Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

REVIEWS.ROSEWOODFORTO.COM

REVIEWS.ROSEWOODFORTO.COM
Shared Attributes
Domain
whitelabelexample.com poctest2.whitelabelexample.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 230 days
beitzellfence.com review.beitzellfence.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Aug 2021 May 2022 276 days
ezchildtrack.com review.ezchildtrack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 Jan 2022 46 days
fusiononemarketing.com review.fusiononemarketing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 208 days
GTM GTM-5X7LXZJ Apr 2023 Jul 2023 105 days
lemonadestand.org review.lemonadestand.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
zuki.co.za review.zuki.co.za
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 266 days
reviewais.com reviewais.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewallstarmenifee.com reviewallstarmenifee.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewalt-tech.com reviewalt-tech.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Dec 2021 May 2022 158 days
reviewanthonywimpeyplumbing.com reviewanthonywimpeyplumbing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewaxiom.com reviewaxiom.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewbethanyinsurance.com reviewbethanyinsurance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewbuildonyourland.com reviewbuildonyourland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewbuschconsultinginc.com reviewbuschconsultinginc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 124 days
reviewenvisionconsulting.com reviewenvisionconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewfreshmanagedit.com reviewfreshmanagedit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewgalaxyit.com reviewgalaxyit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 May 2022 158 days
reviewgarageinnovations.com reviewgarageinnovations.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewgoingclearinteractive.com reviewgoingclearinteractive.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewgoodshepherdrv.com reviewgoodshepherdrv.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 74 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewgtgnetworks.com reviewgtgnetworks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 124 days
reviewhtandrc.com reviewhtandrc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewitsg.com reviewitsg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewkuntzlaw.com reviewkuntzlaw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewmellorlawfirm.com reviewmellorlawfirm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewmodcabinetry.com reviewmodcabinetry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewmorningsideplumbing.com reviewmorningsideplumbing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewneothink.com reviewneothink.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
reviewpatriotpestprescott.com reviewpatriotpestprescott.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewpierson-pierson.com reviewpierson-pierson.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 7 days
reviewpraxis.com reviewpraxis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewprotectionselfstorageprovo.com reviewprotectionselfstorageprovo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewrednightconsulting.com reviewrednightconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
autotrim-md.com reviews.autotrim-md.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 176 days
GTM GTM-PXPSMT4 Dec 2021 May 2022 140 days
barnumfloors.com reviews.barnumfloors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Oct 2021 May 2022 189 days
chattanoogafurnitureshop.com reviews.chattanoogafurnitureshop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 203 days
coldspringplasticsurgery.com reviews.coldspringplasticsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 216 days
eyedesignnewyork.com reviews.eyedesignnewyork.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 278 days
familyfirster.com reviews.familyfirster.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 Dec 2021 One Off
fencingdirect.com reviews.fencingdirect.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Nov 2021 Mar 2022 125 days
gilbertmdeyecare.com reviews.gilbertmdeyecare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 Apr 2022 227 days
graniteselection.com reviews.graniteselection.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 90 days
GTM GTM-PXPSMT4 Mar 2022 Mar 2022 One Off
gulfcoastvisioncenter.com reviews.gulfcoastvisioncenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 282 days
hamburgdentalcare.com reviews.hamburgdentalcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 64 days
haylor.com reviews.haylor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Aug 2021 May 2022 277 days
hearinghelpexpress.com reviews.hearinghelpexpress.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 Apr 2022 225 days
howefarmstn.com reviews.howefarmstn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jan 2022 May 2022 124 days
keysrealestate.com reviews.keysrealestate.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Nov 2021 May 2022 170 days
lakesidebrides.com reviews.lakesidebrides.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 Feb 2022 145 days
landscapingthegulfcoast.com reviews.landscapingthegulfcoast.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Dec 2023 252 days
langracing.com reviews.langracing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 287 days
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 112 days
morgancreekgolf.com reviews.morgancreekgolf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 252 days
mrtintinc.com reviews.mrtintinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 195 days
prsrentals.com reviews.prsrentals.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 150 days
GTM GTM-PXPSMT4 Oct 2021 May 2022 213 days
redwoods-golf.com reviews.redwoods-golf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
regencymorristown.com reviews.regencymorristown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
relocatetohuntsville.com reviews.relocatetohuntsville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 May 2022 212 days
GTM GTM-5X7LXZJ Apr 2023 Sep 2023 162 days
sanchezlawpa.com reviews.sanchezlawpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 Dec 2021 One Off
sferrawaterproofing.com reviews.sferrawaterproofing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 Feb 2022 83 days
shelbyparkmanorapts.com reviews.shelbyparkmanorapts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 222 days
snac.com reviews.snac.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
texasjohns.com reviews.texasjohns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 204 days
GTM GTM-PXPSMT4 Dec 2021 Apr 2022 118 days
theclosingagent.com reviews.theclosingagent.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 57 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 262 days
thegrindholmen.com reviews.thegrindholmen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 57 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 282 days
wujekcalcaterra.com reviews.wujekcalcaterra.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
wyckoffcomfort.com reviews.wyckoffcomfort.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Aug 2021 May 2022 279 days
reviewsolutionsindata.net reviewsolutionsindata.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Oct 2021 May 2022 212 days
reviewthrowerconcrete.com reviewthrowerconcrete.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 May 2022 May 2022 1 day
reviewtitletree.com reviewtitletree.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtwintel.com reviewtwintel.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Feb 2022 May 2022 74 days
iwdmarketing.com reviewus.iwdmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Feb 2022 Feb 2022 One Off
reviewwebertc.com reviewwebertc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
reviewwisechiropracticcenter.com reviewwisechiropracticcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewzing.com snlprime.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
reviewzing.com bathdoctor.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
watchboxreviews.com watchboxreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
chattanoogareviews.com chattanoogareviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 264 days
reviewzing.com elitetentsandevents.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
trentonforging.com employeereviews.trentonforging.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 58 days
GTM GTM-PXPSMT4 Dec 2021 Dec 2021 One Off
tintglass.com feedback.tintglass.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 57 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 282 days
reviewzing.com homewisepros.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jan 2022 Mar 2022 71 days
kawreviews.com kawreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
kcpier.reviews kcpier.reviews
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Feb 2022 May 2022 87 days
reviewzing.com kenstrans.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
prestigeautoreviews.com prestigeautoreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
bolemanlaw.com review.bolemanlaw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Aug 2021 May 2022 276 days
catalystfdg.com review.catalystfdg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Aug 2021 May 2022 263 days
inspiredindoorair.com review.inspiredindoorair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 189 days
GTM GTM-PXPSMT4 Apr 2022 Apr 2022 One Off
landscape-solutions.net review.landscape-solutions.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 228 days
njvvc.com review.njvvc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
sponzilli.com review.sponzilli.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 295 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 284 days
treesunlimitednj.com review.treesunlimitednj.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 58 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 281 days
xceedit.com review.xceedit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 8 days
