kar-z.com kar-z.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 272 days
SVRN SVRN-236947 Jun 2019 Jan 2020 190 days
kbzk.com kbzk.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
kellathletics.org kellathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 61 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
kempnerathletics.com kempnerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 112 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
khurram.life khurram.life
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Jun 2019 One Off
IEX IEX-184282 Jun 2019 Jun 2019 One Off
kpax.com kpax.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jun 2019 Jul 2019 48 days
krtv.com krtv.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
ksby.com ksby.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jun 2019 Jul 2019 48 days
ktvq.com ktvq.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
kxlf.com kxlf.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jun 2019 Jul 2019 48 days
lex18.com lex18.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
lifelooksm.info lifelooksm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 62 days
DM DM-100541 Aug 2019 Oct 2019 54 days
lincolnprepathletics.org lincolnprepathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 113 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
localprayers.com localprayers.com
Attribute Value First Detected Last Detected Overlap Duration
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 7 days
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 7 days
logic-immo-neuf.be logic-immo-neuf.be
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Dec 2019 217 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
logic-immo.be logic-immo.be
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 302 days
SVRN SVRN-236947 Sep 2019 Jan 2020 110 days
lovemydogm.info lovemydogm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 113 days
DM DM-100541 Aug 2019 Oct 2019 55 days
lowcountryautomotive.com lowcountryautomotive.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 312 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
madvix.com madvix.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Aug 2018 Sep 2018 46 days
OL OL-2859-424-10-6714 Aug 2018 Sep 2018 46 days
mavpride.com mavpride.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 51 days
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
meteo.es meteo.es
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Aug 2019 92 days
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
mmostart-game.info mmostart-game.info
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jul 2019 42 days
LIJI LIJI-236947 May 2019 Jul 2019 42 days
moultrienews.com moultrienews.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
nataliasports.net nataliasports.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
navidad.es navidad.es
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 314 days
SVRN SVRN-236947 Jul 2019 Jan 2020 184 days
ndaeagles.org ndaeagles.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Oct 2019 113 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
newspresd.club newspresd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Mar 2020 159 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
npcmustangs.com npcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
nswildcats.com nswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
oconnellathletics.com oconnellathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
okbridaldress.com okbridaldress.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jul 2019 45 days
LIJI LIJI-236947 May 2019 Jul 2019 45 days
olentangyberlinathletics.com olentangyberlinathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Oct 2019 114 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
onlydogsc.club onlydogsc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 65 days
DM DM-100541 Oct 2019 Oct 2019 1 day
pceagles.com pceagles.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
phhsbigreds.com phhsbigreds.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 63 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
psprices.com psprices.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Aug 2019 One Off
IEX IEX-184282 Feb 2020 Feb 2020 One Off
ramonahighathletics.com ramonahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Oct 2019 115 days
LIJI LIJI-236947 Jul 2019 Oct 2019 115 days
ravensathletics.com ravensathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
rhymes-with-witch.com rhymes-with-witch.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jul 2019 47 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
advantage-job-find.com advantage-job-find.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 49 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
saucyrecipes.com saucyrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jan 2020 224 days
LIJI LIJI-236947 May 2019 Jul 2019 48 days
scbuffalostrong.com scbuffalostrong.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
schoolandcollegelistings.com schoolandcollegelistings.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020 1 year, 245 days
OL OL-2859-424-10-6714 Jul 2018 Sep 2018 58 days
ahsindians.com ahsindians.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
softschools.com softschools.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 255 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
sotecnologia.com sotecnologia.com
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Mar 2020 263 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
supootsuraifu.jp supootsuraifu.jp
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 280 days
SVRN SVRN-236947 Sep 2019 Nov 2019 64 days
tastegapsm.info tastegapsm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Sep 2019 53 days
DM DM-100541 Sep 2019 Sep 2019 One Off
autismdailynewscast.com autismdailynewscast.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
theminorityreportblog.com theminorityreportblog.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jan 2020 234 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
thomasdaleathletics.com thomasdaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 53 days
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
behindwoods.com behindwoods.com
Attribute Value First Detected Last Detected Overlap Duration
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 Nov 2019 Mar 2020 134 days
MEME MEME-209 Nov 2019 Mar 2020 134 days
truckerscafefood4soul.org truckerscafefood4soul.org
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Jul 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Jul 2019 One Off
biblescan.com biblescan.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
biblez.com biblez.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Mar 2020 199 days
SVRN SVRN-236947 Sep 2019 Jan 2020 110 days
untappedcities.com untappedcities.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Nov 2019 121 days
SVRN SVRN-236947 Jun 2019 Sep 2019 104 days
bitadir.com bitadir.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 297 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
blackfilm.com blackfilm.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Nov 2019 169 days
LIJI LIJI-236947 Jul 2019 Nov 2019 121 days
virtualjerusalem.com virtualjerusalem.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Sep 2019 104 days
LIJI LIJI-236947 Jun 2019 Sep 2019 104 days
bne.com.br bne.com.br
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 May 2019 Mar 2020 316 days
DM DM-100541 Aug 2019 Oct 2019 63 days
wchseagles.com wchseagles.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
boxingnewsnow.com boxingnewsnow.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Jul 2019 One Off
broadneckathletics.org broadneckathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
whoabella.com whoabella.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jan 2020 186 days
SVRN SVRN-236947 Jul 2019 Sep 2019 56 days
wildammo.com wildammo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 26 days
UDOG UDOG-1000 Mar 2020 Mar 2020 26 days
buffalocars.com buffalocars.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 255 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
buscacepapp.com buscacepapp.com
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Mar 2020 228 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
buscadorgratis.com buscadorgratis.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Feb 2020 259 days
SVRN SVRN-236947 May 2019 Nov 2019 193 days
zeelandwestsports.com zeelandwestsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 56 days
LIJI LIJI-236947 Jul 2019 Sep 2019 56 days
chococrazeb.club chococrazeb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Mar 2020 186 days
AOL AOL-10513 Mar 2020 Mar 2020 One Off
cornersoftheworldh.club cornersoftheworldh.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 121 days
AOL AOL-10513 Mar 2020 Mar 2020 One Off
coventryathletics.org coventryathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
craftstylish.com craftstylish.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jan 2020 234 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
csskodiaks.com csskodiaks.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
dailyheyg.club dailyheyg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 120 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
dhnet.be dhnet.be
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
dhshsathletics.com dhshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
dirrtyremix.es dirrtyremix.es
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Mar 2020 227 days
SVRN SVRN-236947 Dec 2019 Jan 2020 29 days
diywatcha.club diywatcha.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Dec 2019 65 days
DM DM-100541 Sep 2019 Sep 2019 One Off
diywatchm.info diywatchm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Sep 2019 108 days
DM DM-100541 Aug 2019 Sep 2019 35 days
dnsbl.info dnsbl.info
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jun 2019 25 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
dogloversb.club dogloversb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 64 days
DM DM-100541 Oct 2019 Oct 2019 27 days
dogloversk.info dogloversk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 109 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dogpawsk.info dogpawsk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 109 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dolartoday.info dolartoday.info
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 301 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
dolartoday.tv dolartoday.tv
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 301 days
SVRN SVRN-236947 May 2019 Dec 2019 198 days
dolartuday.net dolartuday.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 301 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
dolartuday.org dolartuday.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Feb 2020 264 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
dowathletics.com dowathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 49 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
dpsbelmontathletics.com dpsbelmontathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 108 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
dubistfit.de dubistfit.de
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 302 days
SVRN SVRN-236947 May 2019 Aug 2019 75 days
elkgroveford.com elkgroveford.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
elmonteathletics.com elmonteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
ensurenews.com ensurenews.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jan 2020 200 days
LIJI LIJI-236947 Aug 2019 Feb 2020 190 days
estasdemoda.com estasdemoda.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Feb 2020 Mar 2020 48 days
SVRN SVRN-236947 Dec 2019 Jan 2020 26 days
feelgoodquoteso.info feelgoodquoteso.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Oct 2019 Oct 2019 One Off
CONV CONV-40802 Oct 2019 Oct 2019 One Off
freebeacon.com freebeacon.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jun 2019 Jul 2019 48 days
fullertonindiansathletics.com fullertonindiansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
funkklingeln.com funkklingeln.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Dec 2019 Mar 2020 100 days
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
funstoryz.com funstoryz.com
Attribute Value First Detected Last Detected Overlap Duration
TEAD TEAD-16795 Jul 2019 Mar 2020 257 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
fussball-addict.com fussball-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Dec 2019 204 days
LOCK LOCK-10852900247427328 May 2019 Dec 2019 204 days
gahrgladiators.com gahrgladiators.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gamesbarq.com gamesbarq.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Jun 2019 30 days
CONV CONV-40802 May 2019 Jun 2019 30 days
glendoraathletics.com glendoraathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
gobluedevilsports.com gobluedevilsports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
gocomets.net gocomets.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gocrusadersathletics.com gocrusadersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
goeatoneagles.com goeatoneagles.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
gonwpanthers.com gonwpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gorattlernation.com gorattlernation.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gotaftathletics.com gotaftathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
gphswildcats.com gphswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 60 days
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
gthstitanathletics.com gthstitanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
hhshoyasports.com hhshoyasports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
hillel.org hillel.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
hogeyesports.net hogeyesports.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
iangavet.com iangavet.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Dec 2019 Feb 2020 63 days
SVRN SVRN-236947 Dec 2019 Jan 2020 18 days
improuse.com improuse.com
Attribute Value First Detected Last Detected Overlap Duration
OL OL-2859-424-10-6714 Jul 2018 Jul 2018 One Off
CA CA-PUB-5579869737189846 Jul 2018 Jul 2018 One Off
interhelp.org interhelp.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Mar 2020 223 days
SVRN SVRN-236947 Dec 2019 Jan 2020 17 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

jazzycash.com jazzycash.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jan 2020 227 days
LIJI LIJI-236947 Oct 2019 Mar 2020 161 days
jcpantherathletics.org jcpantherathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
jeffathletics.com jeffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
redarrowathletics.com redarrowathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
roughridersports.net roughridersports.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Aug 2019 52 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
cchsathletics.org cchsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
rugbyleaguenews.org rugbyleaguenews.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Aug 2019 One Off
schooltube.com schooltube.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
aikenaugustaauto.com aikenaugustaauto.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 316 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
sehablaespanolnews.com sehablaespanolnews.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 312 days
LIJI LIJI-236947 Feb 2020 Feb 2020 One Off
sgvikings.com sgvikings.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
allpoetry.com allpoetry.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
shsjaguars.com shsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
amor.net amor.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 250 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
smyrnahighathletics.com smyrnahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
societycaresb.club societycaresb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Jan 2020 129 days
DM DM-100541 Sep 2019 Sep 2019 One Off
socscistatistics.com socscistatistics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
apocrypha.org apocrypha.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
sunsigns.org sunsigns.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Sep 2019 104 days
SVRN SVRN-236947 Jun 2019 Sep 2019 104 days
swmavs.com swmavs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
astrologycircle.com astrologycircle.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 55 days
SVRN SVRN-236947 Jul 2019 Sep 2019 55 days
tcwestathletics.org tcwestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
telegraphindia.com telegraphindia.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Mar 2020 255 days
MEME MEME-209 Jul 2019 Mar 2020 255 days
theheartydogk.info theheartydogk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Sep 2019 53 days
DM DM-100541 Sep 2019 Sep 2019 One Off
theroyaldogb.club theroyaldogb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Jan 2020 129 days
DM DM-100541 Sep 2019 Oct 2019 53 days
festusathletics.com festusathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
tippecanoevalleyathletics.com tippecanoevalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 53 days
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
tooeleathletics.org tooeleathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
tornadoathletics.org tornadoathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 54 days
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
turbochristmas.com turbochristmas.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Nov 2019 166 days
LIJI LIJI-236947 Nov 2019 Mar 2020 142 days
twistity.com twistity.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Mar 2020 199 days
SVRN SVRN-236947 Sep 2019 Jan 2020 110 days
uglyeaglesathletics.com uglyeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
unycas.com unycas.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Mar 2020 206 days
SVRN SVRN-236947 Jul 2019 Sep 2019 53 days
vegetablegardener.com vegetablegardener.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jan 2020 186 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
vimeo.com vimeo.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jan 2020 234 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
voyageavance.global voyageavance.global
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 May 2019 One Off
LIJI LIJI-236947 May 2019 May 2019 One Off
vrnerds.de vrnerds.de
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 306 days
SVRN SVRN-236947 May 2019 Jan 2020 217 days
wanghong69.com wanghong69.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Nov 2019 Nov 2019 One Off
LIJI LIJI-236947 Nov 2019 Nov 2019 One Off
waylandunionwildcats.com waylandunionwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
wenonahdragonathletics.com wenonahdragonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
weregeek.com weregeek.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 305 days
SVRN SVRN-236947 Sep 2019 Jan 2020 114 days
wfchuangyou.com wfchuangyou.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Nov 2019 Jan 2020 65 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
btolat.net btolat.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Mar 2020 298 days
DM DM-100541 Aug 2019 Oct 2019 63 days
btolat.news btolat.news
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Mar 2020 298 days
DM DM-100541 Aug 2019 Oct 2019 63 days
wodwell.com wodwell.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Aug 2019 Mar 2020 218 days
DM DM-100541 Aug 2019 Oct 2019 63 days
wpspanthers.com wpspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 54 days
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
camelcamelcamel.com camelcamelcamel.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
carbontv.com carbontv.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Nov 2019 169 days
LIJI LIJI-236947 Jun 2019 Nov 2019 169 days
reshish.ru reshish.ru
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jul 2019 Jul 2019 One Off
CONV CONV-40802 Jul 2019 Jul 2019 One Off
chhsathletics.com chhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
chococrazek.club chococrazek.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 122 days
AOL AOL-10513 Nov 2019 Nov 2019 One Off
chscolts.org chscolts.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 59 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
hawkeyesathletics.com hawkeyesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
cincytacoweek.com cincytacoweek.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Nov 2019 Nov 2019 One Off
LIJI LIJI-236947 Feb 2020 Feb 2020 One Off
clutchcity.net clutchcity.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 254 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
clutchfans.net clutchfans.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
coogs4life.net coogs4life.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 59 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
cookingdonelight.com cookingdonelight.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jun 2019 23 days
LIJI LIJI-236947 May 2019 Jun 2019 23 days
covenantathletics.org covenantathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
cuddlebuda.club cuddlebuda.club
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Sep 2019 Sep 2019 One Off
IEX IEX-184282 Sep 2019 Sep 2019 One Off
curapelanatureza.com.br curapelanatureza.com.br
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 May 2019 Jun 2019 24 days
CONV CONV-40802 May 2019 Jun 2019 24 days
cursosedu.com cursosedu.com
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Aug 2019 Mar 2020 243 days
AOL AOL-10513 Aug 2019 Mar 2020 218 days
cvilleathletics.com cvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
dailyheyc.club dailyheyc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Dec 2019 64 days
DM DM-100541 Sep 2019 Sep 2019 One Off
dhsvikingsports.com dhsvikingsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
dixonramsathletics.com dixonramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
diywatchp.info diywatchp.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Sep 2019 Sep 2019 One Off
CONV CONV-40802 Sep 2019 Sep 2019 One Off
dogloversm.info dogloversm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 109 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dogloversn.info dogloversn.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Oct 2019 Oct 2019 One Off
CONV CONV-40802 Oct 2019 Oct 2019 One Off
dogloverso.info dogloverso.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 59 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dogpawsb.club dogpawsb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 64 days
DM DM-100541 Oct 2019 Oct 2019 27 days
dogpawsm.info dogpawsm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 109 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dogpawsn.info dogpawsn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 59 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dolartuday.co dolartuday.co
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 301 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
dovikingsathletics.com dovikingsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
downeyathletics.com downeyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
dpsmarshallathletics.com dpsmarshallathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
dpsmeadowdaleathletics.com dpsmeadowdaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 108 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
dpsponitzathletics.com dpsponitzathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 59 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
drf.com drf.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jul 2019 48 days
LIJI LIJI-236947 Jun 2019 Jul 2019 48 days
dunlapeaglesathletics.com dunlapeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
edmdl.co edmdl.co
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Mar 2020 226 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
efthunderbirds.com efthunderbirds.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
elmwoodparkathletics.com elmwoodparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
evansvillenorthathletics.com evansvillenorthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 109 days
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
fairfieldathletics.org fairfieldathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
fhcrangers.com fhcrangers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