zabace.com review.zabace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 151 days
reviewbearacandheating.com reviewbearacandheating.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewdcheadshots.com reviewdcheadshots.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewdmatechsolutions.com reviewdmatechsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
reviewdowntownbuildingservices.com reviewdowntownbuildingservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
reviewecosmartpools.com reviewecosmartpools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jul 2024 1 year, 92 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
revieweliteselfstorage.com revieweliteselfstorage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewgb.com reviewgb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewhollandmc.com reviewhollandmc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewinscnet.com reviewinscnet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
reviewinterstate70towing.com reviewinterstate70towing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewkoskovichandmurphy.com reviewkoskovichandmurphy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewnapoli.com reviewnapoli.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewofseyer.com reviewofseyer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewpawnshopconsulting.com reviewpawnshopconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewperryelectrical.com reviewperryelectrical.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewrhino-db.com reviewrhino-db.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewrikeshakeen.com reviewrikeshakeen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
abateproco.com reviews.abateproco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
alonti.com reviews.alonti.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 267 days
GTM GTM-5X7LXZJ Oct 2023 Oct 2023 One Off
assuritytitle.com reviews.assuritytitle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 176 days
awbroadband.net reviews.awbroadband.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Aug 2021 May 2022 268 days
bascomgrooms.com reviews.bascomgrooms.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
boardwalkcleaning.com reviews.boardwalkcleaning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 304 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 267 days
clocktower-dental.com reviews.clocktower-dental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Mar 2022 May 2022 58 days
cullomeyecenter.com reviews.cullomeyecenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Nov 2021 May 2022 184 days
drglasberg.com reviews.drglasberg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
flexabed.com reviews.flexabed.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 207 days
floridapm.net reviews.floridapm.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 280 days
hutchisonglassandmirror.com reviews.hutchisonglassandmirror.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Apr 2022 Apr 2022 One Off
industrialfastenersandsupply.com reviews.industrialfastenersandsupply.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 225 days
kandkheatingandcooling.com reviews.kandkheatingandcooling.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 139 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
keithheatingandair.com reviews.keithheatingandair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 287 days
medicallicensuregroup.com reviews.medicallicensuregroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 105 days
neolytix.com reviews.neolytix.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 146 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
regencybirmingham.com reviews.regencybirmingham.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
riverwoodretirement.com reviews.riverwoodretirement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
triplepeaksroofing.com reviews.triplepeaksroofing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 58 days
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
walkerheye.com reviews.walkerheye.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 60 days
GTM GTM-PXPSMT4 Aug 2021 May 2022 280 days
wehakeecampforgirls.com reviews.wehakeecampforgirls.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
westbycreamery.com reviews.westbycreamery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 265 days
reviewsimpleitsolutions.com reviewsimpleitsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewsqlwatchmen.com reviewsqlwatchmen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtelewire.com reviewtelewire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewthrottlenet.com reviewthrottlenet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewtochta.com reviewtochta.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtolarsystems.com reviewtolarsystems.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewvizualsymphony.com reviewvizualsymphony.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewwishartfamilylaw.com reviewwishartfamilylaw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewzing.com bayareawildlife.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Oct 2021 Jan 2022 102 days
reviewzing.com billianlaw.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jan 2022 Feb 2022 36 days
yoursmilepro.com yoursmilepro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 115 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 247 days
reviewzing.com deancamlin.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Oct 2021 May 2022 211 days
generalsolar.net feedback.generalsolar.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 126 days
GTM GTM-PXPSMT4 Feb 2022 May 2022 88 days
freshmealplanreviews.com freshmealplanreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 276 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 185 days
govbergreviews.com govbergreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 282 days
hhroofingreviews.com hhroofingreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 281 days
houselawreviews.com houselawreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 282 days
tshirtexpressreviews.com tshirtexpressreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 149 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 241 days
btmlawreviews.com btmlawreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 273 days
reviewzing.com dragonscale.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
thstattoo.com feedback.thstattoo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jun 2024 One Off
GTM GTM-PXPSMT4 Dec 2021 Dec 2021 One Off
reviewzing.com haganandsons.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
idlcompanyreviews.com idlcompanyreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 283 days
localbizreview.co localbizreview.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewascentdata.com reviewascentdata.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Mar 2022 182 days
GTM GTM-5X7LXZJ Jun 2024 Jul 2024 18 days
reviewaccountingpartners.com reviewaccountingpartners.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewamanica.com reviewamanica.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 111 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
angellaire.com review.angellaire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 175 days
frontiermarketingllc.com review.frontiermarketingllc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
mydoctorsf.com review.mydoctorsf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Mar 2024 337 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewaquospools.com reviewaquospools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewfusiontechnology.com reviewfusiontechnology.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 111 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewcan-restore.com reviewcan-restore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewcualtzinsalon.com reviewcualtzinsalon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jul 2024 1 year, 92 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewemdtec.com reviewemdtec.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
reviewmarinaj.com reviewmarinaj.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewmarketblazer.com reviewmarketblazer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewprotectionselfstorage.com reviewprotectionselfstorage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewquestworkspaces.com reviewquestworkspaces.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 7 days
alcoproductsinc.com reviews.alcoproductsinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 12 days
bartenmedia.com reviews.bartenmedia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 176 days
GTM GTM-PXPSMT4 Dec 2021 May 2022 139 days
biosweepal.com reviews.biosweepal.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Nov 2021 May 2022 188 days
callsouthernpridepestcontrol.com reviews.callsouthernpridepestcontrol.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2023 138 days
GTM GTM-PXPSMT4 Nov 2021 Nov 2021 One Off
comradeweb.com reviews.comradeweb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
cutlerrader.com reviews.cutlerrader.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 205 days
gandgconcrete.com reviews.gandgconcrete.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 267 days
elorenergy.com reviews.elorenergy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
factorfunding.com reviews.factorfunding.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 Apr 2022 112 days
greatfallsfamilydentistry.com reviews.greatfallsfamilydentistry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 209 days
islandwidechiropractic.com reviews.islandwidechiropractic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Mar 2022 Mar 2022 One Off
k-and-s.com reviews.k-and-s.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Nov 2021 Mar 2022 122 days
lakememorials.com reviews.lakememorials.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 287 days
lakesideweddings.com reviews.lakesideweddings.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
lasvegaswedding4u.com reviews.lasvegaswedding4u.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
lcifrederick.com reviews.lcifrederick.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Mar 2022 181 days
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 112 days
levelfinancing.com reviews.levelfinancing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Mar 2024 332 days
GTM GTM-PXPSMT4 Jan 2022 Jan 2022 One Off
nrilifeinsurance.com reviews.nrilifeinsurance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 254 days
GTM GTM-5X7LXZJ Jun 2023 Sep 2023 85 days
mywaterfl.com reviews.mywaterfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Sep 2024 1 year, 35 days
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 181 days
naveteam.com reviews.naveteam.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 146 days
GTM GTM-PXPSMT4 Mar 2022 Mar 2022 One Off
parakhplasticsurgery.com reviews.parakhplasticsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 149 days
GTM GTM-PXPSMT4 Oct 2021 Mar 2022 176 days
pismohomes.com reviews.pismohomes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 May 2022 213 days
GTM GTM-5X7LXZJ Apr 2023 Jul 2023 76 days
qcplasticsurgeons.com reviews.qcplasticsurgeons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 150 days
GTM GTM-PXPSMT4 May 2022 May 2022 One Off
regencyretirementjackson.com reviews.regencyretirementjackson.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 222 days
rmsaccounting.com reviews.rmsaccounting.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
royalpalmacademy.com reviews.royalpalmacademy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 May 2022 157 days
seekmomentum.com reviews.seekmomentum.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 May 2022 156 days
shinedentalgroup.com reviews.shinedentalgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 267 days
weightlosssurgeryla.com reviews.weightlosssurgeryla.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Dec 2023 Sep 2024 268 days
smilesimdmd.com reviews.smilesimdmd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 285 days
theheritagedowntown.com reviews.theheritagedowntown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 57 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
theinternationalkitchen.com reviews.theinternationalkitchen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 267 days
treeringdigital.com reviews.treeringdigital.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 58 days
GTM GTM-PXPSMT4 Jul 2021 Oct 2021 96 days
troylegalpa.com reviews.troylegalpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Jun 2024 1 year, 14 days
GTM GTM-PXPSMT4 Oct 2021 Apr 2022 167 days
turnerhomefl.com reviews.turnerhomefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 58 days
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 194 days
wilderness.co.nz reviews.wilderness.co.nz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Aug 2021 Apr 2022 248 days
waterfrontplayhouse.org reviews.waterfrontplayhouse.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtki.com reviewtki.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 111 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewwhartonrentals.com reviewwhartonrentals.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewsingerandfalk.com reviewsingerandfalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jul 2024 1 year, 92 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewslaterbrotherswelldrilling.com reviewslaterbrotherswelldrilling.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewsoarvacationrental.com reviewsoarvacationrental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 May 2024 1 year, 39 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewsolaceemotional.com reviewsolaceemotional.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewstasmayer.com reviewstasmayer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtatefireplaces.com reviewtatefireplaces.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 229 days
bohannonservices.com review.bohannonservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 202 days
GTM GTM-5X7LXZJ Nov 2023 Nov 2023 One Off
fusionmanagedit.com review.fusionmanagedit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 May 2024 1 year, 40 days
GTM GTM-PXPSMT4 Nov 2021 May 2022 178 days
lumberjax.com review.lumberjax.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 Mar 2022 179 days
renownedbuildingsolutions.com review.renownedbuildingsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 May 2022 212 days
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 121 days
sonjaphoto.com review.sonjaphoto.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 249 days
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 203 days
sudburygraniteandmarble.com review.sudburygraniteandmarble.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 283 days
GTM GTM-5X7LXZJ Apr 2023 Dec 2023 242 days
reviewadvancare.com reviewadvancare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 7 days
reviewallstarhemet.com reviewallstarhemet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jul 2024 1 year, 92 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewamericanpestmanagement.com reviewamericanpestmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 124 days
reviewancgroup.com reviewancgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewatlantaplumbersguild.com reviewatlantaplumbersguild.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 124 days
reviewbrightlineit.com reviewbrightlineit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
reviewdatataptech.com reviewdatataptech.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewelitecarpaltunnel.com reviewelitecarpaltunnel.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 May 2022 May 2022 1 day
reviewfhstickles.com reviewfhstickles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewgenosseweranddrains.com reviewgenosseweranddrains.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewhenderson.com reviewhenderson.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewicherishhomecare.com reviewicherishhomecare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewindiestudiosuites.com reviewindiestudiosuites.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewironedge.com reviewironedge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewisgtech.com reviewisgtech.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewitology.com reviewitology.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 111 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewmonarchfamilylaw.com reviewmonarchfamilylaw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewnorthpoledental.com reviewnorthpoledental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewpoolicons.com reviewpoolicons.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewresultstech.com reviewresultstech.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewrjggroup.com reviewrjggroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
acswfl.com reviews.acswfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
advancedendocare.com reviews.advancedendocare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 268 days
americanlegacyfishing.com reviews.americanlegacyfishing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
americantent.com reviews.americantent.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 267 days
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 12 days
bethesdahomedesign.com reviews.bethesdahomedesign.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
bioservusa.com reviews.bioservusa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Feb 2022 Mar 2022 35 days
cougardigitalmarketing.com reviews.cougardigitalmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Mar 2022 Mar 2022 One Off
earthdevelopmentinc.com reviews.earthdevelopmentinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 62 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
espwindowtint.com reviews.espwindowtint.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 278 days
GTM GTM-5X7LXZJ Apr 2023 Sep 2023 145 days
floridapestcontrolcenter.com reviews.floridapestcontrolcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 280 days
GTM GTM-5X7LXZJ Apr 2023 Sep 2023 146 days
golfoaks.com reviews.golfoaks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Mar 2022 Apr 2022 39 days
happytrailersales.com reviews.happytrailersales.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 197 days
home4rent.com reviews.home4rent.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Aug 2021 May 2022 276 days
honeybrookgolf.com reviews.honeybrookgolf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
houseofair.com reviews.houseofair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 151 days
infinitytransportation.net reviews.infinitytransportation.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Nov 2023 Sep 2024 304 days
GTM GTM-PXPSMT4 Apr 2022 Apr 2022 One Off
internetmarketingllc.com reviews.internetmarketingllc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 136 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 247 days
islanddentalassociates.com reviews.islanddentalassociates.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Feb 2022 Apr 2022 73 days
legacypestcontrolaz.com reviews.legacypestcontrolaz.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Apr 2022 Apr 2022 One Off
longislandaccident.com reviews.longislandaccident.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Sep 2024 1 year, 123 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 288 days
mosesmousereye.com reviews.mosesmousereye.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Sep 2021 May 2022 221 days
neplumbing.net reviews.neplumbing.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 146 days
GTM GTM-PXPSMT4 Jan 2022 May 2022 115 days
ocoeeoralsurgery.com reviews.ocoeeoralsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 292 days
ohioinjurylaw.com reviews.ohioinjurylaw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Oct 2021 May 2022 214 days
perfectlocks.com reviews.perfectlocks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 Apr 2022 35 days
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 9 days
powerwashingman.com reviews.powerwashingman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 294 days
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 198 days