findhealthclinics.com findhealthclinics.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 19 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 19 days
finecooking.com finecooking.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
finegardening.com finegardening.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
fitogfrisk.dk fitogfrisk.dk
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Mar 2020 225 days
SVRN SVRN-236947 Dec 2019 Dec 2019 One Off
frontieracademyathletics.com frontieracademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gaithersburgathletics.com gaithersburgathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
glendaleprepathletics.com glendaleprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
glennathletics.com glennathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
glenoakathletics.org glenoakathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
glequip.com glequip.com
Attribute Value First Detected Last Detected Overlap Duration
OL OL-2859-424-10-6714 Sep 2018 Sep 2018 One Off
CA CA-PUB-5579869737189846 Sep 2018 Sep 2018 One Off
gloopla.com gloopla.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 8 days
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 8 days
glorychanf.club glorychanf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 111 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
glorychanm.info glorychanm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 110 days
DM DM-100541 Aug 2019 Oct 2019 43 days
glorychanp.info glorychanp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 60 days
DM DM-100541 Oct 2019 Oct 2019 One Off
gobearcats.org gobearcats.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
gobgnsports.com gobgnsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gobigredathletics.com gobigredathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gobluecats.com gobluecats.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
goclarkathletics.com goclarkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
goherronathletics.com goherronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gokanelandknights.com gokanelandknights.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
golakeviewsports.com golakeviewsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 60 days
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
gomhswarhawks.com gomhswarhawks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
gopaolirams.com gopaolirams.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
gordonleeathletics.com gordonleeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
goredknightathletics.org goredknightathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gotjpatsathletics.com gotjpatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
govalhalla.org govalhalla.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
goyellowjacketsathletics.com goyellowjacketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
greenbuildingadvisor.com greenbuildingadvisor.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 231 days
SVRN SVRN-236947 Jul 2019 Jan 2020 166 days
grrlpowercomic.com grrlpowercomic.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
happypostc.club happypostc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 65 days
DM DM-100541 Oct 2019 Oct 2019 19 days
henryclayathletics.com henryclayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hesperiaathletics.com hesperiaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
hhihsathletics.org hhihsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 49 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hillcrestathletics.org hillcrestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hillcrestknightsathletics.com hillcrestknightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hurricanesathletics.com hurricanesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 111 days
LIJI LIJI-236947 Jun 2019 Oct 2019 111 days
ikbenfit.com ikbenfit.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Dec 2019 125 days
LIJI LIJI-236947 Jun 2019 Oct 2019 111 days
itsadogsworlda.club itsadogsworlda.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 65 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
itsadogsworldn.info itsadogsworldn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 61 days
DM DM-100541 Aug 2019 Oct 2019 48 days
jewishjournal.com jewishjournal.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
LIJI LIJI-236947 Jun 2019 Jul 2019 48 days
joboptionlistings.com joboptionlistings.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Feb 2020 188 days
SVRN SVRN-236947 May 2019 Oct 2019 148 days
kashmereathletics.com kashmereathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 112 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
kearsleyhornets.org kearsleyhornets.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
kristv.com kristv.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
kztv10.com kztv10.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
laplataathletics.org laplataathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
laps4.com laps4.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 311 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
latindex.com latindex.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 272 days
SVRN SVRN-236947 Jun 2019 Jan 2020 188 days
legalinsurrection.com legalinsurrection.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
leopardathletics.org leopardathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 62 days
LIJI LIJI-236947 Aug 2019 Oct 2019 62 days
lifequotesb.club lifequotesb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Dec 2019 126 days
DM DM-100541 Oct 2019 Oct 2019 One Off
lifequotesc.club lifequotesc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 64 days
DM DM-100541 Oct 2019 Oct 2019 9 days
lifequotesp.info lifequotesp.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Oct 2019 Oct 2019 One Off
CONV CONV-40802 Oct 2019 Oct 2019 One Off
lolakers.com lolakers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 112 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
lovemydogc.club lovemydogc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 64 days
DM DM-100541 Oct 2019 Oct 2019 8 days
lovemydogf.club lovemydogf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 99 days
IEX IEX-184282 Feb 2020 Feb 2020 One Off
lphsathletics.net lphsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
marauderathletics.org marauderathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 51 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
mcseagles.org mcseagles.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 51 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
menaulsports.com menaulsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 113 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
mesquiteathletics.com mesquiteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 62 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
miamisburgathletics.com miamisburgathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
milacawolves.com milacawolves.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
milanathletics.com milanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
milfordmavs.com milfordmavs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
mlbnewsnow.com mlbnewsnow.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Dec 2019 127 days
SVRN SVRN-236947 Dec 2019 Dec 2019 One Off
mrhssentinels.org mrhssentinels.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
murrayhsathletics.com murrayhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
muysalud.com muysalud.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Feb 2020 278 days
SVRN SVRN-236947 Oct 2019 Jan 2020 71 days
mvcmustangs.com mvcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
LIJI LIJI-236947 Jul 2019 Aug 2019 51 days
mycutebaby.in mycutebaby.in
Attribute Value First Detected Last Detected Overlap Duration
MEME MEME-209 May 2019 Mar 2020 316 days
CONV CONV-40802 May 2019 Mar 2020 316 days
newspapers.com newspapers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
newspress.com newspress.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Nov 2019 Mar 2020 134 days
SVRN SVRN-236947 Nov 2019 Jan 2020 45 days
nflnews.org nflnews.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Aug 2019 One Off
nfraidersathletics.com nfraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
oclancerathletics.com oclancerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
ontarioathletics.org ontarioathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 52 days
LIJI LIJI-236947 Jul 2019 Aug 2019 52 days
openforjobs.com openforjobs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Feb 2020 280 days
SVRN SVRN-236947 Jul 2019 Jan 2020 182 days
pcactivities.com pcactivities.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
phsterrors.org phsterrors.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
plhsfightingpointers.com plhsfightingpointers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Oct 2019 115 days
SVRN SVRN-236947 Jul 2019 Aug 2019 52 days
ptwarriors.org ptwarriors.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
publicacion.com publicacion.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
cuisimonde.com cuisimonde.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
LIJI LIJI-236947 Feb 2020 Mar 2020 54 days
revistacloud.com revistacloud.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Feb 2020 281 days
SVRN SVRN-236947 May 2019 Jan 2020 225 days
rubidouxathletics.com rubidouxathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
aahuronathletics.com aahuronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
samchui.com samchui.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jul 2019 47 days
LIJI LIJI-236947 May 2019 May 2019 One Off
al3aby4yy.com al3aby4yy.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Mar 2020 316 days
CONV CONV-40802 May 2019 Mar 2020 316 days
sharejoyc.info sharejoyc.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Sep 2019 53 days
DM DM-100541 Sep 2019 Sep 2019 One Off
sharejoyd.club sharejoyd.club
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Sep 2019 Sep 2019 One Off
CONV CONV-40802 Sep 2019 Sep 2019 One Off
amandaclearcreekathletics.com amandaclearcreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
antaizhiye.com antaizhiye.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Nov 2019 65 days
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
solitairebliss.com solitairebliss.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Jan 2020 Mar 2020 69 days
CONV CONV-40802 Jan 2020 Mar 2020 69 days
somethingpositive.net somethingpositive.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
southchristiansports.com southchristiansports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 56 days
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
southdearbornathletics.com southdearbornathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
srfalcons.org srfalcons.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 53 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
stmaknights.com stmaknights.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
storywrite.com storywrite.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 302 days
SVRN SVRN-236947 Jun 2019 Jan 2020 213 days
summervilleathletics.com summervilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
aktienkursewelt.com aktienkursewelt.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 316 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
tbirdathletics.com tbirdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 53 days
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
ayudaparamanualidades.com ayudaparamanualidades.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 277 days
SVRN SVRN-236947 Jun 2019 Jan 2020 208 days
threadsmagazine.com threadsmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
toilettensitzerhoehungen.com toilettensitzerhoehungen.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Nov 2019 Mar 2020 143 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 143 days
batesvilleathletics.com batesvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
bibleatlas.org bibleatlas.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Mar 2020 231 days
SVRN SVRN-236947 Nov 2019 Jan 2020 45 days
blakeathletics.org blakeathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
vnnsportshub.net vnnsportshub.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
wareshoalsathletics.com wareshoalsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
webflyer.com webflyer.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 56 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
wfhscoyoteathletics.com wfhscoyoteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
wpdirecto.com wpdirecto.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jan 2020 216 days
LIJI LIJI-236947 Sep 2019 Mar 2020 203 days
wqddjlm.com wqddjlm.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Jan 2020 233 days
SVRN SVRN-236947 May 2019 Jan 2020 216 days
buzz-addict.com buzz-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Nov 2019 65 days
LOCK LOCK-10852900247427328 Sep 2019 Nov 2019 65 days
buzzfuse.net buzzfuse.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jan 2020 227 days
LIJI LIJI-236947 May 2019 Nov 2019 193 days
henrycountyathletics.com henrycountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
ypsigrizzlies.com ypsigrizzlies.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 55 days
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
cavernaathletics.com cavernaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
zamora24horas.com zamora24horas.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 255 days
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
cedarspringsathletics.com cedarspringsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 58 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
chemics.net chemics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
chococrazeg.club chococrazeg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 122 days
AOL AOL-10513 Nov 2019 Feb 2020 66 days
chococrazeh.club chococrazeh.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 56 days
AOL AOL-10513 Feb 2020 Feb 2020 One Off
coinmarketcap.com coinmarketcap.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jan 2020 213 days
LIJI LIJI-236947 Jul 2019 Jan 2020 186 days
comics.org comics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
cornersoftheworldg.club cornersoftheworldg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 55 days
IEX IEX-184282 Mar 2020 Mar 2020 One Off
cotacoesbolsa.com cotacoesbolsa.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 300 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
covathletics.org covathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
cracked.com cracked.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Dec 2019 195 days
LIJI LIJI-236947 Jun 2019 Dec 2019 172 days
cyber-breeze.com cyber-breeze.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 May 2019 Mar 2020 316 days
DM DM-100541 Aug 2019 Oct 2019 63 days
dailyheyb.club dailyheyb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Mar 2020 184 days
DM DM-100541 Sep 2019 Oct 2019 29 days
dailyheyb.info dailyheyb.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Sep 2019 59 days
DM DM-100541 Sep 2019 Sep 2019 One Off
dailyheyd.info dailyheyd.info
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Sep 2019 Sep 2019 One Off
CONV CONV-40802 Sep 2019 Sep 2019 One Off
dailyheyh.club dailyheyh.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 120 days
AOL AOL-10513 Feb 2020 Feb 2020 One Off
dailynayadiganta.com dailynayadiganta.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Aug 2019 Oct 2019 63 days
IEX IEX-184282 May 2019 Jun 2019 24 days
dekotipps.com dekotipps.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Dec 2019 64 days
LIJI LIJI-236947 Dec 2019 Dec 2019 One Off
demilked.com demilked.com
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Mar 2020 231 days
RTB RTB-3I1LYLGQH8EQE6N8GJZB Mar 2020 Mar 2020 One Off
diariodelamancha.com diariodelamancha.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Mar 2020 227 days
SVRN SVRN-236947 Aug 2019 Jan 2020 153 days
diywatchk.info diywatchk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Sep 2019 59 days
DM DM-100541 Aug 2019 Sep 2019 35 days
djpool.co djpool.co
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 301 days
LIJI LIJI-236947 Jun 2019 Aug 2019 49 days
dogpawso.info dogpawso.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 59 days
DM DM-100541 Aug 2019 Oct 2019 36 days
dolartoday.com dolartoday.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 279 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
dolartuday.info dolartuday.info
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 301 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
downersgrovesouthathletics.com downersgrovesouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 108 days
SVRN SVRN-236947 Jun 2019 Aug 2019 49 days
dpsstiversathletics.com dpsstiversathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 49 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
dublinathletics.us dublinathletics.us
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
dzls56.com dzls56.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
ecathletics.org ecathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 59 days
LIJI LIJI-236947 Aug 2019 Oct 2019 59 days
egthunderbirds.com egthunderbirds.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 49 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
eltiempomadrid.com eltiempomadrid.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 302 days
SVRN SVRN-236947 Aug 2019 Dec 2019 123 days
envyauto9w.com envyauto9w.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 303 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
evanstonathletics.com evanstonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
fcgriffins.com fcgriffins.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
feelgoodquotesc.club feelgoodquotesc.club
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Dec 2019 Dec 2019 One Off
CONV CONV-40802 Dec 2019 Dec 2019 One Off
ffivepado.site ffivepado.site
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
CTX CTX-562165 Mar 2020 Mar 2020 One Off
filesearch.io filesearch.io
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Aug 2019 79 days
LIJI LIJI-236947 May 2019 Jun 2019 29 days
findglocal.com findglocal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 7 days
OL OL-2859-424-10-6714 Jul 2018 Jul 2018 One Off
finewoodworking.com finewoodworking.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Mar 2020 303 days
SVRN SVRN-236947 Jun 2019 Jan 2020 214 days
folsomathletics.com folsomathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
frankenmuthathletics.com frankenmuthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
funcarz.com funcarz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Feb 2020 Mar 2020 35 days
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
fvhsathletics.com fvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 56 days
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
gaffneyindiansathletics.com gaffneyindiansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 59 days
LIJI LIJI-236947 Aug 2019 Oct 2019 59 days
gelgul.com gelgul.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 35 days
TEAD TEAD-16795 Feb 2020 Feb 2020 One Off
glorychanb.club glorychanb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Dec 2019 124 days
DM DM-100541 Aug 2019 Oct 2019 43 days
glorychann.info glorychann.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 110 days
DM DM-100541 Aug 2019 Oct 2019 43 days
glotels.com glotels.com
Attribute Value First Detected Last Detected Overlap Duration
OL OL-2859-424-10-6714 Jul 2018 Aug 2018 8 days
CA CA-PUB-5579869737189846 Jul 2018 Aug 2018 8 days
goblackshirts.com goblackshirts.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gocardinalritter.org gocardinalritter.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
gocelts.com gocelts.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
gocentralsports.com gocentralsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
goclementsfootball.com goclementsfootball.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gofalconathletics.com gofalconathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
goganders.com goganders.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
gohowebulldogs.net gohowebulldogs.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
goplymouthathletics.com goplymouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gorebelsathletics.com gorebelsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
gossip-addict.com gossip-addict.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Aug 2019 81 days
LOCK LOCK-10852900247427328 May 2019 Aug 2019 81 days
gowbmillers.com gowbmillers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
haeorum.com haeorum.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Mar 2020 224 days
SVRN SVRN-236947 Aug 2019 Jan 2020 145 days
happypostb.info happypostb.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 60 days
DM DM-100541 Oct 2019 Oct 2019 One Off
happypostd.info happypostd.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 60 days
DM DM-100541 Aug 2019 Oct 2019 44 days
hcaeaglessports.org hcaeaglessports.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
hcbeavers.net hcbeavers.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hhsmustangathletics.org hhsmustangathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
hillgroveathletics.com hillgroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
howemilitaryathletics.org howemilitaryathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hwhswildcats.com hwhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
itsadogsworldm.info itsadogsworldm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 111 days
DM DM-100541 Aug 2019 Oct 2019 48 days
jeromeathletics.net jeromeathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
jimtownathletics.org jimtownathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 111 days
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
johnadamsathletics.com johnadamsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
johnmarshallathletics.org johnmarshallathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
juiciopolitico.com juiciopolitico.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 309 days
SVRN SVRN-236947 Aug 2019 Jan 2020 140 days
katc.com katc.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
kushnercobras.com kushnercobras.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
kxlh.com kxlh.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
laps3.com laps3.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Mar 2020 222 days
SVRN SVRN-236947 Aug 2019 Jan 2020 138 days
lavilleathletics.com lavilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
lifequotesd.club lifequotesd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 100 days
AOL AOL-10513 Dec 2019 Dec 2019 One Off
limabride365.com limabride365.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Mar 2020 159 days
SVRN SVRN-236947 Oct 2019 Jan 2020 75 days
localbarsfinder.com localbarsfinder.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Sep 2018 52 days
OL OL-2859-424-10-6714 Jul 2018 Sep 2018 52 days
loteriaresultados.es loteriaresultados.es
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Feb 2020 276 days
SVRN SVRN-236947 Jun 2019 Jan 2020 187 days
lovemydogd.club lovemydogd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Mar 2020 163 days
DM DM-100541 Oct 2019 Oct 2019 8 days
lovemydogp.info lovemydogp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 62 days
DM DM-100541 Oct 2019 Oct 2019 One Off
malaysiastock.biz malaysiastock.biz
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Feb 2020 277 days
DM DM-100541 Aug 2019 Oct 2019 63 days
mapasapp.com mapasapp.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 May 2019 Feb 2020 277 days
DM DM-100541 Aug 2019 Oct 2019 56 days
meadowcreekathletics.org meadowcreekathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 51 days
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
mejorconsalud.com mejorconsalud.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Dec 2019 178 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
milandawgs.com milandawgs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Oct 2019 113 days
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
mujeres.es mujeres.es
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 314 days
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
myjobhelper.co.uk myjobhelper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Mar 2020 160 days
DM DM-100541 Oct 2019 Oct 2019 One Off
nmblacktornadosports.com nmblacktornadosports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 63 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
northviewsports.com northviewsports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 55 days
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
occujump.com occujump.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Feb 2020 235 days
SVRN SVRN-236947 May 2019 Jan 2020 227 days
ocoeeathletics.com ocoeeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
odathletics.com odathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
odcsathletics.org odcsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
okemosathletics.net okemosathletics.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
oshareinteria.jp oshareinteria.jp
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jan 2020 181 days
LIJI LIJI-236947 Jul 2019 Dec 2019 179 days
otrapartida.com otrapartida.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Mar 2020 219 days
SVRN SVRN-236947 May 2019 Oct 2019 160 days
ovidelsiesports.com ovidelsiesports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
palma-asakim.com palma-asakim.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 May 2019 Jul 2019 46 days
LIJI LIJI-236947 May 2019 Jul 2019 46 days
pflsports.net pflsports.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 63 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
phsbulldogsathletics.org phsbulldogsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
pmawarriorsathletics.com pmawarriorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 63 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
pvathletics.com pvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
randolphathletics.net randolphathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
ravennaathletics.us ravennaathletics.us
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Oct 2019 115 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
ravennabulldogsathletics.com ravennabulldogsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Oct 2019 115 days
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
kshb.com kshb.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
kvue.com kvue.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
lasalleprepathletics.org lasalleprepathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
lbpolyathletics.com lbpolyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
leedavisathletics.com leedavisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
leegeneralsathletics.com leegeneralsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
lifelooksc.club lifelooksc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Dec 2019 One Off
lifelooksn.info lifelooksn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Aug 2019 51 days
lifequotesf.club lifequotesf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 40 days
likesharetweet.com likesharetweet.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
lincolnprepathletics.com lincolnprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
llamayo.com llamayo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jun 2019 40 days
losaltosathletics.org losaltosathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 62 days
losaltossports.com losaltossports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 113 days
lrathletics.org lrathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
luxandlush.com luxandlush.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 272 days
matadorathletics.org matadorathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
mbbuccaneers.com mbbuccaneers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
meadowbrookathletics.com meadowbrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
meups4.com.br meups4.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Aug 2019 Oct 2019 56 days
mjhemails.com mjhemails.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Mar 2020 316 days
mkjseadacbdc.ru mkjseadacbdc.ru
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Aug 2019 93 days
naeagles.com naeagles.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
ncwhsathletics.com ncwhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Aug 2019 51 days
ramsayramsathletics.com ramsayramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
nhseagleathletics.com nhseagleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
nohsathletics.com nohsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
northwestathletics.org northwestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 56 days
nuviewbridgeathletics.com nuviewbridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Oct 2019 114 days
oaathletics.org oaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Oct 2019 114 days
oakridgeathletics.com oakridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Aug 2019 51 days
obozrevatel.com obozrevatel.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 45 days
ohslions.com ohslions.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
onlydogsm.info onlydogsm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Aug 2019 52 days
oregoncityschoolsathletics.org oregoncityschoolsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Oct 2019 114 days
pacerathletics.org pacerathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 63 days
raysofhopea.club raysofhopea.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Oct 2019 One Off
patriotproud.net patriotproud.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
pcspacers.com pcspacers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
rebelstrue.com rebelstrue.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
perfdrive.com perfdrive.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jun 2019 Feb 2020 240 days
perris247.com perris247.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Oct 2019 One Off
phhspatriotpride.com phhspatriotpride.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 63 days
phnhuskies.com phnhuskies.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
piedmontwildcatsathletics.com piedmontwildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
piquaindiansathletics.org piquaindiansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
pleasantgrovevikings.com pleasantgrovevikings.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
pmhsfalcons.com pmhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
popeathletics.com popeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
prettyfun.com prettyfun.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
prosport.ro prosport.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
puppytownj.info puppytownj.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
puppytownk.info puppytownk.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
puppytownl.info puppytownl.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
puppytownq.info puppytownq.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
puppyvillep.info puppyvillep.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
purejoyc.club purejoyc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Jan 2020 65 days
purejoyi.info purejoyi.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 May 2019 One Off
qchsathletics.com qchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
quizpeek.com quizpeek.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 315 days
qwily.com qwily.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
radiopaedia.org radiopaedia.org
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Sep 2019 104 days
revrevy.com revrevy.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
ringgoldrams.org ringgoldrams.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
rochesterrams.org rochesterrams.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
acpathletics.com acpathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
saladoeaglenation.org saladoeaglenation.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
arcadehippo.com arcadehippo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 298 days
scottbulldogs.org scottbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
scseaglenation.com scseaglenation.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
aggieathletics.org aggieathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
semperzoo.com semperzoo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
aktiespararna.se aktiespararna.se
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 21 days
akcenty.com.ua akcenty.com.ua
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Mar 2020 129 days
sjraidersathletics.com sjraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
slwceaglenationathletics.com slwceaglenationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
snifflyh.info snifflyh.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 May 2019 One Off
snifflyk.info snifflyk.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
snugglepupj.info snugglepupj.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
snugglepupm.info snugglepupm.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
societycaresg.club societycaresg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 31 days
societycareso.info societycareso.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Sep 2019 53 days
soobluedevils.com soobluedevils.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
spartanation300.com spartanation300.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
spstallions.com spstallions.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
sputnamathletics.com sputnamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
stvmathletics.com stvmathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
svhsathletics.org svhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
tctrojanpride.com tctrojanpride.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
aynorbluejackets.net aynorbluejackets.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
tigardtigers.com tigardtigers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
tischkochen.com tischkochen.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jan 2020 Mar 2020 78 days
bathcountyathletics.com bathcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
baycitywesternathletics.com baycitywesternathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
tomorrowoman.com tomorrowoman.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
translate.ru translate.ru
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
tribunely.com tribunely.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Sep 2019 One Off
trndsnt.de trndsnt.de
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 280 days
tubereplay.com tubereplay.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 24 days
bglancers.com bglancers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
uhstitansathletics.com uhstitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 54 days
unici.cn unici.cn
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Nov 2019 One Off
bihon.ro bihon.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 19 days
utdt.net utdt.net
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Jan 2020 One Off
blic.rs blic.rs
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
vfathletics.com vfathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
waggenerathletics.com waggenerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wbir.com wbir.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 69 days
wcsramsathletics.com wcsramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
waynedaleathletics.com waynedaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
bouldercityathletics.com bouldercityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
weareauburndaleathletics.com weareauburndaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
brainfall.com brainfall.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 255 days
weldcentralrebels.com weldcentralrebels.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wghathletics.org wghathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wgrz.com wgrz.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 26 days
wfaa.com wfaa.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
winamacathletics.com winamacathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
wkyc.com wkyc.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 45 days
wmc1010.info wmc1010.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Jul 2019 48 days
wnhsathletics.com wnhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
bumblebeenation.com bumblebeenation.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
woodburnbulldogs.com woodburnbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wossmanwildcatsathletics.com wossmanwildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
wtol.com wtol.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 26 days
buzzinhere.com buzzinhere.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
wundaba.de wundaba.de
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jan 2020 Jan 2020 One Off
buzzvivo.com buzzvivo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Sep 2019 128 days
bvathletics.net bvathletics.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
cacavaliers.com cacavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
wythemaroons.org wythemaroons.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
xeniaathletics.com xeniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
canyonlake247.com canyonlake247.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Nov 2019 193 days
ynetnews.com ynetnews.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
cbs8.com cbs8.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
cedargroveathletics.com cedargroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 58 days
zeelandeastsports.com zeelandeastsports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
celebzz.com celebzz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
zerohedge.com zerohedge.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
centervilleelkathletics.com centervilleelkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
am.com.mx am.com.mx
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB Jul 2019 Jul 2019 One Off
chococrazeb.info chococrazeb.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Sep 2019 59 days
tv.movie tv.movie
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 133 days
chswarriors.org chswarriors.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
connectorb.club connectorb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Dec 2019 64 days
copilul.ro copilul.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
cornersoftheworldb.info cornersoftheworldb.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Sep 2019 59 days
cornersoftheworldd.info cornersoftheworldd.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Sep 2019 One Off
cornersoftheworldl.club cornersoftheworldl.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 55 days
cornersoftheworldm.club cornersoftheworldm.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 55 days
crossbingo.com crossbingo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Sep 2019 131 days
cuddlebuddyk.info cuddlebuddyk.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cwncathletics.org cwncathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Sep 2019 59 days
dailyheym.club dailyheym.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 53 days
dailyhive.com dailyhive.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Feb 2020 Mar 2020 37 days
dchawks.com dchawks.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
derbyathletics.com derbyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Sep 2019 59 days
dictionary.co.il dictionary.co.il
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
diywatchd.club diywatchd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 118 days
dogloversc.club dogloversc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Dec 2019 One Off
elginwildcatathletics.com elginwildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
elyriaathletics.org elyriaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
escondido247.com escondido247.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Dec 2019 201 days
esnoticiamexico.com esnoticiamexico.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
fabulous55.com fabulous55.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Oct 2019 137 days
famefocus.com famefocus.com
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Mar 2020 255 days
fcmustangs.com fcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
feelgoodquotesa.club feelgoodquotesa.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Dec 2019 124 days
fgrirish.com fgrirish.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 49 days
fhsindians.com fhsindians.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
fhswildcats.com fhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
foleyathletics.com foleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
folhabv.com.br folhabv.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Oct 2019 Mar 2020 165 days
fox61.com fox61.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Feb 2020 One Off
fribbla.com fribbla.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Aug 2019 Oct 2019 41 days
furrydeedsm.info furrydeedsm.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Aug 2019 50 days
gainesvilleredelephantathletics.com gainesvilleredelephantathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
ganeshagiantsathletics.com ganeshagiantsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gddhyxj.com gddhyxj.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Feb 2020 Feb 2020 One Off
guyerwildcats.com guyerwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
mhs-mavericks.com mhs-mavericks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
ghsvikings.com ghsvikings.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
girardindians.org girardindians.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
glonstruct.com glonstruct.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Jul 2018 Jul 2018 One Off
glynncountyathletics.com glynncountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
goaustinhighathletics.com goaustinhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
goballardbruins.com goballardbruins.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
gocentennialathletics.com gocentennialathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
goeastmark.com goeastmark.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 60 days
goghsreddevils.com goghsreddevils.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
gohebronathletics.com gohebronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
gohutchathletics.com gohutchathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
gomarshallredhawks.com gomarshallredhawks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
gonmbchiefs.com gonmbchiefs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
gonwtigers.com gonwtigers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
mhsbluedevilnation.com mhsbluedevilnation.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
goramsathletics.com goramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
gorangerathletics.com gorangerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
goscorpionsports.com goscorpionsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
gowildcatsports.com gowildcatsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
grcathletics.com grcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
happymailj.info happymailj.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
happypostd.club happypostd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 65 days
happypostl.club happypostl.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 45 days
happysquirrelf.club happysquirrelf.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Oct 2019 Oct 2019 One Off
hawkathletics.net hawkathletics.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
headstory.com headstory.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Dec 2019 Mar 2020 99 days
hellopuppyh.info hellopuppyh.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hellopuppyp.info hellopuppyp.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hfathletics.com hfathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 61 days
hhspatriots.org hhspatriots.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
hiredtechnology.com hiredtechnology.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Mar 2020 316 days
hitchcockbulldogs.org hitchcockbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
ihavenet.com ihavenet.com
Attribute Value First Detected Last Detected Overlap Duration
UDOG UDOG-1000 Jul 2019 Jul 2019 One Off
ijaen.es ijaen.es
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
independencebluedevils.com independencebluedevils.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
intelliquiz.com intelliquiz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 308 days
ipstatic.net ipstatic.net
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 199 days
iwordfinder.com iwordfinder.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Aug 2019 85 days
jasperathletics.com jasperathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
jeffersonbluejays.com jeffersonbluejays.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
jenisonathletics.com jenisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
joneshighathletics.com joneshighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
kfetele.ro kfetele.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
kgw.com kgw.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
kipptexas-sanantonioathletics.com kipptexas-sanantonioathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
knighthawksathletics.com knighthawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
krem.com krem.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
juguetes.org juguetes.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Dec 2019 Jan 2020 14 days
kearnsathletics.com kearnsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
kens5.com kens5.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Jan 2020 One Off
kleincollinstigers.com kleincollinstigers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
knightnationathletics.com knightnationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
ktvb.com ktvb.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Feb 2020 One Off
lackeyathletics.com lackeyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
lafayettefightingirish.com lafayettefightingirish.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 62 days
lagunahillsathletics.com lagunahillsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
lancasterathletics.com lancasterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
lawndaleathletics.com lawndaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
lecathletics.com lecathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
legendsguru.com legendsguru.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
lewiscountyathletics.com lewiscountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
lhshornets.com lhshornets.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
libertateapentrufemei.ro libertateapentrufemei.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
loogooteeathletics.com loogooteeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
losgatosathletics.com losgatosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
lowellvilleathletics.com lowellvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
lwwathletics.com lwwathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
manchesterdutchmen.com manchesterdutchmen.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
matadornetwork.com matadornetwork.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 45 days
mchiathletics.com mchiathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 62 days
mcmustangs.com mcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
meadeathletics.com meadeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
mohawks4life.com mohawks4life.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
mrhsathletics.com mrhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
mrhsgrizzlies.org mrhsgrizzlies.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 63 days
mthfightingowls.com mthfightingowls.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
munciecentralathletics.com munciecentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
ncacrusaders.org ncacrusaders.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
ndathletics.com ndathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
neopets.com neopets.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jul 2019 Nov 2019 121 days