redskiesyoga.com reviews.redskiesyoga.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 222 days
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 99 days
regencyhuntsville.com reviews.regencyhuntsville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Oct 2021 May 2022 212 days
regencytuscaloosa.com reviews.regencytuscaloosa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
sdakotainternet.com reviews.sdakotainternet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Oct 2021 May 2022 210 days
shellislandshuttle.com reviews.shellislandshuttle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 294 days
socialfirm.com reviews.socialfirm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 131 days
sugarshackholmen.com reviews.sugarshackholmen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 May 2023 42 days
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
summitcommercialroofing.com reviews.summitcommercialroofing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Apr 2022 Apr 2022 One Off
techfirefly.com reviews.techfirefly.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 282 days
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 127 days
theblugroup.com reviews.theblugroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 57 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
thesalonatlakeside.com reviews.thesalonatlakeside.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 248 days
yatesind.com reviews.yatesind.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 231 days
reviewsimplesystemsutah.com reviewsimplesystemsutah.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewstrategiccares.com reviewstrategiccares.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
reviewsysarc.com reviewsysarc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtechrockstars.com reviewtechrockstars.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtms.com reviewtms.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 May 2024 1 year, 39 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtrinware.com reviewtrinware.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
brooksfieldschool.org review.brooksfieldschool.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 Apr 2022 114 days
reviewzing.com americanheritage.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
teagueelectricreviews.com teagueelectricreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 237 days
comancheexcellence.com comancheexcellence.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 275 days
reviewzing.com dkrus.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
reviewzing.com freedominsurance.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
fusionelectricreviews.com fusionelectricreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 277 days
GTM GTM-5X7LXZJ Apr 2023 Dec 2023 234 days
cavewebworks.com review.cavewebworks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Dec 2021 Mar 2022 77 days
hinklehardscapes.reviews hinklehardscapes.reviews
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewzing.com kpwildlifecontrol.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
reviewzing.com marylandmobilevet.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
instamaids.com rating.instamaids.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewzing.com mrunkph.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
reviewzing.com nadeck.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Aug 2023 One Off
ckpanhandle.com review.ckpanhandle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2023 Sep 2024 1 year, 54 days
elavatere.com review.elavatere.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
netvisits.com review.netvisits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jun 2024 One Off
pagnissealcoating.net review.pagnissealcoating.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 One Off
pinkroofing.com review.pinkroofing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 One Off
procutfirewood.com review.procutfirewood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2023 Sep 2024 353 days
reviewacehomeservicesrepair.com reviewacehomeservicesrepair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
reviewbsgutter.com reviewbsgutter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewcareathomellc.com reviewcareathomellc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Aug 2023 58 days
reviewcommonangle.com reviewcommonangle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
reviewdrfallonspractice.com reviewdrfallonspractice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Jun 2024 59 days
revieweaglecollision.com revieweaglecollision.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Aug 2024 1 year, 6 days
reviewelixistechnology.com reviewelixistechnology.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2024 Aug 2024 19 days
reviewfirststorage.com reviewfirststorage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Aug 2024 37 days
reviewfleurandstems.com reviewfleurandstems.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 117 days
reviewfusionpaintsupply.com reviewfusionpaintsupply.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2024 Jul 2024 One Off
reviewgiaspace.com reviewgiaspace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Aug 2024 56 days
reviewjpthegeek.com reviewjpthegeek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
reviewkaufmanit.com reviewkaufmanit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 7 days
reviewkramerpools.com reviewkramerpools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 124 days
reviewliquiduspools.com reviewliquiduspools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Aug 2024 37 days
reviewnaturalwonders.com reviewnaturalwonders.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 78 days
reviewonboardit.com reviewonboardit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 145 days
reviewparadiseclimatestorage.com reviewparadiseclimatestorage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 123 days
reviewpittmansupply.com reviewpittmansupply.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Oct 2023 Sep 2024 328 days
axlehire.com reviews.axlehire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 62 days
cyclonecontracting.com reviews.cyclonecontracting.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Oct 2023 Sep 2024 336 days
dwiteam.com reviews.dwiteam.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Sep 2024 1 year, 93 days
ecotectpest.com reviews.ecotectpest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2023 Nov 2023 76 days
generationstrenchless.com reviews.generationstrenchless.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2024 Sep 2024 26 days
haciendapools.net reviews.haciendapools.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2023 May 2024 258 days
loganmasterappliance.com reviews.loganmasterappliance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2023 Sep 2024 363 days
longfence.com reviews.longfence.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 91 days
mnplumbingandhomeservices.com reviews.mnplumbingandhomeservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 104 days
ptsdfw.com reviews.ptsdfw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Mar 2024 Jun 2024 73 days
refreshoh.com reviews.refreshoh.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Aug 2023 One Off
rockrecoverycenter.com reviews.rockrecoverycenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 One Off
shepherdroofingrenovations.com reviews.shepherdroofingrenovations.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2023 165 days
southerncrawlspace.com reviews.southerncrawlspace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 203 days
springerfloorcare.com reviews.springerfloorcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 150 days
stacyssensorysolutions.com reviews.stacyssensorysolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Dec 2023 Jun 2024 179 days
theabbittgroup.com reviews.theabbittgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jun 2024 One Off
trentonforging.com reviews.trentonforging.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jun 2024 One Off
websitesmia.com reviews.websitesmia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
reviewsouthpointpest.com reviewsouthpointpest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
reviewstabilitynetworks.com reviewstabilitynetworks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 124 days
reviewsustainable-restoration.com reviewsustainable-restoration.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jul 2024 18 days
reviewthemeadowsraleigh.com reviewthemeadowsraleigh.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Sep 2024 219 days
reviewthreatalliance.com reviewthreatalliance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Aug 2024 56 days
reviewunityit.com reviewunityit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jul 2024 1 year, 92 days
reviewutwindowexperts.com reviewutwindowexperts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewvoicendatasolutions.net reviewvoicendatasolutions.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Sep 2024 219 days
reviewwizardcpu.com reviewwizardcpu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Aug 2024 96 days
reviewzing.com advantageim.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
reviewzing.com arhdecks.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Nov 2023 Mar 2024 146 days
reviewzing.com unlimitedunderground.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Sep 2024 1 year, 113 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

alcofenceco.com fairmont.alcofenceco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jul 2023 91 days
woodsonedu.com feedback.woodsonedu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 144 days
reviewzing.com flourishbeautystudio.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Sep 2024 1 year, 113 days
dany-holiday.com gztji.dany-holiday.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2023 Sep 2024 1 year, 47 days
reviewzing.com marylandprivatemortgage.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

powersealerllc.review powersealerllc.review
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Aug 2021 43 days
renterspowerhouse.com review-me.renterspowerhouse.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 May 2022 212 days