newspresp.info newspresp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Aug 2019 One Off
newspressn.info newspressn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Aug 2019 51 days
newswest9.com newswest9.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 45 days
nghsbulldogs.com nghsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 63 days
nmhsathletics.com nmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
noveltyo.com noveltyo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jul 2019 44 days
npaaathletics.com npaaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 62 days
npcougars.com npcougars.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Oct 2019 114 days
oberlinathletics.org oberlinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
ohstigers.com ohstigers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
olyathletics.com olyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
onlydogsp.info onlydogsp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Aug 2019 One Off
oronospartans.org oronospartans.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
ovpatriots.com ovpatriots.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 63 days
parentztalk.com parentztalk.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
pcepactivities.com pcepactivities.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
penrevy.com penrevy.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jul 2019 47 days
pikecountyathletics.com pikecountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
puppytownh.info puppytownh.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
puppytownt.info puppytownt.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
purejoye.club purejoye.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 88 days
purejoyg.club purejoyg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 34 days
purejoyk.info purejoyk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Jul 2019 47 days
qocougars.com qocougars.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 63 days
ramsathletics.org ramsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
raysofhopeb.club raysofhopeb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Jan 2020 129 days
raysofhopeh.info raysofhopeh.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 May 2019 One Off
raysofhopei.info raysofhopei.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 May 2019 One Off
raysofhopem.info raysofhopem.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Aug 2019 51 days
raysofhopeo.info raysofhopeo.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Aug 2019 51 days
riverside247.com riverside247.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Nov 2019 163 days
abilenecooperathletics.org abilenecooperathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
rvblazerathletics.com rvblazerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
sandraandwoo.com sandraandwoo.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Nov 2019 65 days
saxonathletics.com saxonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
sclouddownloader.net sclouddownloader.net
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jan 2020 Mar 2020 84 days
sdcavers.com sdcavers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
ahsathletics.com ahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
ahsrocketsports.org ahsrocketsports.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
semesterz.com semesterz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 312 days
sequoyahathletics.com sequoyahathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
seventyfirstathletics.com seventyfirstathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
alohaathletics.org alohaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
seymourathletics.com seymourathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
alcazardesanjuan.com alcazardesanjuan.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
algonabulldogs.org algonabulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
shs-falcons.com shs-falcons.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
shsnolesathletics.com shsnolesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
shswolfpack.com shswolfpack.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
simbaly.com simbaly.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 264 days
slcavaliers.com slcavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
smpanthersports.com smpanthersports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
snifflyl.info snifflyl.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snifflym.info snifflym.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snifflyo.info snifflyo.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snifflyu.info snifflyu.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snugglepupi.info snugglepupi.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
snugglepupt.info snugglepupt.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snugglepupu.info snugglepupu.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
societycaresn.info societycaresn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Sep 2019 53 days
soddydaisyathletics.com soddydaisyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
sopawfect.com sopawfect.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Sep 2019 100 days
sportingz.com sportingz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Nov 2019 164 days
arundelathletics.com arundelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
stcathletics.com stcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
1007sandiego.com 1007sandiego.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Jan 2020 One Off
12newsnow.com 12newsnow.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 45 days
13newsnow.com 13newsnow.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 45 days
swraidersathletics.com swraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
tabooya.com tabooya.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jun 2019 Sep 2019 104 days
tastegapsd.club tastegapsd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 145 days
tcrams.net tcrams.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
techbulldogs.com techbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
telehealthdave.com telehealthdave.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 309 days
theheartydogd.club theheartydogd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 79 days
theheartydogf.club theheartydogf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 79 days
theroyaldogf.club theroyaldogf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 29 days
theyoump3.com theyoump3.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 309 days
timbercreekathletics.com timbercreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
baratacademyathletics.org baratacademyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
tion.ro tion.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 29 days
tippecanoeathletics.com tippecanoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
titansathletics.org titansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
basketball.com basketball.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 175 days
tohsathletics.org tohsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bchsdolphins.com bchsdolphins.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
travelingmom.com travelingmom.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 24 days
tri-centraltrojans.com tri-centraltrojans.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
tri-countyathletics.com tri-countyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
trndhive.com trndhive.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
tscougarssports.com tscougarssports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bexleyathletics.com bexleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bghsathletics.com bghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
urbanahawksathletics.com urbanahawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bishopenglandathletics.com bishopenglandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
valleyviewtigers1.com valleyviewtigers1.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
verdict.ro verdict.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
blythewoodbengals.com blythewoodbengals.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
boardmanathletics.org boardmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
bombeiros24.pt bombeiros24.pt
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 Jul 2019 Jul 2019 One Off
wabashapaches.net wabashapaches.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wcnc.com wcnc.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 74 days
wearebeggs.com wearebeggs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wfmynews2.com wfmynews2.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
whas11.com whas11.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 26 days
brockeaglesathletics.com brockeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
widefieldgladiators.org widefieldgladiators.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
brvathletics.com brvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
btwathletics.com btwathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
buccaneerstrong.com buccaneerstrong.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
wopanthers.com wopanthers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
buttscountyathletics.com buttscountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
cajoncowboyathletics.com cajoncowboyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
calcalist.co.il calcalist.co.il
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 294 days
cavsathletics.com cavsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
cbs19.tv cbs19.tv
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
cfcolts.com cfcolts.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
zygdesigner.com zygdesigner.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
chicksonright.com chicksonright.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Feb 2020 260 days
chococrazeb.xyz chococrazeb.xyz
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 17 days
chsfalconpride.com chsfalconpride.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
chsfalcons.com chsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
chslionsathletics.com chslionsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
cornersoftheworldn.club cornersoftheworldn.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 16 days
covinahighathletics.com covinahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
cuddlebuddyl.info cuddlebuddyl.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cuddlebuddyq.info cuddlebuddyq.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cumhuriyet.com.tr cumhuriyet.com.tr
Attribute Value First Detected Last Detected Overlap Duration
UDOG UDOG-1000 Sep 2019 Sep 2019 One Off
daculaathletics.com daculaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
dadecountyathletics.com dadecountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Sep 2019 59 days
dailyarmy.com dailyarmy.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jun 2019 24 days
dailydisclosure.com dailydisclosure.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 184 days
dailyheyk.club dailyheyk.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 120 days
dailyheyl.club dailyheyl.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 53 days
darklegacycomics.com darklegacycomics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Dec 2019 Dec 2019 One Off
dbhssports.org dbhssports.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
dcbusiness.ro dcbusiness.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 53 days
dcnews.ro dcnews.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 53 days
deeplyfav.com deeplyfav.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
deersy.com deersy.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jun 2019 24 days
denmarkathletics.com denmarkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
dezignshopz.com dezignshopz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jun 2019 25 days
diabloathletics.com diabloathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
diywatchf.club diywatchf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 15 days
dmwolves.com dmwolves.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
dogpawsd.club dogpawsd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 52 days
dvskyhawksathletics.com dvskyhawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
easleyathletics.com easleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
eastviewathletics.com eastviewathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 56 days
ehsathletics.org ehsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
ejeagleathletics.org ejeagleathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
elle.ro elle.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
ennislions.org ennislions.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 109 days
erhsmustangathletics.com erhsmustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 109 days
fcflashes.com fcflashes.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
fliernation.org fliernation.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
flucoathletics.com flucoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
fmhsathletics.com fmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
football.com football.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 134 days
foxcreekathletics.com foxcreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
fsglwkf.cn fsglwkf.cn
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
furrydeedsb.club furrydeedsb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Dec 2019 124 days
furrydeedsn.info furrydeedsn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Aug 2019 One Off
gahannalincolnathletics.com gahannalincolnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
ganxindz.com ganxindz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Aug 2019 Aug 2019 One Off
gbhsathletics.com gbhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gcaathletics.org gcaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
gchsathletics.org gchsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gilbertathletics.org gilbertathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
gingerize.com gingerize.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
globalbusinesschronicle.com globalbusinesschronicle.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Dec 2019 205 days
godwinheightsathletics.com godwinheightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 55 days
gofcswarriors.com gofcswarriors.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 50 days
gosparkplugs.com gosparkplugs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gotfhsbruins.com gotfhsbruins.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
governorpalin.org governorpalin.org
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Dec 2019 Dec 2019 One Off
gowilsonwildcats.com gowilsonwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
grchristianeagles.com grchristianeagles.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
greenbulldogathletics.com greenbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
hannity.com hannity.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Sep 2019 Oct 2019 44 days
happymailk.info happymailk.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
happypostb.xyz happypostb.xyz
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 10 days
happypostf.club happypostf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Mar 2020 174 days
happypostg.club happypostg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 109 days
happypostm.club happypostm.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 109 days
happypostn.club happypostn.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 10 days
happypostq.club happypostq.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 45 days
healthyhogk.info healthyhogk.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hellopuppyg.info hellopuppyg.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hellopuppyi.info hellopuppyi.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hellopuppyl.info hellopuppyl.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hetamsterdamschevoetbal.nl hetamsterdamschevoetbal.nl
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 35 days
hhpboosterclub.com hhpboosterclub.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hidalgopirates.org hidalgopirates.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
hirednurses.com hirednurses.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 109 days
hiringretail.com hiringretail.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 44 days
hmbhsathletics.com hmbhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
hokesbluffathletics.com hokesbluffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
homeremedyshop.com homeremedyshop.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 Jul 2019 Sep 2019 56 days
idabelwarriors.com idabelwarriors.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
ilwarriors.com ilwarriors.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
interpals.net interpals.net
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
ironhorseathletics.net ironhorseathletics.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
itsadogsworldb.club itsadogsworldb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 61 days
jamesclemensathletics.com jamesclemensathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
jeffersonfalconathletics.com jeffersonfalconathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 111 days
rareviral.com rareviral.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Mar 2020 152 days
ratsit.se ratsit.se
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 45 days
raysofhopeg.club raysofhopeg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 33 days
redtri.com redtri.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 24 days
roscoeathletics.com roscoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
royalathletics.net royalathletics.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
roughriderathletics.net roughriderathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
routerloginwifi.com routerloginwifi.com
Attribute Value First Detected Last Detected Overlap Duration
UDOG UDOG-1000 Jul 2019 Jul 2019 One Off
roverathletics.org roverathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
saeasports.org saeasports.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
salamanca24horas.com salamanca24horas.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 313 days
sccsathletics.cc sccsathletics.cc
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
ahduvido.com.br ahduvido.com.br
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 One Off
sharejoyh.club sharejoyh.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 83 days
sharejoyq.club sharejoyq.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 31 days
shskyhawksathletics.com shskyhawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
shpanthernation.com shpanthernation.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
amherststeelecomets.com amherststeelecomets.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
americancolumn.com americancolumn.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 295 days
amar-sangbad.com amar-sangbad.com
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 Jun 2019 Jul 2019 49 days
answertrade.com answertrade.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 128 days
smcathletics.us smcathletics.us
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 53 days
snifflyg.info snifflyg.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
snifflyn.info snifflyn.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snifflyp.info snifflyp.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
smtitansathletics.org smtitansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 53 days
snugglepupk.info snugglepupk.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
snugglepupl.info snugglepupl.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snugglepupo.info snugglepupo.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snowdaycalculator.com snowdaycalculator.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 311 days
sogoodly.com sogoodly.com
Attribute Value First Detected Last Detected Overlap Duration
UDOG UDOG-1000 Sep 2019 Nov 2019 64 days
societycaresd.club societycaresd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 148 days
societycaresf.club societycaresf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 82 days
southernathletics.org southernathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
sparksoflifef.club sparksoflifef.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 147 days
sparksoflifeh.club sparksoflifeh.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 147 days
12news.com 12news.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 68 days
aaskylineathletics.com aaskylineathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
achswolvesathletics.net achswolvesathletics.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
sunloungef.club sunloungef.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Jan 2020 One Off
allaboutjazz.com allaboutjazz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 255 days
svilleathletics.com svilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
apacheathletics.org apacheathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 57 days
atalakers.com atalakers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
tastegapsb.club tastegapsb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Jan 2020 130 days
tastegapsn.info tastegapsn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Sep 2019 One Off
textsfromlastnight.com textsfromlastnight.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
aydengriftonathletics.com aydengriftonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
bahisyap101.com bahisyap101.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 19 days
thv11.com thv11.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 24 days
titanathleticshq.com titanathleticshq.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
tmhswildcatsathletics.com tmhswildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bchstigers.com bchstigers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
toptiz.com toptiz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jan 2020 Mar 2020 78 days
trend-guru.com trend-guru.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jul 2019 48 days
trivia.com trivia.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 175 days
triwestbruins.com triwestbruins.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 55 days
bereanathletics.org bereanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
bessemerathletics.com bessemerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
uasdathletics.com uasdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
binghamathletics.com binghamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bishopcanevinathletics.com bishopcanevinathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
varinaathletics.com varinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Sep 2019 54 days
vcscrusaderathletics.com vcscrusaderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
blscots.org blscots.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
boazathletics.com boazathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bobshideout.com bobshideout.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
bollywoodhungama.com bollywoodhungama.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 24 days
bomcondutor.pt bomcondutor.pt
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Mar 2020 316 days
bonappetity.com bonappetity.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
wearebartlett.com wearebartlett.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
wearemaranatha.com wearemaranatha.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
brcardinals.com brcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
wellness99.com wellness99.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 One Off
wesleychapelathletics.com wesleychapelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
westernpanthersports.com westernpanthersports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
westfieldathletics.com westfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
wghawksactivities.com wghawksactivities.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
whatismyipaddress.com whatismyipaddress.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
wheelerbearcatsathletics.com wheelerbearcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
whsowls.com whsowls.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
btw-athletics.com btw-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
burlesonathletics.com burlesonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
worlderz.com worlderz.com
Attribute Value First Detected Last Detected Overlap Duration
MEME MEME-209 May 2019 Jul 2019 48 days
worthyo.com worthyo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
wrenhurricanesathletics.com wrenhurricanesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
buzzbeagle.com buzzbeagle.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 295 days
byroncentersports.com byroncentersports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
cadetathletics.com cadetathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
wxwildcats.com wxwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
wyomingwolvesathletics.com wyomingwolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 55 days
calcalistech.com calcalistech.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 276 days
carlsbad247.com carlsbad247.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Sep 2019 57 days
yorktownathletics.com yorktownathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
cfallsathletics.org cfallsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
cfhspanthers.com cfhspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
zooflew.com zooflew.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Jun 2019 One Off
chlloe.com chlloe.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 169 days
chocolate.com chocolate.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 199 days
chsathletics.net chsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
cirangers.org cirangers.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
clarencevilleathletics.com clarencevilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
coffmanathletics.net coffmanathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
cornersoftheworldk.club cornersoftheworldk.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 121 days
csturg.is csturg.is
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
cuddlebuddyj.info cuddlebuddyj.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cuddlebuddym.info cuddlebuddym.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cuddlebuddyn.info cuddlebuddyn.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cuddlebuddyo.info cuddlebuddyo.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cuddlebuddyp.info cuddlebuddyp.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cvjags.com cvjags.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
dailyheyf.club dailyheyf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 120 days
dailytreat.net dailytreat.net
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Dec 2019 Mar 2020 104 days
dashamerica.com dashamerica.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 300 days
days.to days.to
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Sep 2019 Mar 2020 168 days
dealerwebb.com dealerwebb.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Feb 2020 Mar 2020 53 days
dha.com.tr dha.com.tr
Attribute Value First Detected Last Detected Overlap Duration
UDOG UDOG-1000 May 2019 Aug 2019 74 days
dilemaveche.ro dilemaveche.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 24 days
diywatchb.club diywatchb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Dec 2019 65 days
diywatche.club diywatche.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 15 days
diywatchn.info diywatchn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Sep 2019 108 days
dreadnaughtathletics.com dreadnaughtathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
eauclaireathletics.org eauclaireathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 59 days
ecaathletics.org ecaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
edgewoodmustangsathletics.com edgewoodmustangsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
ehs-tigers.com ehs-tigers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
emuparadise.me emuparadise.me
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
evansathletics.com evansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
fairbankspanthers.com fairbankspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
fclionathletics.com fclionathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
feelgoodquotesb.club feelgoodquotesb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Oct 2019 Dec 2019 64 days
feelgoodquotesf.club feelgoodquotesf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 114 days
feelgoodquotesk.info feelgoodquotesk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Oct 2019 110 days
fhs-warriors.com fhs-warriors.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
filmibeat.com filmibeat.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 One Off
frequenciesf.club frequenciesf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 113 days
frequenciesg.club frequenciesg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 47 days
furrydeedsf.club furrydeedsf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 112 days
furrydeedsk.info furrydeedsk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Aug 2019 50 days
furrydeedso.info furrydeedso.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Aug 2019 One Off
furrydeedsp.info furrydeedsp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Aug 2019 One Off
gandul.ro gandul.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
ghnorthernoaksathletics.org ghnorthernoaksathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
goaviatorsathletics.com goaviatorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
gocanebayathletics.net gocanebayathletics.net
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
gocentralindians.com gocentralindians.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
gohermleigh.com gohermleigh.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
gohornetsathletics.com gohornetsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
golamarmustangs.com golamarmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 60 days
gomightyarabs.com gomightyarabs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
gopantherathletics.com gopantherathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gorangernation.com gorangernation.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 60 days
goroyalsgo.net goroyalsgo.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
gosachristian.org gosachristian.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
gpucheck.com gpucheck.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Feb 2020 43 days
graduatez.com graduatez.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 305 days
greeningz.com greeningz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 305 days
gustarte.ro gustarte.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 35 days
gvgatorathletics.com gvgatorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 110 days
hancockcountyathletics.com hancockcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
happycandles.com happycandles.com
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
happymailn.info happymailn.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
haraiders.com haraiders.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
hboilersports.com hboilersports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
hcbeavers.org hcbeavers.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hchshornets.com hchshornets.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
healthyhogg.info healthyhogg.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
healthyhogl.info healthyhogl.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hellopuppyj.info hellopuppyj.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hellopuppyo.info hellopuppyo.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hellopuppyq.info hellopuppyq.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
heykentucky.com heykentucky.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
hinkleyathletics.com hinkleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hiringlogistics.com hiringlogistics.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 109 days
hooverhighathletics.com hooverhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 61 days
hudsonvilleathletics.com hudsonvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
huffmanhighschoolathletics.com huffmanhighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
iccpathletics.org iccpathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
idrlabs.com idrlabs.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 61 days
irabulldogs.org irabulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
itsadogsworldk.info itsadogsworldk.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Oct 2019 146 days
jdvolsathletics.com jdvolsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
jgathletics.org jgathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 61 days
jichsathletics.com jichsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 111 days
jwnorthathletics.org jwnorthathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
kalkaskaathletics.com kalkaskaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 112 days
kare11.com kare11.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 69 days
kgun9.com kgun9.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
khou.com khou.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
kiiitv.com kiiitv.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
kvoa.com kvoa.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Nov 2019 Nov 2019 One Off
kwknights.com kwknights.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
lahstoppers.com lahstoppers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
lakenonaathletics.org lakenonaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
lakeontariounited.com lakeontariounited.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Sep 2019 Mar 2020 199 days
lamarcountyathletics.com lamarcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
lccathletics.com lccathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
lebanonathletics.org lebanonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
lebanonwarriorathletics.com lebanonwarriorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
leonslair.com leonslair.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Aug 2019 90 days
lhhighlanderathletics.com lhhighlanderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
lhs-trojans.com lhs-trojans.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 51 days
lickingvalleyathletics.com lickingvalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
lifelooksg.club lifelooksg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 40 days
likesism.com likesism.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 311 days
loanpride.com loanpride.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 271 days
lokmatnews.in lokmatnews.in
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 Dec 2019 Feb 2020 59 days
lovemydogb.club lovemydogb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Dec 2019 126 days
marauderathletics.com marauderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
mchsathletics.com mchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
mckayathletics.com mckayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 62 days
mcmichaelathletics.com mcmichaelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 113 days
mcs-athletics.com mcs-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
medyafaresi.com medyafaresi.com
Attribute Value First Detected Last Detected Overlap Duration
UDOG UDOG-1000 Sep 2019 Mar 2020 199 days
mhspioneers.com mhspioneers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
minecraft24.com minecraft24.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-22430 May 2019 Mar 2020 316 days
mlspartanathletics.org mlspartanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
mmmarauders.com mmmarauders.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
mooseheadstew.com mooseheadstew.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 May 2019 Mar 2020 316 days
mpanthers.com mpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
mqtblazers.com mqtblazers.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
mtcssports.com mtcssports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Aug 2019 51 days
mydailyviral.com mydailyviral.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 314 days
myfavoritecontent.com myfavoritecontent.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Aug 2019 Oct 2019 63 days
myjobhelper-corp.com myjobhelper-corp.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 Mar 2020 316 days
mzamin.com mzamin.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Jun 2019 Mar 2020 303 days
newsd.co newsd.co
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 314 days
nhs-cougars.com nhs-cougars.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
nilesathletics.com nilesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
northwesterntrojans.org northwesterntrojans.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
nutra.blog nutra.blog
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Aug 2019 Mar 2020 218 days
nwmounties.com nwmounties.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
oakridgeathletics.org oakridgeathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
ochsathletics.com ochsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 51 days
ohscardinals.com ohscardinals.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
okmagazine.ro okmagazine.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 35 days
olentangybravesathletics.com olentangybravesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
olentangyorangeathletics.com olentangyorangeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
omahabryanbears.com omahabryanbears.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
onlineweb.tools onlineweb.tools
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Mar 2020 155 days
onlydogsb.club onlydogsb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Dec 2019 128 days
onlydogsg.club onlydogsg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 36 days
paintbranchathletics.org paintbranchathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
pcpatriotsports.com pcpatriotsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 52 days
pelhamhighathletics.com pelhamhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
pendletonathletics.com pendletonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
rimathleticsactivities.com rimathleticsactivities.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
plox.com.br plox.com.br
Attribute Value First Detected Last Detected Overlap Duration
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020 316 days
pomonareddevilathletics.com pomonareddevilathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
pottervilleathletics.com pottervilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
riverforestathletics.com riverforestathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
riverhawkathletics.com riverhawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
ptpanthers.org ptpanthers.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Oct 2019 115 days
pupandhome.com pupandhome.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100541 Aug 2019 Oct 2019 61 days
puppytowni.info puppytowni.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
puppytownm.info puppytownm.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
puppytownn.info puppytownn.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
puppytownu.info puppytownu.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
puppyvilleg.info puppyvilleg.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
puppyvilleh.info puppyvilleh.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
puppyvillei.info puppyvillei.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
puppyvillej.info puppyvillej.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
puppyvillek.info puppyvillek.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
puppyvilleo.info puppyvilleo.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
purejoyb.club purejoyb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Jan 2020 128 days
purejoyh.info purejoyh.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 May 2019 May 2019 One Off
purejoym.info purejoym.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Aug 2019 One Off
ramonaathletics.com ramonaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
riflehighschoolsports.com riflehighschoolsports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Aug 2019 52 days
aromdidi.com aromdidi.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jan 2020 Mar 2020 62 days
sabreathletics.org sabreathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Aug 2019 52 days
addisonathletics.com addisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
afternoonspecial.com afternoonspecial.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
selectclassifieds.com selectclassifieds.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Nov 2019 116 days
ajax1.nl ajax1.nl
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Jan 2020 Mar 2020 64 days
sfhsdonsathletics.com sfhsdonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
sharejoyc.club sharejoyc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Jan 2020 One Off
sharejoyf.club sharejoyf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 149 days
sharejoyg.club sharejoyg.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Mar 2020 149 days
sherwoodathletics.org sherwoodathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
shoeflew.com shoeflew.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
sjajaguars.org sjajaguars.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
skidmore-tynanathletics.com skidmore-tynanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
snifflyj.info snifflyj.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
snifflyt.info snifflyt.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
snugglepupg.info snugglepupg.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
snugglepuph.info snugglepuph.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 May 2019 Jul 2019 47 days
snugglepupp.info snugglepupp.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
societycaresc.club societycaresc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Jan 2020 66 days
sporteluxe.com sporteluxe.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 281 days
sprayberryathletics.com sprayberryathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
springbrookathletics.org springbrookathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
ststephensathletics.org ststephensathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
sublimly.com sublimly.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jan 2020 Mar 2020 80 days
ahscolts.net ahscolts.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
akinseaglessports.com akinseaglessports.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
swimyo.com swimyo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
americanmilitarynews.com americanmilitarynews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Nov 2019 Mar 2020 134 days
takimag.com takimag.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 303 days
tastegapsc.club tastegapsc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Nov 2019 Jan 2020 66 days
tastegapsf.club tastegapsf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 79 days
tastegapspp.info tastegapspp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Sep 2019 53 days
tcnathletics.com tcnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
avhshawkathletics.com avhshawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
theheartydogb.club theheartydogb.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Sep 2019 Jan 2020 129 days
tikaneyat.com tikaneyat.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 May 2019 One Off
timberlandathletics.com timberlandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
timezoff.com timezoff.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Nov 2019 Mar 2020 144 days
tkathletics.com tkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
tosaeastathletics.com tosaeastathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
twinpeakscharteracademyathletics.com twinpeakscharteracademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
uchsathletics.com uchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
bethcenterbulldogs.com bethcenterbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
uhsathletics.org uhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
bhpbears.com bhpbears.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
bhsathletics.org bhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
bhsbulldogs.com bhsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
upperstclairathletics.com upperstclairathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
upvideo.pt upvideo.pt
Attribute Value First Detected Last Detected Overlap Duration
SMAD SMAD-3198 May 2019 Mar 2020 307 days
upworthy.com upworthy.com
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Mar 2020 255 days
vahsathletics.com vahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
viewpure.com viewpure.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jul 2019 Mar 2020 255 days
viralwalrus.com viralwalrus.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 306 days
bogalusalumberjacks.org bogalusalumberjacks.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
washingtonexaminer.com washingtonexaminer.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 279 days
wdathletics.com wdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
waverlywarriorsathletics.com waverlywarriorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wearecamdenhs.com wearecamdenhs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
weboathletics.com weboathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bozoba.de bozoba.de
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Mar 2020 Mar 2020 One Off
bradleyathletics.org bradleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
wheatonknights.com wheatonknights.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
bssjaguars.com bssjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wltx.com wltx.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 24 days
wmtornadoes.com wmtornadoes.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
buckeyevalleyathletics.com buckeyevalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
bulldogsathletics.com bulldogsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
wqad.com wqad.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 One Off
canoodlesoup.com canoodlesoup.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 279 days
capacathletics.com capacathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
yidio.com yidio.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 304 days
ccc11.shop ccc11.shop
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 277 days
ncraiders.com ncraiders.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
chscougarathletics.com chscougarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Sep 2019 Sep 2019 One Off
churchillathletics.com churchillathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
clackamasathletics.com clackamasathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
clickpentrufemei.ro clickpentrufemei.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 38 days
clickpoftabuna.ro clickpoftabuna.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 38 days
cmhornets.net cmhornets.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
collegefreakz.com collegefreakz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
concordhsathletics.com concordhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
coolimba.com coolimba.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Jun 2019 Mar 2020 277 days
coolstoryz.com coolstoryz.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 39 days
copleyathletics.org copleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
cornersoftheworldb.xyz cornersoftheworldb.xyz
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 16 days
cpgophers.com cpgophers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
cuddlebuddyi.info cuddlebuddyi.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
cuyhtsathletics.com cuyhtsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
cvhsgrizzlies.net cvhsgrizzlies.net
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
dailyheyb.xyz dailyheyb.xyz
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Mar 2020 Mar 2020 16 days
dailyheyc.info dailyheyc.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Sep 2019 59 days