eliterolloff.com review.eliterolloff.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Sep 2021 One Off
lawndoctordenver.com review.lawndoctordenver.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 Nov 2021 One Off
shaveunion.co.za review.shaveunion.co.za
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
ziamediagroup.com review.ziamediagroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Aug 2021 One Off
reviewabletransportsolutions.com reviewabletransportsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 229 days
reviewbestrooferil.com reviewbestrooferil.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Mar 2022 182 days
reviewcabinet-wholesalers.com reviewcabinet-wholesalers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 186 days
reviewdavidshouseofdiamonds.com reviewdavidshouseofdiamonds.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewfullerwenteinc.com reviewfullerwenteinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewlandcautoandtire.com reviewlandcautoandtire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Mar 2022 182 days
reviewlegacybydesign.com reviewlegacybydesign.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 47 days
reviewpizzeriadimaria.com reviewpizzeriadimaria.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 138 days
airmedicsac.com reviews.airmedicsac.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 May 2022 272 days
allfleettowing.com reviews.allfleettowing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 May 2022 191 days
allinfamilymed.com reviews.allinfamilymed.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Dec 2021 130 days
burtonasphalt.com reviews.burtonasphalt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
chirocareflorida.com reviews.chirocareflorida.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 274 days
choraltracks.com reviews.choraltracks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
dwiguy.com reviews.dwiguy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 166 days
eagleeyemedia.net reviews.eagleeyemedia.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 Mar 2022 One Off
empowerfcu.com reviews.empowerfcu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 151 days
engleservicesheatingandair.com reviews.engleservicesheatingandair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 May 2022 180 days
everwellrx.com reviews.everwellrx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 278 days
flaircommunication.com reviews.flaircommunication.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 280 days
floridafoundationauthority.com reviews.floridafoundationauthority.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 242 days
foundationrecoverysystems.com reviews.foundationrecoverysystems.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 280 days
janescherrn.com reviews.janescherrn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 285 days
kpmrestoration.com reviews.kpmrestoration.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 67 days
maxwellbuildingservices.com reviews.maxwellbuildingservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 May 2022 166 days
oahupropainters.com reviews.oahupropainters.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 254 days
omniacreativestudio.com reviews.omniacreativestudio.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 254 days
pettispools.com reviews.pettispools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Jan 2022 104 days
pfeifferautoclinic.com reviews.pfeifferautoclinic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 38 days
precisioncarpet.net reviews.precisioncarpet.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 221 days
realnets.com reviews.realnets.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 295 days
srstintandgraphics.com reviews.srstintandgraphics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 213 days
stickyfingers.com reviews.stickyfingers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Aug 2021 One Off
tamakilaw.com reviews.tamakilaw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 131 days
tarheelbasementsystems.com reviews.tarheelbasementsystems.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 248 days
tomatinos.com reviews.tomatinos.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
virginiadentalcenter.com reviews.virginiadentalcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
webpropulsion.com reviews.webpropulsion.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Aug 2021 One Off
welterconstruction.com reviews.welterconstruction.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Apr 2022 248 days
whitespestcontrol.net reviews.whitespestcontrol.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Dec 2021 Dec 2021 One Off
reviewsinglepointglobal.com reviewsinglepointglobal.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
reviewsmallworldbigfun.com reviewsmallworldbigfun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewsyzygy3.com reviewsyzygy3.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewterminalb.com reviewterminalb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewwavetechnologies.com reviewwavetechnologies.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 229 days
reviewyourtridental.com reviewyourtridental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewzirous.com reviewzirous.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Feb 2022 May 2022 74 days
reviewzing.com rossalbers.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 186 days
abcsidingreviews.com abcsidingreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 252 days
reviewzing.com commerciallyclean.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
stylestrandmedia.com discovernchomes-reviews.stylestrandmedia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
shift32.com feedback.shift32.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 294 days
heartlanddecksreviews.com heartlanddecksreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 273 days
reviewzing.com kentclean.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jan 2022 Mar 2022 71 days
reviewzing.com kccs.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Nov 2023 Sep 2024 316 days
leaveiconareview.com leaveiconareview.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 11 days
excellentautoglass.com review.excellentautoglass.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2024 Sep 2024 31 days
saundersls.com review.saundersls.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 99 days
review3kingsplumbing.com review3kingsplumbing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Sep 2024 214 days
reviewaquamasters.com reviewaquamasters.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2024 Sep 2024 22 days
reviewbeartechit.com reviewbeartechit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 One Off
reviewbuildeuropean.com reviewbuildeuropean.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Oct 2023 Jun 2024 236 days
reviewdiamondducts.com reviewdiamondducts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Oct 2023 Jun 2024 236 days
reviewdowntownwindowcleaning.com reviewdowntownwindowcleaning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 78 days
reviewdupreeplumbing.com reviewdupreeplumbing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jul 2024 1 year, 92 days
reviewgenerationix.com reviewgenerationix.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 59 days
reviewgovernmentauction.com reviewgovernmentauction.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
reviewgxait.com reviewgxait.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 74 days
reviewhrct.com reviewhrct.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 145 days
reviewitforscrubs.com reviewitforscrubs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 111 days
reviewknoxstoragealcoa.com reviewknoxstoragealcoa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Jul 2024 159 days
reviewkr.com reviewkr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Aug 2024 354 days
reviewmagview.com reviewmagview.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewnebraskahomepediatrics.com reviewnebraskahomepediatrics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 59 days
reviewnoftek.com reviewnoftek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
reviewomniic.com reviewomniic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 5 days
allianceinvestigating.com reviews.allianceinvestigating.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Oct 2023 142 days
hoalegal.com reviews.hoalegal.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2023 Sep 2024 1 year, 3 days
javavinolax.com reviews.javavinolax.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Sep 2024 109 days
jlsinc.net reviews.jlsinc.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
kingmetals.com reviews.kingmetals.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 91 days
omegapestsolution.com reviews.omegapestsolution.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Mar 2024 Mar 2024 One Off
rockfordhomes.net reviews.rockfordhomes.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
roofsaverstricities.com reviews.roofsaverstricities.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
rotorooterga.com reviews.rotorooterga.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2023 Dec 2023 160 days
runnetworkrun.com reviews.runnetworkrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 99 days
shredsmartusa.com reviews.shredsmartusa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 98 days
srlawpa.com reviews.srlawpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
treeprosonoma.com reviews.treeprosonoma.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jun 2024 One Off
urbantreemanagement.com reviews.urbantreemanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 93 days
vistalandscapingofbft.com reviews.vistalandscapingofbft.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Aug 2023 One Off
reviewsdriven.com reviewsdriven.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Nov 2023 Sep 2024 317 days
reviewsmileitdental.com reviewsmileitdental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 5 days
reviewspotteddog.coffee reviewspotteddog.coffee
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 May 2024 1 year, 27 days