dailyheyn.club dailyheyn.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 53 days
daowl.com daowl.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jun 2019 24 days
dcmedical.ro dcmedical.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 53 days
designf4.com designf4.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Dec 2019 197 days
designyoo.com designyoo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jun 2019 25 days
dezignerzyo.com dezignerzyo.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jun 2019 25 days
nctsharknation.com nctsharknation.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
diywatchc.club diywatchc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Dec 2019 One Off
dockathletics.org dockathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
dogloversf.club dogloversf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 52 days
drhsjaguars.com drhsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
dublinathletics.org dublinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
dutchtownathletics.com dutchtownathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 49 days
ectrojansathletics.com ectrojansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 109 days
edgewaterathletics.com edgewaterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
educacion2.com educacion2.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Jan 2020 151 days
eelsathletics.com eelsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
einsteinathletics.org einsteinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
elmatero.net elmatero.net
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Oct 2019 Oct 2019 One Off
elranchodons.com elranchodons.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 59 days
engineere.com engineere.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-5579869737189846 Aug 2018 Aug 2018 One Off
fentonathletics.org fentonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
fightingeaglesports.org fightingeaglesports.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 59 days
fikeathletics.com fikeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
filerathletics.com filerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
fleischtheke.info fleischtheke.info
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Feb 2020 Mar 2020 47 days
frequenciesn.info frequenciesn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 60 days
frequenciesp.info frequenciesp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 60 days
fullydelicious.com fullydelicious.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 Mar 2020 Mar 2020 One Off
funbrk.com funbrk.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 304 days
furrydeedsc.club furrydeedsc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Dec 2019 One Off
furrydeedsd.club furrydeedsd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 112 days
gadsdencityathletics.com gadsdencityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 59 days
gagwoop.com gagwoop.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
garawayathletics.com garawayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Oct 2019 110 days
gcshawks.com gcshawks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
gizbot.com gizbot.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-10513 Mar 2020 Mar 2020 24 days
goadamscentralathletics.com goadamscentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
goaledobearcats.com goaledobearcats.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
goclspartans.org goclspartans.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
goeasterneagles.org goeasterneagles.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
gohammondathletics.com gohammondathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Aug 2019 50 days
gohhshurricanes.com gohhshurricanes.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
gokennedycavs.com gokennedycavs.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gomaroonsathletics.com gomaroonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
gonorthridgevikings.com gonorthridgevikings.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
goriversideathletics.com goriversideathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 60 days
goscarboroughspartans.com goscarboroughspartans.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
govikingsathletics.com govikingsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
greatlakesfisherman.com greatlakesfisherman.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-184282 Mar 2020 Mar 2020 One Off
gwcarversports.com gwcarversports.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
haftrhawks.com haftrhawks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
happymailh.info happymailh.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
happymailq.info happymailq.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
headlineleak.com headlineleak.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
healthyhogi.info healthyhogi.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
healthyhogp.info healthyhogp.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hellopuppyk.info hellopuppyk.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Jun 2019 One Off
hhcardinals.com hhcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
hhcomets.com hhcomets.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
hilandathletics.com hilandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
homeepiphany.com homeepiphany.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
hopkinsathletics.com hopkinsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
houndnation1.com houndnation1.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
hseroyalsathletics.com hseroyalsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 111 days
incomeworth.com incomeworth.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 43 days
itsadogsworldc.club itsadogsworldc.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Dec 2019 One Off
itsadogsworldd.club itsadogsworldd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 105 days
itsadogsworldf.club itsadogsworldf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Dec 2019 Mar 2020 105 days
itsadogsworldp.info itsadogsworldp.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Oct 2019 61 days
jcpatriotsathletics.com jcpatriotsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
joshuaathletics.com joshuaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Aug 2019 51 days
jyghxsm.com jyghxsm.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Dec 2019 176 days
kcentv.com kcentv.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 34 days
keenanraiders.com keenanraiders.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
kffirebirds.com kffirebirds.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Oct 2019 112 days
king5.com king5.com
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Feb 2020 Mar 2020 35 days
kmlchargers.com kmlchargers.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
knightspride.com knightspride.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Oct 2019 62 days
ndhsrebels.com ndhsrebels.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
lapelathletics.com lapelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
lfclive.net lfclive.net
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 5 days
lfg.co lfg.co
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Dec 2019 64 days
lfgcomic.com lfgcomic.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jan 2020 Jan 2020 One Off
lgyw582.cn lgyw582.cn
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Mar 2020 Mar 2020 One Off
lifelooksd.club lifelooksd.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 40 days
lifequotesn.info lifequotesn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jun 2019 Aug 2019 51 days
lobonation.com lobonation.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
logancountyathletics.com logancountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jun 2019 Jun 2019 One Off
logangrizzlies.org logangrizzlies.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
logicimmonieuwbouw.be logicimmonieuwbouw.be
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Feb 2020 Mar 2020 35 days
lqathletics.com lqathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jun 2019 Jun 2019 One Off
mcdonoughathletics.com mcdonoughathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
meaww.com meaww.com
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jun 2019 Mar 2020 271 days
moonareaathletics.com moonareaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
mshstrojanathletics.com mshstrojanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
muathletics.com muathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
mvmavericks.com mvmavericks.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
myjobhelper.com myjobhelper.com
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jul 2019 Mar 2020 255 days
nelsoncountycardinals.com nelsoncountycardinals.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
newspresf.club newspresf.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Feb 2020 Mar 2020 37 days
nphswolfpackathletics.com nphswolfpackathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
nutleyathletics.org nutleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
odemowlathletics.com odemowlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
ohspiratesathletics.com ohspiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Aug 2019 One Off
olentangylibertyathletics.com olentangylibertyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
omahanorthvikings.com omahanorthvikings.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
omahanorthwesthuskies.com omahanorthwesthuskies.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Oct 2019 Oct 2019 One Off
osseo-orioles.com osseo-orioles.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Sep 2019 Sep 2019 One Off
parentmap.com parentmap.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Nov 2019 121 days
pchsathletics.com pchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Aug 2019 52 days
pebblebrookathletics.com pebblebrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Oct 2019 Oct 2019 One Off
penguinmd.com penguinmd.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020 316 days
pikecentralathletics.com pikecentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
pikeroadathletics.org pikeroadathletics.org
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
pinckneypiratesathletics.com pinckneypiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Jul 2019 Jul 2019 One Off
plattepirates.org plattepirates.org
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Sep 2019 55 days
pleasantonathletics.com pleasantonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Aug 2019 Oct 2019 63 days
pottershousepumas.com pottershousepumas.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Aug 2019 51 days
prhslions.com prhslions.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
promotor.ro promotor.ro
Attribute Value First Detected Last Detected Overlap Duration
CTX CTX-562165 Mar 2020 Mar 2020 24 days
pruebavelocidad.com pruebavelocidad.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Feb 2020 Mar 2020 34 days
psychicmonday.com psychicmonday.com
Attribute Value First Detected Last Detected Overlap Duration
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Jul 2019 47 days
puppyvilleq.info puppyvilleq.info
Attribute Value First Detected Last Detected Overlap Duration
LOCK LOCK-10852900247427328 Jul 2019 Jul 2019 One Off
purejoyn.info purejoyn.info
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Aug 2019 Aug 2019 One Off
pvhsathletics.com pvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
rattlernationathletics.com rattlernationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
SVRN SVRN-236947 Aug 2019 Aug 2019 One Off
raysofhopef.club raysofhopef.club
Attribute Value First Detected Last Detected Overlap Duration
CONV CONV-40802 Jan 2020 Mar 2020 87 days
redanhighathletics.com redanhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
LIJI LIJI-236947 Jul 2019 Jul 2019 One Off
PHOTLO.COM
Non IP Attributes
Attribute First Last
UA UA-113139964 Feb 2018 Aug 2020
AT AT-RA-5A6CE3385669D3E6 Mar 2018 Jan 2020
CA CA-PUB-5579869737189846 Jul 2018 Mar 2020
TB TB-1156606 Aug 2018 Mar 2020
PRIM PRIM-22430 May 2019 Mar 2020
LIJI LIJI-236947 May 2019 Mar 2020
MEME MEME-209 May 2019 Mar 2020
CONV CONV-40802 May 2019 Mar 2020
IEX IEX-184282 May 2019 Mar 2020
ADYO ADYO-E4D009CCE34EDC4084A807869EC78E32 May 2019 Mar 2020
YIMO YIMO-1823148729717916915 May 2019 Mar 2020
BIDF BIDF-88B55B49-98F5-42E5-AC43-22CFF79711A4 May 2019 Mar 2020
UDOG UDOG-1000 May 2019 Mar 2020
SMAD SMAD-3198 May 2019 Mar 2020
SHAR SHAR-AF3BDE15 May 2019 Mar 2020
LOCK LOCK-10852900247427328 May 2019 Mar 2020
RTB RTB-3I1LYLGQH8EQE6N8GJZB May 2019 Mar 2020
VIDA VIDA-5181618553 May 2019 Mar 2020
IMON IMON-2287 May 2019 Feb 2020
MEDI MEDI-8CUKXS6PK Jul 2019 Mar 2020
TEAD TEAD-16795 Jul 2019 Mar 2020
SVRN SVRN-236947 May 2019 Jan 2020
MEDI MEDI-8CU8J33QS May 2019 Jan 2020
AOL AOL-10513 Aug 2019 Mar 2020
CTX CTX-562165 Jan 2020 Mar 2020
DM DM-100541 Aug 2019 Oct 2019
OL OL-2859-424-10-6714 Jul 2018 Sep 2018
AT AT-ra-5a6ce3385669d3e6 Aug 2020 Aug 2020
PHOTLO.COM
Overlap Attribute Domains
photlo.com photlo.com
foodbevg.com foodbevg.com
taxyc.com taxyc.com
voofla.com voofla.com
hwshopper.com hwshopper.com
cleanyx.com cleanyx.com
zupermar.com zupermar.com
gleauty.com gleauty.com
glusiness.com glusiness.com
govserv.org govserv.org
localgymsandfitness.com localgymsandfitness.com
globalnpo.org globalnpo.org
accoua.com accoua.com
bakerias.com bakerias.com
yasteq.com yasteq.com
foodyas.com foodyas.com
glecruit.com glecruit.com
globuya.com globuya.com
juridipedia.com juridipedia.com
medioq.com medioq.com
gemlis.com gemlis.com
glclubs.com glclubs.com
ile-wiesz.pl ile-wiesz.pl
tudosobretdah.com.br tudosobretdah.com.br
glunis.com glunis.com
gluseum.com gluseum.com
lexulous.com lexulous.com
masoncontractors.org masoncontractors.org
updato.com updato.com
anagrammer.com anagrammer.com
wtffunfact.com wtffunfact.com
cleantechnica.com cleantechnica.com
dicascaseiras.net dicascaseiras.net
fishlore.com fishlore.com
cedec.com.br cedec.com.br
ecycle.com.br ecycle.com.br
epic7x.com epic7x.com
hipercurioso.co hipercurioso.co
bramj4u.com bramj4u.com
live-tennis.eu live-tennis.eu
babynames.co.uk babynames.co.uk
findany.biz findany.biz
pay-box.in pay-box.in
skyscraperpage.com skyscraperpage.com
dicio.com.br dicio.com.br
licoesdefe.com.br licoesdefe.com.br
unum.com.br unum.com.br
vagasucesso.com vagasucesso.com
ytdb.co ytdb.co
jogalo.com jogalo.com
this-quiz.com this-quiz.com
financiamentoecredito.com financiamentoecredito.com
jamaicaobserver.com jamaicaobserver.com
jobsbotswana.info jobsbotswana.info
joinfo.ua joinfo.ua
jrfinancas.com jrfinancas.com
sizzlepixs.com sizzlepixs.com
financescredit.com financescredit.com
mundokpmg.com.br mundokpmg.com.br
ourbitcoinnews.com ourbitcoinnews.com
lidaho.com lidaho.com
oseriador.com.br oseriador.com.br
soebola.com soebola.com
utua.com.br utua.com.br
financiamentocredito.com financiamentocredito.com
suvsite.net suvsite.net
viraliq.com viraliq.com
financeiroconsulte.com financeiroconsulte.com
guiamexico.mx guiamexico.mx
buhamster.com buhamster.com
daily-story.com daily-story.com
librodeisogni.net librodeisogni.net
fustany.com fustany.com
revolvy.com revolvy.com
rtvonline.com rtvonline.com
msry.org msry.org
phertiiparta.ml phertiiparta.ml
freereg.org.uk freereg.org.uk
freebmd.org.uk freebmd.org.uk
insidelacrosse.com insidelacrosse.com
dkpittsburghsports.com dkpittsburghsports.com
ebulicao.news ebulicao.news
mymeditravel.com mymeditravel.com
smallbizdaily.com smallbizdaily.com
flyheight.com flyheight.com
velvetmag.it velvetmag.it
dainikamadershomoy.com dainikamadershomoy.com
velvetgossip.it velvetgossip.it
goodreturns.in goodreturns.in
mykhel.com mykhel.com
dailyconservative.com dailyconservative.com
filehippo.com filehippo.com
wuxiaworld.com wuxiaworld.com
usingenglish.com usingenglish.com
foiatualizado.com foiatualizado.com
apost.com apost.com
thehimalayantimes.com thehimalayantimes.com
drivespark.com drivespark.com
whynews.com whynews.com
wordfind.com wordfind.com
meatualizei.com meatualizei.com
educationrjb.com educationrjb.com
audiogon.com audiogon.com
bibliacatolica.com.br bibliacatolica.com.br
boredpanda.com boredpanda.com
dicionariobiblico.com.br dicionariobiblico.com.br
dramabeans.com dramabeans.com
scrabblewordfinder.org scrabblewordfinder.org
bibbiacattolica.com bibbiacattolica.com
bibliacatolica.es bibliacatolica.es
investorvillage.com investorvillage.com
panlasangpinoy.com panlasangpinoy.com
rolloid.net rolloid.net
anandabazar.com anandabazar.com
nativeplanet.com nativeplanet.com
ajel.dev ajel.dev
sharejoyb.club sharejoyb.club
biblecatholique.org biblecatholique.org
wwfoldschool.com wwfoldschool.com
destinationtips.com destinationtips.com
bhaz.com.br bhaz.com.br
free-power-point-templates.com free-power-point-templates.com
freebies.com freebies.com
ajel.sa ajel.sa
crichq.com crichq.com
homemadetools.net homemadetools.net
jcnet.com.br jcnet.com.br
kwongwah.com.my kwongwah.com.my
minilua.com minilua.com
pnrstatusbuzz.in pnrstatusbuzz.in
notimexpr.com notimexpr.com
pravda-tv.com pravda-tv.com
pravda-tv.de pravda-tv.de
roloteca.com roloteca.com
allafrica.com allafrica.com
siasat.pk siasat.pk
stage-crichq.com stage-crichq.com
basketball-addict.com basketball-addict.com
bridoz.com bridoz.com
wmlcloud.com wmlcloud.com
calcio-addict.com calcio-addict.com
chococrazeo.club chococrazeo.club
cltampa.com cltampa.com
consumercomplaints.in consumercomplaints.in
cowfunz.com cowfunz.com
crowdstorm.co.uk crowdstorm.co.uk
dailysquib.co.uk dailysquib.co.uk
designsponge.com designsponge.com
fetees.com fetees.com
feuerschalen-online.com feuerschalen-online.com
fruchtkorb.info fruchtkorb.info
gadgethim.com gadgethim.com
gospelprime.com.br gospelprime.com.br
happypostb.club happypostb.club
istgesund.net istgesund.net
laguiadelsur.es laguiadelsur.es
laprensa.com.ni laprensa.com.ni
mathrubhumi.com mathrubhumi.com
mdundo.com mdundo.com
orlandoweekly.com orlandoweekly.com
purejoyd.club purejoyd.club
reshish.com reshish.com
riverfronttimes.com riverfronttimes.com
tennis-addict.net tennis-addict.net
bdjobs.com bdjobs.com
transplo.com transplo.com
viralized.com viralized.com
bmw2002faq.com bmw2002faq.com
clevescene.com clevescene.com
complaintsboard.com complaintsboard.com
dogpawsg.club dogpawsg.club
dosmiechu.com dosmiechu.com
doyouremember.com doyouremember.com
ebonus.gg ebonus.gg
eightieskids.com eightieskids.com
esnoticiaveracruz.com esnoticiaveracruz.com
esports-addict.com esports-addict.com
fallbrook247.com fallbrook247.com
futbol-addict.com futbol-addict.com
futebol-addict.com futebol-addict.com
gadgether.com gadgether.com
gemuesekorb.info gemuesekorb.info
girlstalkinsmack.com girlstalkinsmack.com
igranada.es igranada.es
sacurrent.com sacurrent.com
sciencebuddies.org sciencebuddies.org
sclouddownloader.com sclouddownloader.com
walyou.com walyou.com
watchmecraft.com watchmecraft.com
broadwayworld.com broadwayworld.com
buzzbuzzhome.com buzzbuzzhome.com
defatoonline.com.br defatoonline.com.br
dogloversd.club dogloversd.club
ebela.in ebela.in
finduslocal.com finduslocal.com
happypostk.club happypostk.club
lucianne.com lucianne.com
metrotimes.com metrotimes.com
onlydogsf.club onlydogsf.club
outinstl.com outinstl.com
pravda-tv.net pravda-tv.net
ptebooks.com ptebooks.com
rensongbj.com rensongbj.com
al3abar.com al3abar.com
sportige.com sportige.com
supercook.com supercook.com
techshout.com techshout.com
thaismf.com thaismf.com
tiny.cc tiny.cc
buzzdrives.com buzzdrives.com
canadianlisted.com canadianlisted.com
checkoutspy.com checkoutspy.com
citybeat.com citybeat.com
djremixalbums.com djremixalbums.com
dogpawsf.club dogpawsf.club
drrtyr.mx drrtyr.mx
edmontongazette.com edmontongazette.com
gospelmais.com.br gospelmais.com.br
guyhut.com guyhut.com
irchk.com irchk.com
netdania.com netdania.com
olharcurioso.net olharcurioso.net
leasticoulddo.com leasticoulddo.com
lghsathletics.com lghsathletics.com
lifelooksb.club lifelooksb.club
lifelooksf.club lifelooksf.club
lifelooksp.info lifelooksp.info
lifequotesm.info lifequotesm.info
logic-immo-nieuwbouw.be logic-immo-nieuwbouw.be
lovemydogk.info lovemydogk.info
maraudersathletics.com maraudersathletics.com
mcamustangsathletics.org mcamustangsathletics.org
memorialhsathletics.com memorialhsathletics.com
mountainhouseathletics.com mountainhouseathletics.com
mundijuegosweb.com mundijuegosweb.com
musketeersathletics.com musketeersathletics.com
mwhswildcats.com mwhswildcats.com
nchsathletics.com nchsathletics.com
newspresb.club newspresb.club
nlaeagles.org nlaeagles.org
oakmountainathletics.org oakmountainathletics.org
onlydogsd.club onlydogsd.club
ooltewahathletics.com ooltewahathletics.com
oremhighathletics.com oremhighathletics.com
owlsathletics.org owlsathletics.org
pennysaverusa.com pennysaverusa.com
philnews.ph philnews.ph
phoronix.com phoronix.com
phswarriors.com phswarriors.com
purejoyf.club purejoyf.club
purejoyo.info purejoyo.info
purejoyp.info purejoyp.info
questionablecontent.net questionablecontent.net
redbankathletics.com redbankathletics.com
ritenourathletics.com ritenourathletics.com
riverbluffathletics.com riverbluffathletics.com
rugby-addict.com rugby-addict.com
russellvilleathletics.com russellvilleathletics.com
samakal.com samakal.com
aggiustatutto.it aggiustatutto.it
aikenstandard.com aikenstandard.com
seatexpert.com seatexpert.com
sharejoyb.info sharejoyb.info
sharejoyd.info sharejoyd.info
slidehunter.com slidehunter.com
sunloungeh.club sunloungeh.club
telemundocc.com telemundocc.com
theroyaldogk.info theroyaldogk.info
torah.org torah.org
beautynailhairsalons.com beautynailhairsalons.com
travelagenciesfinder.com travelagenciesfinder.com
trophymanager.com trophymanager.com
bibleapps.com bibleapps.com
uprepathletics.net uprepathletics.net
biology-online.org biology-online.org
verip.es verip.es
viralsharebee.com viralsharebee.com
visualswithmicroscopeg.club visualswithmicroscopeg.club
vrwolvesathletics.com vrwolvesathletics.com
waldronathletics.com waldronathletics.com
wandr.me wandr.me
wcpo.com wcpo.com
btolat.com btolat.com
worldpopulationreview.com worldpopulationreview.com
cajathletics.com cajathletics.com
xdatalife.com xdatalife.com
canyonathletics.org canyonathletics.org
zacks.com zacks.com
chococrazem.club chococrazem.club
chscoyotes.org chscoyotes.org
ciceroprepathletics.com ciceroprepathletics.com
cornersoftheworldb.club cornersoftheworldb.club
cornersoftheworldd.club cornersoftheworldd.club
cross-currents.com cross-currents.com
crriverhawks.com crriverhawks.com
dailyheyd.club dailyheyd.club
dailyheyp.club dailyheyp.club
decoracion2.com decoracion2.com
difundir.org difundir.org
diywatcho.info diywatcho.info
dogloversp.info dogloversp.info
dogpawsp.info dogpawsp.info
dolartoday.org dolartoday.org
dpsdunbarathletics.com dpsdunbarathletics.com
dukkahrestaurant.com dukkahrestaurant.com
dulcenavidad.com dulcenavidad.com
ecvbraves.com ecvbraves.com
egotastic.com egotastic.com
ehhsathletics.com ehhsathletics.com
elgrifoinformacion.com elgrifoinformacion.com
eltoroathletics.com eltoroathletics.com
emeraldathletics.com emeraldathletics.com
evansvilleharrisonathletics.com evansvilleharrisonathletics.com
eveningclassifieds.com eveningclassifieds.com
eventyas.com eventyas.com
fashyas.com fashyas.com
fearthestingihs.org fearthestingihs.org
feelgoodquotesm.info feelgoodquotesm.info
feelgoodquotesn.info feelgoodquotesn.info
feelgoodquotesp.info feelgoodquotesp.info
finehomebuilding.com finehomebuilding.com
frequenciesb.club frequenciesb.club
gaylordathletics.com gaylordathletics.com
ghathletics.org ghathletics.org
gjhssports.com gjhssports.com
glartent.com glartent.com
glencoeathletics.com glencoeathletics.com
gocometsathletics.com gocometsathletics.com
goheightsbulldogs.com goheightsbulldogs.com
golancerssports.com golancerssports.com
gomilbybuffs.com gomilbybuffs.com
goodmenproject.com goodmenproject.com
gopatriotpride.com gopatriotpride.com
goschscougars.com goschscougars.com
goshermanbearcats.com goshermanbearcats.com
gouctigers.com gouctigers.com
happypostc.info happypostc.info
heraldathletics.com heraldathletics.com
hillsboroathletics.org hillsboroathletics.org
jrhsathletics.com jrhsathletics.com
hurontigerathletics.com hurontigerathletics.com
hvlathletics.com hvlathletics.com
idahosports.com idahosports.com
ipcalc.info ipcalc.info
islanderathletics.com islanderathletics.com
jewishworldreview.com jewishworldreview.com
johnmarshallathletics.com johnmarshallathletics.com
jourdantonathletics.com jourdantonathletics.com
journalscene.com journalscene.com
juegosweb.com juegosweb.com
kearnykomets.com kearnykomets.com
kingstreenews.com kingstreenews.com
kmmountaineers.com kmmountaineers.com
knightsathletics.net knightsathletics.net
kar-z.com kar-z.com
kbzk.com kbzk.com
kellathletics.org kellathletics.org
kempnerathletics.com kempnerathletics.com
khurram.life khurram.life
kpax.com kpax.com
krtv.com krtv.com
ksby.com ksby.com
ktvq.com ktvq.com
kxlf.com kxlf.com
lex18.com lex18.com
lifelooksm.info lifelooksm.info
lincolnprepathletics.org lincolnprepathletics.org
localprayers.com localprayers.com
logic-immo-neuf.be logic-immo-neuf.be
logic-immo.be logic-immo.be
lovemydogm.info lovemydogm.info
lowcountryautomotive.com lowcountryautomotive.com
madvix.com madvix.com
mavpride.com mavpride.com
meteo.es meteo.es
mmostart-game.info mmostart-game.info
moultrienews.com moultrienews.com
nataliasports.net nataliasports.net
navidad.es navidad.es
ndaeagles.org ndaeagles.org
newspresd.club newspresd.club
npcmustangs.com npcmustangs.com
nswildcats.com nswildcats.com
oconnellathletics.com oconnellathletics.com
okbridaldress.com okbridaldress.com
olentangyberlinathletics.com olentangyberlinathletics.com
onlydogsc.club onlydogsc.club
pceagles.com pceagles.com
phhsbigreds.com phhsbigreds.com
psprices.com psprices.com
ramonahighathletics.com ramonahighathletics.com
ravensathletics.com ravensathletics.com
rhymes-with-witch.com rhymes-with-witch.com
advantage-job-find.com advantage-job-find.com
saucyrecipes.com saucyrecipes.com
scbuffalostrong.com scbuffalostrong.com
schoolandcollegelistings.com schoolandcollegelistings.com
ahsindians.com ahsindians.com
softschools.com softschools.com
sotecnologia.com sotecnologia.com
supootsuraifu.jp supootsuraifu.jp
tastegapsm.info tastegapsm.info
autismdailynewscast.com autismdailynewscast.com
theminorityreportblog.com theminorityreportblog.com
thomasdaleathletics.com thomasdaleathletics.com
behindwoods.com behindwoods.com
truckerscafefood4soul.org truckerscafefood4soul.org
biblescan.com biblescan.com
biblez.com biblez.com
untappedcities.com untappedcities.com
bitadir.com bitadir.com
blackfilm.com blackfilm.com
virtualjerusalem.com virtualjerusalem.com
bne.com.br bne.com.br
wchseagles.com wchseagles.com
boxingnewsnow.com boxingnewsnow.com
broadneckathletics.org broadneckathletics.org
whoabella.com whoabella.com
wildammo.com wildammo.com
buffalocars.com buffalocars.com
buscacepapp.com buscacepapp.com
buscadorgratis.com buscadorgratis.com
zeelandwestsports.com zeelandwestsports.com
chococrazeb.club chococrazeb.club
cornersoftheworldh.club cornersoftheworldh.club
coventryathletics.org coventryathletics.org
craftstylish.com craftstylish.com
csskodiaks.com csskodiaks.com
dailyheyg.club dailyheyg.club
dhnet.be dhnet.be
dhshsathletics.com dhshsathletics.com
dirrtyremix.es dirrtyremix.es
diywatcha.club diywatcha.club
diywatchm.info diywatchm.info
dnsbl.info dnsbl.info
dogloversb.club dogloversb.club
dogloversk.info dogloversk.info
dogpawsk.info dogpawsk.info
dolartoday.info dolartoday.info
dolartoday.tv dolartoday.tv
dolartuday.net dolartuday.net
dolartuday.org dolartuday.org
dowathletics.com dowathletics.com
dpsbelmontathletics.com dpsbelmontathletics.com
dubistfit.de dubistfit.de
elkgroveford.com elkgroveford.com
elmonteathletics.com elmonteathletics.com
ensurenews.com ensurenews.com
estasdemoda.com estasdemoda.com
feelgoodquoteso.info feelgoodquoteso.info
freebeacon.com freebeacon.com
fullertonindiansathletics.com fullertonindiansathletics.com
funkklingeln.com funkklingeln.com
funstoryz.com funstoryz.com
fussball-addict.com fussball-addict.com
gahrgladiators.com gahrgladiators.com
gamesbarq.com gamesbarq.com
glendoraathletics.com glendoraathletics.com
gobluedevilsports.com gobluedevilsports.com
gocomets.net gocomets.net
gocrusadersathletics.com gocrusadersathletics.com
goeatoneagles.com goeatoneagles.com
gonwpanthers.com gonwpanthers.com
gorattlernation.com gorattlernation.com
gotaftathletics.com gotaftathletics.com
gphswildcats.com gphswildcats.com
gthstitanathletics.com gthstitanathletics.com
hhshoyasports.com hhshoyasports.com
hillel.org hillel.org
hogeyesports.net hogeyesports.net
iangavet.com iangavet.com
improuse.com improuse.com
interhelp.org interhelp.org
janglo.net janglo.net
jazzycash.com jazzycash.com
jcpantherathletics.org jcpantherathletics.org
jeffathletics.com jeffathletics.com
redarrowathletics.com redarrowathletics.com
roughridersports.net roughridersports.net
cchsathletics.org cchsathletics.org
rugbyleaguenews.org rugbyleaguenews.org
schooltube.com schooltube.com
aikenaugustaauto.com aikenaugustaauto.com
sehablaespanolnews.com sehablaespanolnews.com
sgvikings.com sgvikings.com
allpoetry.com allpoetry.com
shsjaguars.com shsjaguars.com
amor.net amor.net
smyrnahighathletics.com smyrnahighathletics.com
societycaresb.club societycaresb.club
socscistatistics.com socscistatistics.com
apocrypha.org apocrypha.org
sunsigns.org sunsigns.org
swmavs.com swmavs.com
astrologycircle.com astrologycircle.com
tcwestathletics.org tcwestathletics.org
telegraphindia.com telegraphindia.com
theheartydogk.info theheartydogk.info
theroyaldogb.club theroyaldogb.club
festusathletics.com festusathletics.com
tippecanoevalleyathletics.com tippecanoevalleyathletics.com
tooeleathletics.org tooeleathletics.org
tornadoathletics.org tornadoathletics.org
turbochristmas.com turbochristmas.com
twistity.com twistity.com
uglyeaglesathletics.com uglyeaglesathletics.com
unycas.com unycas.com
vegetablegardener.com vegetablegardener.com
vimeo.com vimeo.com
voyageavance.global voyageavance.global
vrnerds.de vrnerds.de
wanghong69.com wanghong69.com
waylandunionwildcats.com waylandunionwildcats.com
wenonahdragonathletics.com wenonahdragonathletics.com
weregeek.com weregeek.com
wfchuangyou.com wfchuangyou.com
btolat.net btolat.net
btolat.news btolat.news
wodwell.com wodwell.com
wpspanthers.com wpspanthers.com
camelcamelcamel.com camelcamelcamel.com
carbontv.com carbontv.com
reshish.ru reshish.ru
chhsathletics.com chhsathletics.com
chococrazek.club chococrazek.club
chscolts.org chscolts.org
hawkeyesathletics.com hawkeyesathletics.com
cincytacoweek.com cincytacoweek.com
clutchcity.net clutchcity.net
clutchfans.net clutchfans.net
coogs4life.net coogs4life.net
cookingdonelight.com cookingdonelight.com
covenantathletics.org covenantathletics.org
cuddlebuda.club cuddlebuda.club
curapelanatureza.com.br curapelanatureza.com.br
cursosedu.com cursosedu.com
cvilleathletics.com cvilleathletics.com
dailyheyc.club dailyheyc.club
dhsvikingsports.com dhsvikingsports.com
dixonramsathletics.com dixonramsathletics.com
diywatchp.info diywatchp.info
dogloversm.info dogloversm.info
dogloversn.info dogloversn.info
dogloverso.info dogloverso.info
dogpawsb.club dogpawsb.club
dogpawsm.info dogpawsm.info
dogpawsn.info dogpawsn.info
dolartuday.co dolartuday.co
dovikingsathletics.com dovikingsathletics.com
downeyathletics.com downeyathletics.com
dpsmarshallathletics.com dpsmarshallathletics.com
dpsmeadowdaleathletics.com dpsmeadowdaleathletics.com
dpsponitzathletics.com dpsponitzathletics.com
drf.com drf.com
dunlapeaglesathletics.com dunlapeaglesathletics.com
edmdl.co edmdl.co
efthunderbirds.com efthunderbirds.com
elmwoodparkathletics.com elmwoodparkathletics.com
evansvillenorthathletics.com evansvillenorthathletics.com
fairfieldathletics.org fairfieldathletics.org
fhcrangers.com fhcrangers.com
findhealthclinics.com findhealthclinics.com
finecooking.com finecooking.com
finegardening.com finegardening.com
fitogfrisk.dk fitogfrisk.dk
frontieracademyathletics.com frontieracademyathletics.com
gaithersburgathletics.com gaithersburgathletics.com
glendaleprepathletics.com glendaleprepathletics.com
glennathletics.com glennathletics.com
glenoakathletics.org glenoakathletics.org
glequip.com glequip.com
gloopla.com gloopla.com
glorychanf.club glorychanf.club
glorychanm.info glorychanm.info
glorychanp.info glorychanp.info
gobearcats.org gobearcats.org
gobgnsports.com gobgnsports.com
gobigredathletics.com gobigredathletics.com
gobluecats.com gobluecats.com
goclarkathletics.com goclarkathletics.com
goherronathletics.com goherronathletics.com
gokanelandknights.com gokanelandknights.com
golakeviewsports.com golakeviewsports.com
gomhswarhawks.com gomhswarhawks.com
gopaolirams.com gopaolirams.com
gordonleeathletics.com gordonleeathletics.com
goredknightathletics.org goredknightathletics.org
gotjpatsathletics.com gotjpatsathletics.com
govalhalla.org govalhalla.org
goyellowjacketsathletics.com goyellowjacketsathletics.com
greenbuildingadvisor.com greenbuildingadvisor.com
grrlpowercomic.com grrlpowercomic.com
happypostc.club happypostc.club
henryclayathletics.com henryclayathletics.com
hesperiaathletics.com hesperiaathletics.com
hhihsathletics.org hhihsathletics.org
hillcrestathletics.org hillcrestathletics.org
hillcrestknightsathletics.com hillcrestknightsathletics.com
hurricanesathletics.com hurricanesathletics.com
ikbenfit.com ikbenfit.com
itsadogsworlda.club itsadogsworlda.club
itsadogsworldn.info itsadogsworldn.info
jewishjournal.com jewishjournal.com
joboptionlistings.com joboptionlistings.com
kashmereathletics.com kashmereathletics.com
kearsleyhornets.org kearsleyhornets.org
kristv.com kristv.com
kztv10.com kztv10.com
laplataathletics.org laplataathletics.org
laps4.com laps4.com
latindex.com latindex.com
legalinsurrection.com legalinsurrection.com
leopardathletics.org leopardathletics.org
lifequotesb.club lifequotesb.club
lifequotesc.club lifequotesc.club
lifequotesp.info lifequotesp.info
lolakers.com lolakers.com
lovemydogc.club lovemydogc.club
lovemydogf.club lovemydogf.club
lphsathletics.net lphsathletics.net
marauderathletics.org marauderathletics.org
mcseagles.org mcseagles.org
menaulsports.com menaulsports.com
mesquiteathletics.com mesquiteathletics.com
miamisburgathletics.com miamisburgathletics.com
milacawolves.com milacawolves.com
milanathletics.com milanathletics.com
milfordmavs.com milfordmavs.com
mlbnewsnow.com mlbnewsnow.com
mrhssentinels.org mrhssentinels.org
murrayhsathletics.com murrayhsathletics.com
muysalud.com muysalud.com
mvcmustangs.com mvcmustangs.com
mycutebaby.in mycutebaby.in
newspapers.com newspapers.com
newspress.com newspress.com
nflnews.org nflnews.org
nfraidersathletics.com nfraidersathletics.com
oclancerathletics.com oclancerathletics.com
ontarioathletics.org ontarioathletics.org
openforjobs.com openforjobs.com
pcactivities.com pcactivities.com
phsterrors.org phsterrors.org
plhsfightingpointers.com plhsfightingpointers.com
ptwarriors.org ptwarriors.org
publicacion.com publicacion.com
cuisimonde.com cuisimonde.com
revistacloud.com revistacloud.com
rubidouxathletics.com rubidouxathletics.com
aahuronathletics.com aahuronathletics.com
samchui.com samchui.com
al3aby4yy.com al3aby4yy.com
sharejoyc.info sharejoyc.info
sharejoyd.club sharejoyd.club
amandaclearcreekathletics.com amandaclearcreekathletics.com
antaizhiye.com antaizhiye.com
solitairebliss.com solitairebliss.com
somethingpositive.net somethingpositive.net
southchristiansports.com southchristiansports.com
southdearbornathletics.com southdearbornathletics.com
srfalcons.org srfalcons.org
stmaknights.com stmaknights.com
storywrite.com storywrite.com
summervilleathletics.com summervilleathletics.com
aktienkursewelt.com aktienkursewelt.com
tbirdathletics.com tbirdathletics.com
ayudaparamanualidades.com ayudaparamanualidades.com
threadsmagazine.com threadsmagazine.com
toilettensitzerhoehungen.com toilettensitzerhoehungen.com
batesvilleathletics.com batesvilleathletics.com
bibleatlas.org bibleatlas.org
blakeathletics.org blakeathletics.org
vnnsportshub.net vnnsportshub.net
wareshoalsathletics.com wareshoalsathletics.com
webflyer.com webflyer.com
wfhscoyoteathletics.com wfhscoyoteathletics.com
wpdirecto.com wpdirecto.com
wqddjlm.com wqddjlm.com
buzz-addict.com buzz-addict.com
buzzfuse.net buzzfuse.net
henrycountyathletics.com henrycountyathletics.com
ypsigrizzlies.com ypsigrizzlies.com
cavernaathletics.com cavernaathletics.com
zamora24horas.com zamora24horas.com
cedarspringsathletics.com cedarspringsathletics.com
chemics.net chemics.net
chococrazeg.club chococrazeg.club
chococrazeh.club chococrazeh.club
coinmarketcap.com coinmarketcap.com
comics.org comics.org
cornersoftheworldg.club cornersoftheworldg.club
cotacoesbolsa.com cotacoesbolsa.com
covathletics.org covathletics.org
cracked.com cracked.com
cyber-breeze.com cyber-breeze.com
dailyheyb.club dailyheyb.club
dailyheyb.info dailyheyb.info
dailyheyd.info dailyheyd.info
dailyheyh.club dailyheyh.club
dailynayadiganta.com dailynayadiganta.com
dekotipps.com dekotipps.com
demilked.com demilked.com
diariodelamancha.com diariodelamancha.com
diywatchk.info diywatchk.info
djpool.co djpool.co
dogpawso.info dogpawso.info
dolartoday.com dolartoday.com
dolartuday.info dolartuday.info
downersgrovesouthathletics.com downersgrovesouthathletics.com
dpsstiversathletics.com dpsstiversathletics.com
dublinathletics.us dublinathletics.us
dzls56.com dzls56.com
ecathletics.org ecathletics.org
egthunderbirds.com egthunderbirds.com
eltiempomadrid.com eltiempomadrid.com
envyauto9w.com envyauto9w.com
evanstonathletics.com evanstonathletics.com
fcgriffins.com fcgriffins.com
feelgoodquotesc.club feelgoodquotesc.club
ffivepado.site ffivepado.site
filesearch.io filesearch.io
findglocal.com findglocal.com
finewoodworking.com finewoodworking.com
folsomathletics.com folsomathletics.com
frankenmuthathletics.com frankenmuthathletics.com
funcarz.com funcarz.com
fvhsathletics.com fvhsathletics.com
gaffneyindiansathletics.com gaffneyindiansathletics.com
gelgul.com gelgul.com
glorychanb.club glorychanb.club
glorychann.info glorychann.info
glotels.com glotels.com
goblackshirts.com goblackshirts.com
gocardinalritter.org gocardinalritter.org
gocelts.com gocelts.com
gocentralsports.com gocentralsports.com
goclementsfootball.com goclementsfootball.com
gofalconathletics.com gofalconathletics.com
goganders.com goganders.com
gohowebulldogs.net gohowebulldogs.net
goplymouthathletics.com goplymouthathletics.com
gorebelsathletics.com gorebelsathletics.com
gossip-addict.com gossip-addict.com
gowbmillers.com gowbmillers.com
haeorum.com haeorum.com
happypostb.info happypostb.info
happypostd.info happypostd.info
hcaeaglessports.org hcaeaglessports.org
hcbeavers.net hcbeavers.net
hhsmustangathletics.org hhsmustangathletics.org
hillgroveathletics.com hillgroveathletics.com
howemilitaryathletics.org howemilitaryathletics.org
hwhswildcats.com hwhswildcats.com
itsadogsworldm.info itsadogsworldm.info
jeromeathletics.net jeromeathletics.net
jimtownathletics.org jimtownathletics.org
johnadamsathletics.com johnadamsathletics.com
johnmarshallathletics.org johnmarshallathletics.org
juiciopolitico.com juiciopolitico.com
katc.com katc.com
kushnercobras.com kushnercobras.com
kxlh.com kxlh.com
laps3.com laps3.com
lavilleathletics.com lavilleathletics.com
lifequotesd.club lifequotesd.club
limabride365.com limabride365.com
localbarsfinder.com localbarsfinder.com
loteriaresultados.es loteriaresultados.es
lovemydogd.club lovemydogd.club
lovemydogp.info lovemydogp.info
malaysiastock.biz malaysiastock.biz
mapasapp.com mapasapp.com
meadowcreekathletics.org meadowcreekathletics.org
mejorconsalud.com mejorconsalud.com
milandawgs.com milandawgs.com
mujeres.es mujeres.es
myjobhelper.co.uk myjobhelper.co.uk
nmblacktornadosports.com nmblacktornadosports.com
northviewsports.com northviewsports.com
occujump.com occujump.com
ocoeeathletics.com ocoeeathletics.com
odathletics.com odathletics.com
odcsathletics.org odcsathletics.org
okemosathletics.net okemosathletics.net
oshareinteria.jp oshareinteria.jp
otrapartida.com otrapartida.com
ovidelsiesports.com ovidelsiesports.com
palma-asakim.com palma-asakim.com
pflsports.net pflsports.net
phsbulldogsathletics.org phsbulldogsathletics.org
pmawarriorsathletics.com pmawarriorsathletics.com
pvathletics.com pvathletics.com
randolphathletics.net randolphathletics.net
ravennaathletics.us ravennaathletics.us
ravennabulldogsathletics.com ravennabulldogsathletics.com
kshb.com kshb.com
kvue.com kvue.com
lasalleprepathletics.org lasalleprepathletics.org
lbpolyathletics.com lbpolyathletics.com
leedavisathletics.com leedavisathletics.com
leegeneralsathletics.com leegeneralsathletics.com
lifelooksc.club lifelooksc.club
lifelooksn.info lifelooksn.info
lifequotesf.club lifequotesf.club
likesharetweet.com likesharetweet.com
lincolnprepathletics.com lincolnprepathletics.com
llamayo.com llamayo.com
losaltosathletics.org losaltosathletics.org
losaltossports.com losaltossports.com
lrathletics.org lrathletics.org
luxandlush.com luxandlush.com
matadorathletics.org matadorathletics.org
mbbuccaneers.com mbbuccaneers.com
meadowbrookathletics.com meadowbrookathletics.com
meups4.com.br meups4.com.br
mjhemails.com mjhemails.com
mkjseadacbdc.ru mkjseadacbdc.ru
naeagles.com naeagles.com
ncwhsathletics.com ncwhsathletics.com
ramsayramsathletics.com ramsayramsathletics.com
nhseagleathletics.com nhseagleathletics.com
nohsathletics.com nohsathletics.com
northwestathletics.org northwestathletics.org
nuviewbridgeathletics.com nuviewbridgeathletics.com
oaathletics.org oaathletics.org
oakridgeathletics.com oakridgeathletics.com
obozrevatel.com obozrevatel.com
ohslions.com ohslions.com
onlydogsm.info onlydogsm.info
oregoncityschoolsathletics.org oregoncityschoolsathletics.org
pacerathletics.org pacerathletics.org
raysofhopea.club raysofhopea.club
patriotproud.net patriotproud.net
pcspacers.com pcspacers.com
rebelstrue.com rebelstrue.com
perfdrive.com perfdrive.com
perris247.com perris247.com
phhspatriotpride.com phhspatriotpride.com
phnhuskies.com phnhuskies.com
piedmontwildcatsathletics.com piedmontwildcatsathletics.com
piquaindiansathletics.org piquaindiansathletics.org
pleasantgrovevikings.com pleasantgrovevikings.com
pmhsfalcons.com pmhsfalcons.com
popeathletics.com popeathletics.com
prettyfun.com prettyfun.com
prosport.ro prosport.ro
puppytownj.info puppytownj.info
puppytownk.info puppytownk.info
puppytownl.info puppytownl.info
puppytownq.info puppytownq.info
puppyvillep.info puppyvillep.info
purejoyc.club purejoyc.club
purejoyi.info purejoyi.info
qchsathletics.com qchsathletics.com
quizpeek.com quizpeek.com
qwily.com qwily.com
radiopaedia.org radiopaedia.org
revrevy.com revrevy.com
ringgoldrams.org ringgoldrams.org
rochesterrams.org rochesterrams.org
acpathletics.com acpathletics.com
saladoeaglenation.org saladoeaglenation.org
arcadehippo.com arcadehippo.com
scottbulldogs.org scottbulldogs.org
scseaglenation.com scseaglenation.com
aggieathletics.org aggieathletics.org
semperzoo.com semperzoo.com
aktiespararna.se aktiespararna.se
akcenty.com.ua akcenty.com.ua
sjraidersathletics.com sjraidersathletics.com
slwceaglenationathletics.com slwceaglenationathletics.com
snifflyh.info snifflyh.info
snifflyk.info snifflyk.info
snugglepupj.info snugglepupj.info
snugglepupm.info snugglepupm.info
societycaresg.club societycaresg.club
societycareso.info societycareso.info
soobluedevils.com soobluedevils.com
spartanation300.com spartanation300.com
spstallions.com spstallions.com
sputnamathletics.com sputnamathletics.com
stvmathletics.com stvmathletics.com
svhsathletics.org svhsathletics.org
tctrojanpride.com tctrojanpride.com
aynorbluejackets.net aynorbluejackets.net
tigardtigers.com tigardtigers.com
tischkochen.com tischkochen.com
bathcountyathletics.com bathcountyathletics.com
baycitywesternathletics.com baycitywesternathletics.com
tomorrowoman.com tomorrowoman.com
translate.ru translate.ru
tribunely.com tribunely.com
trndsnt.de trndsnt.de
tubereplay.com tubereplay.com
bglancers.com bglancers.com
uhstitansathletics.com uhstitansathletics.com
unici.cn unici.cn
bihon.ro bihon.ro
utdt.net utdt.net
blic.rs blic.rs
vfathletics.com vfathletics.com
waggenerathletics.com waggenerathletics.com
wbir.com wbir.com
wcsramsathletics.com wcsramsathletics.com
waynedaleathletics.com waynedaleathletics.com
bouldercityathletics.com bouldercityathletics.com
weareauburndaleathletics.com weareauburndaleathletics.com
brainfall.com brainfall.com
weldcentralrebels.com weldcentralrebels.com
wghathletics.org wghathletics.org
wgrz.com wgrz.com
wfaa.com wfaa.com
winamacathletics.com winamacathletics.com
wkyc.com wkyc.com
wmc1010.info wmc1010.info
wnhsathletics.com wnhsathletics.com
bumblebeenation.com bumblebeenation.com
woodburnbulldogs.com woodburnbulldogs.com
wossmanwildcatsathletics.com wossmanwildcatsathletics.com
wtol.com wtol.com
buzzinhere.com buzzinhere.com
wundaba.de wundaba.de
buzzvivo.com buzzvivo.com
bvathletics.net bvathletics.net
cacavaliers.com cacavaliers.com
wythemaroons.org wythemaroons.org
xeniaathletics.com xeniaathletics.com
canyonlake247.com canyonlake247.com
ynetnews.com ynetnews.com
cbs8.com cbs8.com
cedargroveathletics.com cedargroveathletics.com
zeelandeastsports.com zeelandeastsports.com
celebzz.com celebzz.com
zerohedge.com zerohedge.com
centervilleelkathletics.com centervilleelkathletics.com
am.com.mx am.com.mx
chococrazeb.info chococrazeb.info
tv.movie tv.movie
chswarriors.org chswarriors.org
connectorb.club connectorb.club
copilul.ro copilul.ro
cornersoftheworldb.info cornersoftheworldb.info
cornersoftheworldd.info cornersoftheworldd.info
cornersoftheworldl.club cornersoftheworldl.club
cornersoftheworldm.club cornersoftheworldm.club
crossbingo.com crossbingo.com
cuddlebuddyk.info cuddlebuddyk.info
cwncathletics.org cwncathletics.org
dailyheym.club dailyheym.club
dailyhive.com dailyhive.com
dchawks.com dchawks.com
derbyathletics.com derbyathletics.com
dictionary.co.il dictionary.co.il
diywatchd.club diywatchd.club
dogloversc.club dogloversc.club
elginwildcatathletics.com elginwildcatathletics.com
elyriaathletics.org elyriaathletics.org
escondido247.com escondido247.com
esnoticiamexico.com esnoticiamexico.com
fabulous55.com fabulous55.com
famefocus.com famefocus.com
fcmustangs.com fcmustangs.com
feelgoodquotesa.club feelgoodquotesa.club
fgrirish.com fgrirish.com
fhsindians.com fhsindians.com
fhswildcats.com fhswildcats.com
foleyathletics.com foleyathletics.com
folhabv.com.br folhabv.com.br
fox61.com fox61.com
fribbla.com fribbla.com
furrydeedsm.info furrydeedsm.info
gainesvilleredelephantathletics.com gainesvilleredelephantathletics.com
ganeshagiantsathletics.com ganeshagiantsathletics.com
gddhyxj.com gddhyxj.com
guyerwildcats.com guyerwildcats.com
mhs-mavericks.com mhs-mavericks.com
ghsvikings.com ghsvikings.com
girardindians.org girardindians.org
glonstruct.com glonstruct.com
glynncountyathletics.com glynncountyathletics.com
goaustinhighathletics.com goaustinhighathletics.com
goballardbruins.com goballardbruins.com
gocentennialathletics.com gocentennialathletics.com
goeastmark.com goeastmark.com
goghsreddevils.com goghsreddevils.com
gohebronathletics.com gohebronathletics.com
gohutchathletics.com gohutchathletics.com
gomarshallredhawks.com gomarshallredhawks.com
gonmbchiefs.com gonmbchiefs.com
gonwtigers.com gonwtigers.com
mhsbluedevilnation.com mhsbluedevilnation.com
goramsathletics.com goramsathletics.com
gorangerathletics.com gorangerathletics.com
goscorpionsports.com goscorpionsports.com
gowildcatsports.com gowildcatsports.com
grcathletics.com grcathletics.com
happymailj.info happymailj.info
happypostd.club happypostd.club
happypostl.club happypostl.club
happysquirrelf.club happysquirrelf.club
hawkathletics.net hawkathletics.net
headstory.com headstory.com
hellopuppyh.info hellopuppyh.info
hellopuppyp.info hellopuppyp.info
hfathletics.com hfathletics.com
hhspatriots.org hhspatriots.org
hiredtechnology.com hiredtechnology.com
hitchcockbulldogs.org hitchcockbulldogs.org
ihavenet.com ihavenet.com
ijaen.es ijaen.es
independencebluedevils.com independencebluedevils.com
intelliquiz.com intelliquiz.com
ipstatic.net ipstatic.net
iwordfinder.com iwordfinder.com
jasperathletics.com jasperathletics.com
jeffersonbluejays.com jeffersonbluejays.com
jenisonathletics.com jenisonathletics.com
joneshighathletics.com joneshighathletics.com
kfetele.ro kfetele.ro
kgw.com kgw.com
kipptexas-sanantonioathletics.com kipptexas-sanantonioathletics.com
knighthawksathletics.com knighthawksathletics.com
krem.com krem.com
juguetes.org juguetes.org
kearnsathletics.com kearnsathletics.com
kens5.com kens5.com
kleincollinstigers.com kleincollinstigers.com
knightnationathletics.com knightnationathletics.com
ktvb.com ktvb.com
lackeyathletics.com lackeyathletics.com
lafayettefightingirish.com lafayettefightingirish.com
lagunahillsathletics.com lagunahillsathletics.com
lancasterathletics.com lancasterathletics.com
lawndaleathletics.com lawndaleathletics.com
lecathletics.com lecathletics.com
legendsguru.com legendsguru.com
lewiscountyathletics.com lewiscountyathletics.com
lhshornets.com lhshornets.com
libertateapentrufemei.ro libertateapentrufemei.ro
loogooteeathletics.com loogooteeathletics.com
losgatosathletics.com losgatosathletics.com
lowellvilleathletics.com lowellvilleathletics.com
lwwathletics.com lwwathletics.com
manchesterdutchmen.com manchesterdutchmen.com
matadornetwork.com matadornetwork.com
mchiathletics.com mchiathletics.com
mcmustangs.com mcmustangs.com
meadeathletics.com meadeathletics.com
mohawks4life.com mohawks4life.com
mrhsathletics.com mrhsathletics.com
mrhsgrizzlies.org mrhsgrizzlies.org
mthfightingowls.com mthfightingowls.com
munciecentralathletics.com munciecentralathletics.com
ncacrusaders.org ncacrusaders.org
ndathletics.com ndathletics.com
neopets.com neopets.com
newspresp.info newspresp.info
newspressn.info newspressn.info
newswest9.com newswest9.com