reviewusresources.com reviewusresources.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 73 days
reviewvisualdatacloud.com reviewvisualdatacloud.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewwallaceexcavatingco.com reviewwallaceexcavatingco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
reviewzunigapools.com reviewzunigapools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
tookdress.com tookdress.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Apr 2024 310 days
jiuhongwang.com wazjj.jiuhongwang.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 14 days
disastercleanup.com feedback.disastercleanup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Sep 2024 116 days
post-frame.com feedback.post-frame.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 150 days
kcwebdesign.reviews kcwebdesign.reviews
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewzing.com mde.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jan 2022 Jan 2022 One Off
reviewzing.com playersfunzone.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Dec 2021 Jan 2022 48 days
controlconceptstexas.com review.controlconceptstexas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Apr 2022 Apr 2022 One Off
crockermovingservices.com review.crockermovingservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 163 days
hotboxcookingwood.com review.hotboxcookingwood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 Mar 2022 124 days
inadaysmiledentalimplantcenter.com review.inadaysmiledentalimplantcenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 284 days
kwikkarautoservices.com review.kwikkarautoservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 229 days
walterclark.com review.walterclark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Aug 2021 One Off
reviewadvancedmoving.com reviewadvancedmoving.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 138 days
reviewbarrwood.com reviewbarrwood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 186 days
reviewchoicesolutions.com reviewchoicesolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewclosetsdesignstudio.com reviewclosetsdesignstudio.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 May 2022 212 days
reviewcorrectoralcare.com reviewcorrectoralcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
reviewdentaldash.co reviewdentaldash.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
reviewgbsi.com reviewgbsi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 Mar 2022 One Off
reviewhandsofheartland.com reviewhandsofheartland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewnovustek.com reviewnovustek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
aacompanies.com reviews.aacompanies.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Oct 2021 104 days
advancedhomecomfort.com reviews.advancedhomecomfort.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 63 days
afsrepair.com reviews.afsrepair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 267 days
ampofny.com reviews.ampofny.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 197 days
angelhomehealthcare.com reviews.angelhomehealthcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jan 2022 May 2022 97 days
artisticaudioentertainment.com reviews.artisticaudioentertainment.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 May 2022 270 days
aultmanlawpllc.com reviews.aultmanlawpllc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Feb 2022 May 2022 96 days
aurumcontracting.com reviews.aurumcontracting.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 May 2022 269 days
basementsbybq.com reviews.basementsbybq.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Dec 2021 May 2022 139 days
cashautosalvage.com reviews.cashautosalvage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
completebasementsystems.net reviews.completebasementsystems.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 May 2022 257 days
danielswaterproofing.com reviews.danielswaterproofing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Feb 2022 Feb 2022 One Off
deluxeplumbing.com reviews.deluxeplumbing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
dfwprophoto.com reviews.dfwprophoto.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Apr 2022 May 2022 20 days
dkm.agency reviews.dkm.agency
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 205 days
gaudylaw.com reviews.gaudylaw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 53 days
gc.plumbing reviews.gc.plumbing
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Aug 2021 One Off
gobonafide.com reviews.gobonafide.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Apr 2022 227 days
lplenterprises.com reviews.lplenterprises.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Nov 2021 59 days
mistbodybar.com reviews.mistbodybar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 75 days
patriotair.com reviews.patriotair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 293 days
ridofitvancouver.ca reviews.ridofitvancouver.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
rockpmc.com reviews.rockpmc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
serenitywatersspa.com reviews.serenitywatersspa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 258 days
sleep-tech.net reviews.sleep-tech.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
soflasolar.com reviews.soflasolar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Dec 2021 Feb 2022 83 days
syracusenybride.com reviews.syracusenybride.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Dec 2021 Dec 2021 One Off
themobstopholmen.com reviews.themobstopholmen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
treeshades.com reviews.treeshades.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
tylericasystems.com reviews.tylericasystems.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtalenttermite.com reviewtalenttermite.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 229 days
ericksrealty.com reviewus.ericksrealty.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Nov 2021 116 days
myqualityroof.com reviewus.myqualityroof.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 76 days
trecpro.com reviewus.trecpro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 15 days
reviewutahluxurytours.com reviewutahluxurytours.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
woodchuckdelivery.com reviews.woodchuckdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
aetreereviews.com aetreereviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 253 days
skylinee3.reviews skylinee3.reviews
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewzing.com springboard.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jan 2022 Mar 2022 71 days
copiavineyards.com thank-you.copiavineyards.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Feb 2022 Apr 2022 71 days
bobhamilton.reviews bobhamilton.reviews
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 260 days
barronbraces.com feedback.barronbraces.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Aug 2021 28 days
pawindowtint.com feedback.pawindowtint.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Feb 2022 141 days
reifmanlawfirm.com feedback.reifmanlawfirm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Mar 2022 174 days
tier1vet.com feedback.tier1vet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 14 days
reviewzing.com customdeckbuilders.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
barron-industries.com employees.barron-industries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2024 Sep 2024 60 days
giareviews.com giareviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
hamiltonize.com hamiltonize.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Sep 2024 1 year, 88 days
reviewzing.com lcirecycling.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
leave-a-review.com.au leave-a-review.com.au
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 53 days
reviewa1qualityheatac.com reviewa1qualityheatac.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
reviewabovetherimplumber.com reviewabovetherimplumber.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Jun 2024 354 days
reviewadrytech.com reviewadrytech.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 111 days
reviewainmd.com reviewainmd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
xponent21.com review.xponent21.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
revieweyesighthawaii.com revieweyesighthawaii.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Aug 2024 197 days
reviewfortisfire.com reviewfortisfire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 117 days
reviewgorillaboxtough.com reviewgorillaboxtough.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 111 days
reviewheartlandtowingrecovery.net reviewheartlandtowingrecovery.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
reviewbreadcrumbcyber.com reviewbreadcrumbcyber.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Jun 2024 354 days
reviewcdpest.com reviewcdpest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
reviewchattywire.com reviewchattywire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
reviewcopecosmeticderm.com reviewcopecosmeticderm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2024 Sep 2024 41 days
reviewcustommotowheels.com reviewcustommotowheels.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Sep 2024 1 year, 28 days
reviewcyopsecurity.com reviewcyopsecurity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Apr 2023 7 days
reviewdestinationinspiration.com reviewdestinationinspiration.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 May 2024 1 year, 20 days
reviewelmwoodselfstorage.com reviewelmwoodselfstorage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 May 2024 1 year, 27 days
reviewmicalline.com reviewmicalline.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Sep 2024 219 days
reviewmwcompanies.com reviewmwcompanies.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 May 2024 1 year, 39 days
reviewmyrsi.com reviewmyrsi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Sep 2024 1 year, 28 days
reviewparagonpartnersco.com reviewparagonpartnersco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jul 2024 18 days