nghsbulldogs.com nghsbulldogs.com
nmhsathletics.com nmhsathletics.com
noveltyo.com noveltyo.com
npaaathletics.com npaaathletics.com
npcougars.com npcougars.com
oberlinathletics.org oberlinathletics.org
ohstigers.com ohstigers.com
olyathletics.com olyathletics.com
onlydogsp.info onlydogsp.info
oronospartans.org oronospartans.org
ovpatriots.com ovpatriots.com
parentztalk.com parentztalk.com
pcepactivities.com pcepactivities.com
penrevy.com penrevy.com
pikecountyathletics.com pikecountyathletics.com
puppytownh.info puppytownh.info
puppytownt.info puppytownt.info
purejoye.club purejoye.club
purejoyg.club purejoyg.club
purejoyk.info purejoyk.info
qocougars.com qocougars.com
ramsathletics.org ramsathletics.org
raysofhopeb.club raysofhopeb.club
raysofhopeh.info raysofhopeh.info
raysofhopei.info raysofhopei.info
raysofhopem.info raysofhopem.info
raysofhopeo.info raysofhopeo.info
riverside247.com riverside247.com
abilenecooperathletics.org abilenecooperathletics.org
rvblazerathletics.com rvblazerathletics.com
sandraandwoo.com sandraandwoo.com
saxonathletics.com saxonathletics.com
sclouddownloader.net sclouddownloader.net
sdcavers.com sdcavers.com
ahsathletics.com ahsathletics.com
ahsrocketsports.org ahsrocketsports.org
semesterz.com semesterz.com
sequoyahathletics.com sequoyahathletics.com
seventyfirstathletics.com seventyfirstathletics.com
alohaathletics.org alohaathletics.org
seymourathletics.com seymourathletics.com
alcazardesanjuan.com alcazardesanjuan.com
algonabulldogs.org algonabulldogs.org
shs-falcons.com shs-falcons.com
shsnolesathletics.com shsnolesathletics.com
shswolfpack.com shswolfpack.com
simbaly.com simbaly.com
slcavaliers.com slcavaliers.com
smpanthersports.com smpanthersports.com
snifflyl.info snifflyl.info
snifflym.info snifflym.info
snifflyo.info snifflyo.info
snifflyu.info snifflyu.info
snugglepupi.info snugglepupi.info
snugglepupt.info snugglepupt.info
snugglepupu.info snugglepupu.info
societycaresn.info societycaresn.info
soddydaisyathletics.com soddydaisyathletics.com
sopawfect.com sopawfect.com
sportingz.com sportingz.com
arundelathletics.com arundelathletics.com
stcathletics.com stcathletics.com
1007sandiego.com 1007sandiego.com
12newsnow.com 12newsnow.com
13newsnow.com 13newsnow.com
swraidersathletics.com swraidersathletics.com
tabooya.com tabooya.com
tastegapsd.club tastegapsd.club
tcrams.net tcrams.net
techbulldogs.com techbulldogs.com
telehealthdave.com telehealthdave.com
theheartydogd.club theheartydogd.club
theheartydogf.club theheartydogf.club
theroyaldogf.club theroyaldogf.club
theyoump3.com theyoump3.com
timbercreekathletics.com timbercreekathletics.com
baratacademyathletics.org baratacademyathletics.org
tion.ro tion.ro
tippecanoeathletics.com tippecanoeathletics.com
titansathletics.org titansathletics.org
basketball.com basketball.com
tohsathletics.org tohsathletics.org
bchsdolphins.com bchsdolphins.com
travelingmom.com travelingmom.com
tri-centraltrojans.com tri-centraltrojans.com
tri-countyathletics.com tri-countyathletics.com
trndhive.com trndhive.com
tscougarssports.com tscougarssports.com
bexleyathletics.com bexleyathletics.com
bghsathletics.com bghsathletics.com
urbanahawksathletics.com urbanahawksathletics.com
bishopenglandathletics.com bishopenglandathletics.com
valleyviewtigers1.com valleyviewtigers1.com
verdict.ro verdict.ro
blythewoodbengals.com blythewoodbengals.com
boardmanathletics.org boardmanathletics.org
bombeiros24.pt bombeiros24.pt
wabashapaches.net wabashapaches.net
wcnc.com wcnc.com
wearebeggs.com wearebeggs.com
wfmynews2.com wfmynews2.com
whas11.com whas11.com
brockeaglesathletics.com brockeaglesathletics.com
widefieldgladiators.org widefieldgladiators.org
brvathletics.com brvathletics.com
btwathletics.com btwathletics.com
buccaneerstrong.com buccaneerstrong.com
wopanthers.com wopanthers.com
buttscountyathletics.com buttscountyathletics.com
cajoncowboyathletics.com cajoncowboyathletics.com
calcalist.co.il calcalist.co.il
cavsathletics.com cavsathletics.com
cbs19.tv cbs19.tv
cfcolts.com cfcolts.com
zygdesigner.com zygdesigner.com
chicksonright.com chicksonright.com
chococrazeb.xyz chococrazeb.xyz
chsfalconpride.com chsfalconpride.com
chsfalcons.com chsfalcons.com
chslionsathletics.com chslionsathletics.com
cornersoftheworldn.club cornersoftheworldn.club
covinahighathletics.com covinahighathletics.com
cuddlebuddyl.info cuddlebuddyl.info
cuddlebuddyq.info cuddlebuddyq.info
cumhuriyet.com.tr cumhuriyet.com.tr
daculaathletics.com daculaathletics.com
dadecountyathletics.com dadecountyathletics.com
dailyarmy.com dailyarmy.com
dailydisclosure.com dailydisclosure.com
dailyheyk.club dailyheyk.club
dailyheyl.club dailyheyl.club
darklegacycomics.com darklegacycomics.com
dbhssports.org dbhssports.org
dcbusiness.ro dcbusiness.ro
dcnews.ro dcnews.ro
deeplyfav.com deeplyfav.com
deersy.com deersy.com
denmarkathletics.com denmarkathletics.com
dezignshopz.com dezignshopz.com
diabloathletics.com diabloathletics.com
diywatchf.club diywatchf.club
dmwolves.com dmwolves.com
dogpawsd.club dogpawsd.club
dvskyhawksathletics.com dvskyhawksathletics.com
easleyathletics.com easleyathletics.com
eastviewathletics.com eastviewathletics.com
ehsathletics.org ehsathletics.org
ejeagleathletics.org ejeagleathletics.org
elle.ro elle.ro
ennislions.org ennislions.org
erhsmustangathletics.com erhsmustangathletics.com
fcflashes.com fcflashes.com
fliernation.org fliernation.org
flucoathletics.com flucoathletics.com
fmhsathletics.com fmhsathletics.com
football.com football.com
foxcreekathletics.com foxcreekathletics.com
fsglwkf.cn fsglwkf.cn
furrydeedsb.club furrydeedsb.club
furrydeedsn.info furrydeedsn.info
gahannalincolnathletics.com gahannalincolnathletics.com
ganxindz.com ganxindz.com
gbhsathletics.com gbhsathletics.com
gcaathletics.org gcaathletics.org
gchsathletics.org gchsathletics.org
gilbertathletics.org gilbertathletics.org
gingerize.com gingerize.com
globalbusinesschronicle.com globalbusinesschronicle.com
godwinheightsathletics.com godwinheightsathletics.com
gofcswarriors.com gofcswarriors.com
gosparkplugs.com gosparkplugs.com
gotfhsbruins.com gotfhsbruins.com
governorpalin.org governorpalin.org
gowilsonwildcats.com gowilsonwildcats.com
grchristianeagles.com grchristianeagles.com
greenbulldogathletics.com greenbulldogathletics.com
hannity.com hannity.com
happymailk.info happymailk.info
happypostb.xyz happypostb.xyz
happypostf.club happypostf.club
happypostg.club happypostg.club
happypostm.club happypostm.club
happypostn.club happypostn.club
happypostq.club happypostq.club
healthyhogk.info healthyhogk.info
hellopuppyg.info hellopuppyg.info
hellopuppyi.info hellopuppyi.info
hellopuppyl.info hellopuppyl.info
hetamsterdamschevoetbal.nl hetamsterdamschevoetbal.nl
hhpboosterclub.com hhpboosterclub.com
hidalgopirates.org hidalgopirates.org
hirednurses.com hirednurses.com
hiringretail.com hiringretail.com
hmbhsathletics.com hmbhsathletics.com
hokesbluffathletics.com hokesbluffathletics.com
homeremedyshop.com homeremedyshop.com
idabelwarriors.com idabelwarriors.com
ilwarriors.com ilwarriors.com
interpals.net interpals.net
ironhorseathletics.net ironhorseathletics.net
itsadogsworldb.club itsadogsworldb.club
jamesclemensathletics.com jamesclemensathletics.com
jeffersonfalconathletics.com jeffersonfalconathletics.com
rareviral.com rareviral.com
ratsit.se ratsit.se
raysofhopeg.club raysofhopeg.club
redtri.com redtri.com
roscoeathletics.com roscoeathletics.com
royalathletics.net royalathletics.net
roughriderathletics.net roughriderathletics.net
routerloginwifi.com routerloginwifi.com
roverathletics.org roverathletics.org
saeasports.org saeasports.org
salamanca24horas.com salamanca24horas.com
sccsathletics.cc sccsathletics.cc
ahduvido.com.br ahduvido.com.br
sharejoyh.club sharejoyh.club
sharejoyq.club sharejoyq.club
shskyhawksathletics.com shskyhawksathletics.com
shpanthernation.com shpanthernation.com
amherststeelecomets.com amherststeelecomets.com
americancolumn.com americancolumn.com
amar-sangbad.com amar-sangbad.com
answertrade.com answertrade.com
smcathletics.us smcathletics.us
snifflyg.info snifflyg.info
snifflyn.info snifflyn.info
snifflyp.info snifflyp.info
smtitansathletics.org smtitansathletics.org
snugglepupk.info snugglepupk.info
snugglepupl.info snugglepupl.info
snugglepupo.info snugglepupo.info
snowdaycalculator.com snowdaycalculator.com
sogoodly.com sogoodly.com
societycaresd.club societycaresd.club
societycaresf.club societycaresf.club
southernathletics.org southernathletics.org
sparksoflifef.club sparksoflifef.club
sparksoflifeh.club sparksoflifeh.club
12news.com 12news.com
aaskylineathletics.com aaskylineathletics.com
achswolvesathletics.net achswolvesathletics.net
sunloungef.club sunloungef.club
allaboutjazz.com allaboutjazz.com
svilleathletics.com svilleathletics.com
apacheathletics.org apacheathletics.org
atalakers.com atalakers.com
tastegapsb.club tastegapsb.club
tastegapsn.info tastegapsn.info
textsfromlastnight.com textsfromlastnight.com
aydengriftonathletics.com aydengriftonathletics.com
bahisyap101.com bahisyap101.com
thv11.com thv11.com
titanathleticshq.com titanathleticshq.com
tmhswildcatsathletics.com tmhswildcatsathletics.com
bchstigers.com bchstigers.com
toptiz.com toptiz.com
trend-guru.com trend-guru.com
trivia.com trivia.com
triwestbruins.com triwestbruins.com
bereanathletics.org bereanathletics.org
bessemerathletics.com bessemerathletics.com
uasdathletics.com uasdathletics.com
binghamathletics.com binghamathletics.com
bishopcanevinathletics.com bishopcanevinathletics.com
varinaathletics.com varinaathletics.com
vcscrusaderathletics.com vcscrusaderathletics.com
blscots.org blscots.org
boazathletics.com boazathletics.com
bobshideout.com bobshideout.com
bollywoodhungama.com bollywoodhungama.com
bomcondutor.pt bomcondutor.pt
bonappetity.com bonappetity.com
wearebartlett.com wearebartlett.com
wearemaranatha.com wearemaranatha.com
brcardinals.com brcardinals.com
wellness99.com wellness99.com
wesleychapelathletics.com wesleychapelathletics.com
westernpanthersports.com westernpanthersports.com
westfieldathletics.com westfieldathletics.com
wghawksactivities.com wghawksactivities.com
whatismyipaddress.com whatismyipaddress.com
wheelerbearcatsathletics.com wheelerbearcatsathletics.com
whsowls.com whsowls.com
btw-athletics.com btw-athletics.com
burlesonathletics.com burlesonathletics.com
worlderz.com worlderz.com
worthyo.com worthyo.com
wrenhurricanesathletics.com wrenhurricanesathletics.com
buzzbeagle.com buzzbeagle.com
byroncentersports.com byroncentersports.com
cadetathletics.com cadetathletics.com
wxwildcats.com wxwildcats.com
wyomingwolvesathletics.com wyomingwolvesathletics.com
calcalistech.com calcalistech.com
carlsbad247.com carlsbad247.com
yorktownathletics.com yorktownathletics.com
cfallsathletics.org cfallsathletics.org
cfhspanthers.com cfhspanthers.com
zooflew.com zooflew.com
chlloe.com chlloe.com
chocolate.com chocolate.com
chsathletics.net chsathletics.net
cirangers.org cirangers.org
clarencevilleathletics.com clarencevilleathletics.com
coffmanathletics.net coffmanathletics.net
cornersoftheworldk.club cornersoftheworldk.club
csturg.is csturg.is
cuddlebuddyj.info cuddlebuddyj.info
cuddlebuddym.info cuddlebuddym.info
cuddlebuddyn.info cuddlebuddyn.info
cuddlebuddyo.info cuddlebuddyo.info
cuddlebuddyp.info cuddlebuddyp.info
cvjags.com cvjags.com
dailyheyf.club dailyheyf.club
dailytreat.net dailytreat.net
dashamerica.com dashamerica.com
days.to days.to
dealerwebb.com dealerwebb.com
dha.com.tr dha.com.tr
dilemaveche.ro dilemaveche.ro
diywatchb.club diywatchb.club
diywatche.club diywatche.club
diywatchn.info diywatchn.info
dreadnaughtathletics.com dreadnaughtathletics.com
eauclaireathletics.org eauclaireathletics.org
ecaathletics.org ecaathletics.org
edgewoodmustangsathletics.com edgewoodmustangsathletics.com
ehs-tigers.com ehs-tigers.com
emuparadise.me emuparadise.me
evansathletics.com evansathletics.com
fairbankspanthers.com fairbankspanthers.com
fclionathletics.com fclionathletics.com
feelgoodquotesb.club feelgoodquotesb.club
feelgoodquotesf.club feelgoodquotesf.club
feelgoodquotesk.info feelgoodquotesk.info
fhs-warriors.com fhs-warriors.com
filmibeat.com filmibeat.com
frequenciesf.club frequenciesf.club
frequenciesg.club frequenciesg.club
furrydeedsf.club furrydeedsf.club
furrydeedsk.info furrydeedsk.info
furrydeedso.info furrydeedso.info
furrydeedsp.info furrydeedsp.info
gandul.ro gandul.ro
ghnorthernoaksathletics.org ghnorthernoaksathletics.org
goaviatorsathletics.com goaviatorsathletics.com
gocanebayathletics.net gocanebayathletics.net
gocentralindians.com gocentralindians.com
gohermleigh.com gohermleigh.com
gohornetsathletics.com gohornetsathletics.com
golamarmustangs.com golamarmustangs.com
gomightyarabs.com gomightyarabs.com
gopantherathletics.com gopantherathletics.com
gorangernation.com gorangernation.com
goroyalsgo.net goroyalsgo.net
gosachristian.org gosachristian.org
gpucheck.com gpucheck.com
graduatez.com graduatez.com
greeningz.com greeningz.com
gustarte.ro gustarte.ro
gvgatorathletics.com gvgatorathletics.com
hancockcountyathletics.com hancockcountyathletics.com
happycandles.com happycandles.com
happymailn.info happymailn.info
haraiders.com haraiders.com
hboilersports.com hboilersports.com
hcbeavers.org hcbeavers.org
hchshornets.com hchshornets.com
healthyhogg.info healthyhogg.info
healthyhogl.info healthyhogl.info
hellopuppyj.info hellopuppyj.info
hellopuppyo.info hellopuppyo.info
hellopuppyq.info hellopuppyq.info
heykentucky.com heykentucky.com
hinkleyathletics.com hinkleyathletics.com
hiringlogistics.com hiringlogistics.com
hooverhighathletics.com hooverhighathletics.com
hudsonvilleathletics.com hudsonvilleathletics.com
huffmanhighschoolathletics.com huffmanhighschoolathletics.com
iccpathletics.org iccpathletics.org
idrlabs.com idrlabs.com
irabulldogs.org irabulldogs.org
itsadogsworldk.info itsadogsworldk.info
jdvolsathletics.com jdvolsathletics.com
jgathletics.org jgathletics.org
jichsathletics.com jichsathletics.com
jwnorthathletics.org jwnorthathletics.org
kalkaskaathletics.com kalkaskaathletics.com
kare11.com kare11.com
kgun9.com kgun9.com
khou.com khou.com
kiiitv.com kiiitv.com
kvoa.com kvoa.com
kwknights.com kwknights.com
lahstoppers.com lahstoppers.com
lakenonaathletics.org lakenonaathletics.org
lakeontariounited.com lakeontariounited.com
lamarcountyathletics.com lamarcountyathletics.com
lccathletics.com lccathletics.com
lebanonathletics.org lebanonathletics.org
lebanonwarriorathletics.com lebanonwarriorathletics.com
leonslair.com leonslair.com
lhhighlanderathletics.com lhhighlanderathletics.com
lhs-trojans.com lhs-trojans.com
lickingvalleyathletics.com lickingvalleyathletics.com
lifelooksg.club lifelooksg.club
likesism.com likesism.com
loanpride.com loanpride.com
lokmatnews.in lokmatnews.in
lovemydogb.club lovemydogb.club
marauderathletics.com marauderathletics.com
mchsathletics.com mchsathletics.com
mckayathletics.com mckayathletics.com
mcmichaelathletics.com mcmichaelathletics.com
mcs-athletics.com mcs-athletics.com
medyafaresi.com medyafaresi.com
mhspioneers.com mhspioneers.com
minecraft24.com minecraft24.com
mlspartanathletics.org mlspartanathletics.org
mmmarauders.com mmmarauders.com
mooseheadstew.com mooseheadstew.com
mpanthers.com mpanthers.com
mqtblazers.com mqtblazers.com
mtcssports.com mtcssports.com
mydailyviral.com mydailyviral.com
myfavoritecontent.com myfavoritecontent.com
myjobhelper-corp.com myjobhelper-corp.com
mzamin.com mzamin.com
newsd.co newsd.co
nhs-cougars.com nhs-cougars.com
nilesathletics.com nilesathletics.com
northwesterntrojans.org northwesterntrojans.org
nutra.blog nutra.blog
nwmounties.com nwmounties.com
oakridgeathletics.org oakridgeathletics.org
ochsathletics.com ochsathletics.com
ohscardinals.com ohscardinals.com
okmagazine.ro okmagazine.ro
olentangybravesathletics.com olentangybravesathletics.com
olentangyorangeathletics.com olentangyorangeathletics.com
omahabryanbears.com omahabryanbears.com
onlineweb.tools onlineweb.tools
onlydogsb.club onlydogsb.club
onlydogsg.club onlydogsg.club
paintbranchathletics.org paintbranchathletics.org
pcpatriotsports.com pcpatriotsports.com
pelhamhighathletics.com pelhamhighathletics.com
pendletonathletics.com pendletonathletics.com
rimathleticsactivities.com rimathleticsactivities.com
plox.com.br plox.com.br
pomonareddevilathletics.com pomonareddevilathletics.com
pottervilleathletics.com pottervilleathletics.com
riverforestathletics.com riverforestathletics.com
riverhawkathletics.com riverhawkathletics.com
ptpanthers.org ptpanthers.org
pupandhome.com pupandhome.com
puppytowni.info puppytowni.info
puppytownm.info puppytownm.info
puppytownn.info puppytownn.info
puppytownu.info puppytownu.info
puppyvilleg.info puppyvilleg.info
puppyvilleh.info puppyvilleh.info
puppyvillei.info puppyvillei.info
puppyvillej.info puppyvillej.info
puppyvillek.info puppyvillek.info
puppyvilleo.info puppyvilleo.info
purejoyb.club purejoyb.club
purejoyh.info purejoyh.info
purejoym.info purejoym.info
ramonaathletics.com ramonaathletics.com
riflehighschoolsports.com riflehighschoolsports.com
aromdidi.com aromdidi.com
sabreathletics.org sabreathletics.org
addisonathletics.com addisonathletics.com
afternoonspecial.com afternoonspecial.com
selectclassifieds.com selectclassifieds.com
ajax1.nl ajax1.nl
sfhsdonsathletics.com sfhsdonsathletics.com
sharejoyc.club sharejoyc.club
sharejoyf.club sharejoyf.club
sharejoyg.club sharejoyg.club
sherwoodathletics.org sherwoodathletics.org
shoeflew.com shoeflew.com
sjajaguars.org sjajaguars.org
skidmore-tynanathletics.com skidmore-tynanathletics.com
snifflyj.info snifflyj.info
snifflyt.info snifflyt.info
snugglepupg.info snugglepupg.info
snugglepuph.info snugglepuph.info
snugglepupp.info snugglepupp.info
societycaresc.club societycaresc.club
sporteluxe.com sporteluxe.com
sprayberryathletics.com sprayberryathletics.com
springbrookathletics.org springbrookathletics.org
ststephensathletics.org ststephensathletics.org
sublimly.com sublimly.com
ahscolts.net ahscolts.net
akinseaglessports.com akinseaglessports.com
swimyo.com swimyo.com
americanmilitarynews.com americanmilitarynews.com
takimag.com takimag.com
tastegapsc.club tastegapsc.club
tastegapsf.club tastegapsf.club
tastegapspp.info tastegapspp.info
tcnathletics.com tcnathletics.com
avhshawkathletics.com avhshawkathletics.com
theheartydogb.club theheartydogb.club
tikaneyat.com tikaneyat.com
timberlandathletics.com timberlandathletics.com
timezoff.com timezoff.com
tkathletics.com tkathletics.com
tosaeastathletics.com tosaeastathletics.com
twinpeakscharteracademyathletics.com twinpeakscharteracademyathletics.com
uchsathletics.com uchsathletics.com
bethcenterbulldogs.com bethcenterbulldogs.com
uhsathletics.org uhsathletics.org
bhpbears.com bhpbears.com
bhsathletics.org bhsathletics.org
bhsbulldogs.com bhsbulldogs.com
upperstclairathletics.com upperstclairathletics.com
upvideo.pt upvideo.pt
upworthy.com upworthy.com
vahsathletics.com vahsathletics.com
viewpure.com viewpure.com
viralwalrus.com viralwalrus.com
bogalusalumberjacks.org bogalusalumberjacks.org
washingtonexaminer.com washingtonexaminer.com
wdathletics.com wdathletics.com
waverlywarriorsathletics.com waverlywarriorsathletics.com
wearecamdenhs.com wearecamdenhs.com
weboathletics.com weboathletics.com
bozoba.de bozoba.de
bradleyathletics.org bradleyathletics.org
wheatonknights.com wheatonknights.com
bssjaguars.com bssjaguars.com
wltx.com wltx.com
wmtornadoes.com wmtornadoes.com
buckeyevalleyathletics.com buckeyevalleyathletics.com
bulldogsathletics.com bulldogsathletics.com
wqad.com wqad.com
canoodlesoup.com canoodlesoup.com
capacathletics.com capacathletics.com
yidio.com yidio.com
ccc11.shop ccc11.shop
ncraiders.com ncraiders.com
chscougarathletics.com chscougarathletics.com
churchillathletics.com churchillathletics.com
clackamasathletics.com clackamasathletics.com
clickpentrufemei.ro clickpentrufemei.ro
clickpoftabuna.ro clickpoftabuna.ro
cmhornets.net cmhornets.net
collegefreakz.com collegefreakz.com
concordhsathletics.com concordhsathletics.com
coolimba.com coolimba.com
coolstoryz.com coolstoryz.com
copleyathletics.org copleyathletics.org
cornersoftheworldb.xyz cornersoftheworldb.xyz
cpgophers.com cpgophers.com
cuddlebuddyi.info cuddlebuddyi.info
cuyhtsathletics.com cuyhtsathletics.com
cvhsgrizzlies.net cvhsgrizzlies.net
dailyheyb.xyz dailyheyb.xyz
dailyheyc.info dailyheyc.info
dailyheyn.club dailyheyn.club
daowl.com daowl.com
dcmedical.ro dcmedical.ro
designf4.com designf4.com
designyoo.com designyoo.com
dezignerzyo.com dezignerzyo.com
nctsharknation.com nctsharknation.com
diywatchc.club diywatchc.club
dockathletics.org dockathletics.org
dogloversf.club dogloversf.club
drhsjaguars.com drhsjaguars.com
dublinathletics.org dublinathletics.org
dutchtownathletics.com dutchtownathletics.com
ectrojansathletics.com ectrojansathletics.com
edgewaterathletics.com edgewaterathletics.com
educacion2.com educacion2.com
eelsathletics.com eelsathletics.com
einsteinathletics.org einsteinathletics.org
elmatero.net elmatero.net
elranchodons.com elranchodons.com
engineere.com engineere.com
fentonathletics.org fentonathletics.org
fightingeaglesports.org fightingeaglesports.org
fikeathletics.com fikeathletics.com
filerathletics.com filerathletics.com
fleischtheke.info fleischtheke.info
frequenciesn.info frequenciesn.info
frequenciesp.info frequenciesp.info
fullydelicious.com fullydelicious.com
funbrk.com funbrk.com
furrydeedsc.club furrydeedsc.club
furrydeedsd.club furrydeedsd.club
gadsdencityathletics.com gadsdencityathletics.com
gagwoop.com gagwoop.com
garawayathletics.com garawayathletics.com
gcshawks.com gcshawks.com
gizbot.com gizbot.com
goadamscentralathletics.com goadamscentralathletics.com
goaledobearcats.com goaledobearcats.com
goclspartans.org goclspartans.org
goeasterneagles.org goeasterneagles.org
gohammondathletics.com gohammondathletics.com
gohhshurricanes.com gohhshurricanes.com
gokennedycavs.com gokennedycavs.com
gomaroonsathletics.com gomaroonsathletics.com
gonorthridgevikings.com gonorthridgevikings.com
goriversideathletics.com goriversideathletics.com
goscarboroughspartans.com goscarboroughspartans.com
govikingsathletics.com govikingsathletics.com
greatlakesfisherman.com greatlakesfisherman.com
gwcarversports.com gwcarversports.com
haftrhawks.com haftrhawks.com
happymailh.info happymailh.info
happymailq.info happymailq.info
headlineleak.com headlineleak.com
healthyhogi.info healthyhogi.info
healthyhogp.info healthyhogp.info
hellopuppyk.info hellopuppyk.info
hhcardinals.com hhcardinals.com
hhcomets.com hhcomets.com
hilandathletics.com hilandathletics.com
homeepiphany.com homeepiphany.com
hopkinsathletics.com hopkinsathletics.com
houndnation1.com houndnation1.com
hseroyalsathletics.com hseroyalsathletics.com
incomeworth.com incomeworth.com
itsadogsworldc.club itsadogsworldc.club
itsadogsworldd.club itsadogsworldd.club
itsadogsworldf.club itsadogsworldf.club
itsadogsworldp.info itsadogsworldp.info
jcpatriotsathletics.com jcpatriotsathletics.com
joshuaathletics.com joshuaathletics.com
jyghxsm.com jyghxsm.com
kcentv.com kcentv.com
keenanraiders.com keenanraiders.com
kffirebirds.com kffirebirds.com
king5.com king5.com
kmlchargers.com kmlchargers.com
knightspride.com knightspride.com
ndhsrebels.com ndhsrebels.com
lapelathletics.com lapelathletics.com
lfclive.net lfclive.net
lfg.co lfg.co
lfgcomic.com lfgcomic.com
lgyw582.cn lgyw582.cn
lifelooksd.club lifelooksd.club
lifequotesn.info lifequotesn.info
lobonation.com lobonation.com
logancountyathletics.com logancountyathletics.com
logangrizzlies.org logangrizzlies.org
logicimmonieuwbouw.be logicimmonieuwbouw.be
lqathletics.com lqathletics.com
mcdonoughathletics.com mcdonoughathletics.com
meaww.com meaww.com
moonareaathletics.com moonareaathletics.com
mshstrojanathletics.com mshstrojanathletics.com
muathletics.com muathletics.com
mvmavericks.com mvmavericks.com
myjobhelper.com myjobhelper.com
nelsoncountycardinals.com nelsoncountycardinals.com
newspresf.club newspresf.club
nphswolfpackathletics.com nphswolfpackathletics.com
nutleyathletics.org nutleyathletics.org
odemowlathletics.com odemowlathletics.com
ohspiratesathletics.com ohspiratesathletics.com
olentangylibertyathletics.com olentangylibertyathletics.com
omahanorthvikings.com omahanorthvikings.com
omahanorthwesthuskies.com omahanorthwesthuskies.com
osseo-orioles.com osseo-orioles.com
parentmap.com parentmap.com
pchsathletics.com pchsathletics.com
pebblebrookathletics.com pebblebrookathletics.com
penguinmd.com penguinmd.com
pikecentralathletics.com pikecentralathletics.com
pikeroadathletics.org pikeroadathletics.org
pinckneypiratesathletics.com pinckneypiratesathletics.com
plattepirates.org plattepirates.org
pleasantonathletics.com pleasantonathletics.com
pottershousepumas.com pottershousepumas.com
prhslions.com prhslions.com
promotor.ro promotor.ro
pruebavelocidad.com pruebavelocidad.com
psychicmonday.com psychicmonday.com
puppyvilleq.info puppyvilleq.info
purejoyn.info purejoyn.info
pvhsathletics.com pvhsathletics.com
rattlernationathletics.com rattlernationathletics.com
raysofhopef.club raysofhopef.club
redanhighathletics.com redanhighathletics.com
PHOTLO.COM
IP History

Click the IP addresses to see over domains using them.