reviewpooltch.com reviewpooltch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Oct 2023 Jun 2024 236 days
reviewrapidrentals.com reviewrapidrentals.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Sep 2024 137 days
reviewrvfmillsriver.com reviewrvfmillsriver.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Feb 2024 One Off
atdsolar.com reviews.atdsolar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 213 days
bocaratonestatelawyer.com reviews.bocaratonestatelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2024 Sep 2024 48 days
captainpestpatrol.com reviews.captainpestpatrol.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Oct 2023 162 days
gainesvilleaudiologist.com reviews.gainesvilleaudiologist.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2023 Sep 2023 One Off
intelinetsystems.com reviews.intelinetsystems.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2023 Sep 2024 1 year, 64 days
iwantscrap.com reviews.iwantscrap.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 226 days
jarvisfirm.com reviews.jarvisfirm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Dec 2023 Sep 2024 282 days
pagenstechergroup.com reviews.pagenstechergroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 148 days
raygidich.com reviews.raygidich.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 One Off
recloans360.com reviews.recloans360.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 99 days
royalemanagement.com reviews.royalemanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Sep 2024 1 year, 114 days
shrenovations.org reviews.shrenovations.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
smartconcepts.co reviews.smartconcepts.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Nov 2023 Nov 2023 One Off
thejerryreidagency.com reviews.thejerryreidagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Nov 2023 Nov 2023 One Off
reviewselfstoragenc.com reviewselfstoragenc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Mar 2024 Sep 2024 171 days
zavazonepotomacmills.com reviews.zavazonepotomacmills.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
reviews90.com reviews90.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Feb 2024 One Off
reviewsafetynetinc.com reviewsafetynetinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
reviewtjtravelcenters.com reviewtjtravelcenters.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Mar 2024 May 2024 46 days
reviewtommysglass.net reviewtommysglass.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
reviewtotalit.com reviewtotalit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 147 days
reviewskilcheck.com reviewskilcheck.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Oct 2023 May 2024 220 days
reviewtamissalon.com reviewtamissalon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
reviewtaylormadepools.com reviewtaylormadepools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jul 2024 1 year, 92 days
iwdmarketing.com pppreviews.iwdmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
smokingpigreport.com smokingpigreport.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 55 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

reviewzing.com spotswoodtrailmassage.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Dec 2021 Mar 2022 119 days
reviewzing.com winterton.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 186 days
mybluewateradventures.com feedback.mybluewateradventures.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 291 days
pghwindowfilm.com feedback.pghwindowfilm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Nov 2021 56 days
solartint.com feedback.solartint.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 285 days
feedbackforbudgetblinds.com feedbackforbudgetblinds.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 275 days
feedbackforron.com feedbackforron.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 198 days
reviewzing.com freedommobility.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
reviewzing.com generalautoservice.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Jan 2022 102 days
reviewaceplumbing.com reviewaceplumbing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewallisontranstech.com reviewallisontranstech.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
digitalhyve.com review.digitalhyve.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 276 days
nmdreamhouse.com review.nmdreamhouse.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Nov 2021 55 days
riceac.com review.riceac.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
reviewgreenwire.com reviewgreenwire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 229 days
reviewicscomplete.com reviewicscomplete.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewcornelsplumbing.com reviewcornelsplumbing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
reviewinet.com reviewinet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 229 days
reviewk2techgroup.com reviewk2techgroup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewmaplandandhomes.com reviewmaplandandhomes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 47 days
reviewmidstateohd.com reviewmidstateohd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewmiu.com reviewmiu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 47 days
reviewnetworkprovidence.com reviewnetworkprovidence.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewofficialfinders.com reviewofficialfinders.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Mar 2022 210 days
reviewomnisrehab.com reviewomnisrehab.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewourvineyard.com reviewourvineyard.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 47 days
reviewrts.com reviewrts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
advanceacmiami.com reviews.advanceacmiami.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Oct 2021 104 days
allfleetinc.com reviews.allfleetinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
bluecorddynamics.com reviews.bluecorddynamics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Dec 2021 128 days
countryfootcare.com reviews.countryfootcare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 Apr 2022 36 days
darleysplumbing.com reviews.darleysplumbing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Aug 2021 42 days
dentistsinalexandria.com reviews.dentistsinalexandria.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 276 days
drymich.com reviews.drymich.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
elite-dental.com reviews.elite-dental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
greaternewhavenobgyn.net reviews.greaternewhavenobgyn.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Apr 2022 226 days
hartdesign.com reviews.hartdesign.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 58 days
jessicadumas.net reviews.jessicadumas.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 248 days
junkcarmedics.com reviews.junkcarmedics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 232 days
kwikkarautoservices.com reviews.kwikkarautoservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 229 days
ohiobasementauthority.com reviews.ohiobasementauthority.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 182 days
orcawhalewatch.com reviews.orcawhalewatch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 293 days
matthewkellyassociates.com reviews.matthewkellyassociates.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 289 days
sealytractor.com reviews.sealytractor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
rhhomeslimited.com reviews.rhhomeslimited.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
saharagrill.com reviews.saharagrill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
seattlethera.com reviews.seattlethera.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
secretweapondigital.com reviews.secretweapondigital.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Feb 2022 Apr 2022 35 days
shophondacity.com reviews.shophondacity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
tonigagehomes.com reviews.tonigagehomes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Feb 2022 May 2022 69 days
windowdecor.com reviews.windowdecor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Dec 2021 132 days
dextercompany.com reviewscstat.dextercompany.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Aug 2021 43 days
ylaw.co reviews.ylaw.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Aug 2021 One Off
webpropulsion.com reviewsteleconsultants.webpropulsion.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Aug 2021 17 days
reviewteamlogicsantarosa.com reviewteamlogicsantarosa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 229 days
reviewteamrehab.com reviewteamrehab.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Oct 2021 84 days
reviewtekscape.com reviewtekscape.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 67 days
reviewchuckitinstorage.com reviewchuckitinstorage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Oct 2023 60 days
reviewcloud9detail.com reviewcloud9detail.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 73 days
reviewcurrentteksolutions.com reviewcurrentteksolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Sep 2024 1 year, 86 days
reviewdatotechnologysolutions.com reviewdatotechnologysolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2024 Jul 2024 One Off
reviewdiversified-is.com reviewdiversified-is.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Aug 2024 115 days
reviewforuminfotech.com reviewforuminfotech.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2024 1 year, 130 days
reviewfourspc.com reviewfourspc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Feb 2024 Sep 2024 219 days
reviewhandhtreeservice.com reviewhandhtreeservice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Feb 2024 298 days
reviewlandmarksignusa.com reviewlandmarksignusa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Aug 2024 1 year, 64 days
reviewmcclureandstewart.com reviewmcclureandstewart.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
reviewmikehansenroofing.com reviewmikehansenroofing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
reviewniceandneathomes.com reviewniceandneathomes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewnorthtexasstorage.net reviewnorthtexasstorage.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 145 days
reviewolympicstorage.com reviewolympicstorage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewpartyrentalca.com reviewpartyrentalca.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Jun 2024 40 days
seniorhelpers.com reviews-fhmi.seniorhelpers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Sep 2024 91 days
barron-industries.com reviews.barron-industries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jul 2024 Sep 2024 60 days
buenavistawildlifesafari.com reviews.buenavistawildlifesafari.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Oct 2023 Jul 2024 292 days
chillsquad.com reviews.chillsquad.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
conserv-air.com reviews.conserv-air.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2024 Sep 2024 39 days
finalcutroofing.com reviews.finalcutroofing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Oct 2023 184 days
garbetthomes.com reviews.garbetthomes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
hpmlawyers.com reviews.hpmlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
kitchencabinetguys.net reviews.kitchencabinetguys.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Sep 2024 107 days
lmminc.com reviews.lmminc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Sep 2024 1 year, 72 days
motorhomesforsale.co.nz reviews.motorhomesforsale.co.nz
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
northtexasluxurylawns.com reviews.northtexasluxurylawns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jun 2024 One Off
olivecoffeecart.com reviews.olivecoffeecart.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Dec 2023 Sep 2024 278 days
pcunw.com reviews.pcunw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 149 days
riverworksmarketing.com reviews.riverworksmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
shepherd-electric.net reviews.shepherd-electric.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Nov 2023 202 days
skintightmedspa.com reviews.skintightmedspa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Nov 2023 Sep 2024 315 days
reviewsidedumpindustries.com reviewsidedumpindustries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 66 days
reviewstehlfamilydental.com reviewstehlfamilydental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
reviewswimstatepoolservice.com reviewswimstatepoolservice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 117 days
reviewtechnologybeyond.com reviewtechnologybeyond.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2024 1 year, 55 days
reviewtimelesspools.com reviewtimelesspools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Aug 2024 37 days
reviewvelocityit.com reviewvelocityit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2024 Sep 2024 5 days
reviewvfsfire.com reviewvfsfire.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Jun 2023 59 days
reviewzerorezwasatchback.com reviewzerorezwasatchback.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2024 Jul 2024 18 days
seoye7.com seoye7.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Sep 2024 1 year, 112 days
hijoushiki.net uovuf.hijoushiki.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Sep 2023 Mar 2024 176 days
alcofenceco.com vienna.alcofenceco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2023 Oct 2023 144 days
bradleyreviews.com bradleyreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ May 2024 Sep 2024 93 days
nvmanba.com yxnac.nvmanba.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Jun 2023 Sep 2024 1 year, 73 days
🚫 Removed

This specific domain was removed from BuiltWith so we can't show the history sorry.

michigantherapyinstitute.com feedback.michigantherapyinstitute.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Aug 2023 Sep 2024 1 year, 37 days
pulaskilawfirm.com feedback.pulaskilawfirm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Aug 2023 120 days
reviewzing.com patriotpools.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
reviewzing.com platinumexteriors.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 151 days
whitelabelexample.com poctest.whitelabelexample.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-5X7LXZJ Apr 2023 Sep 2024 1 year, 152 days
absairinc.com review.absairinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 May 2022 273 days
blackpearlva.com review.blackpearlva.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 202 days
northernillinoisrecovery.com review.northernillinoisrecovery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 292 days
nytrafficticket.com review.nytrafficticket.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Aug 2021 One Off
plsauto.com review.plsauto.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 Nov 2021 One Off
reviewcainandco.com reviewcainandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewfortunemarketing.com reviewfortunemarketing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewgreatlakesimaging.com reviewgreatlakesimaging.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewgrumblesroofing.com reviewgrumblesroofing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Mar 2022 182 days
reviewinsognacpa.com reviewinsognacpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewjudetechnology.com reviewjudetechnology.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Sep 2021 One Off
reviewmachinait.com reviewmachinait.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Dec 2021 May 2022 158 days
reviewmammamarias.com reviewmammamarias.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 138 days
reviewmarshalllifestylemedicine.com reviewmarshalllifestylemedicine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 May 2022 249 days
reviewnoctechs.com reviewnoctechs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Dec 2021 91 days
reviewpro.today reviewpro.today
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewproservicebuilders.com reviewproservicebuilders.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 229 days
reviewryantechinc.com reviewryantechinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Sep 2021 One Off
airprofessionalsinc.com reviews.airprofessionalsinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 199 days
allentownasthma.com reviews.allentownasthma.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Mar 2022 209 days
allvinylgraphicsolutions.com reviews.allvinylgraphicsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 May 2022 191 days
baumholtzplasticsurgery.com reviews.baumholtzplasticsurgery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 61 days
bellestreeservicepa.com reviews.bellestreeservicepa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Mar 2022 206 days
buzzkillpestcontrol.com reviews.buzzkillpestcontrol.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 Nov 2021 One Off
carvision.com reviews.carvision.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Apr 2022 248 days
cleanright123.com reviews.cleanright123.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 274 days
cloutair.com reviews.cloutair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Dec 2021 123 days
customerserv.com reviews.customerserv.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 May 2022 255 days
diamondjacks.com reviews.diamondjacks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Aug 2021 Oct 2021 82 days
dryprosystems.com reviews.dryprosystems.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Apr 2022 Apr 2022 One Off
firstpagemedia.com reviews.firstpagemedia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 279 days
generations-care.com reviews.generations-care.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 281 days
handmiami.com reviews.handmiami.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Sep 2021 57 days
hixonhomeimprovements.com reviews.hixonhomeimprovements.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 171 days
madisongaragedoorservices.com reviews.madisongaragedoorservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
managedservicesgroupllc.com reviews.managedservicesgroupllc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 May 2022 166 days
mandwpest.com reviews.mandwpest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 May 2022 38 days
mazzeolaw.ca reviews.mazzeolaw.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
michiganheadandneck.com reviews.michiganheadandneck.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 May 2022 160 days
mmclawpa.com reviews.mmclawpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Nov 2021 131 days
myersrealty.com reviews.myersrealty.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 May 2022 May 2022 One Off
newimagecsc.com reviews.newimagecsc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Nov 2021 133 days
newzealandluxuryescapes.com reviews.newzealandluxuryescapes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 Mar 2022 120 days
ocean13ocmd.com reviews.ocean13ocmd.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Nov 2021 134 days
pawindowtint.com reviews.pawindowtint.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 Feb 2022 84 days
restoration-pro.com reviews.restoration-pro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 May 2022 May 2022 One Off
richarddiehlpaving.com reviews.richarddiehlpaving.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Dec 2021 May 2022 157 days
rlpmax.ca reviews.rlpmax.ca
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Dec 2021 139 days
robertsdaledental.com reviews.robertsdaledental.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
specialtydrapery.com reviews.specialtydrapery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Dec 2021 49 days
talbertgutters.com reviews.talbertgutters.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 213 days
thebasementguyscleveland.com reviews.thebasementguyscleveland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Jan 2022 99 days
titleonemanagement.com reviews.titleonemanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 262 days
txcrimdefense.com reviews.txcrimdefense.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
utilitywraps.com reviews.utilitywraps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jul 2021 One Off
vantmarketing.com reviews.vantmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
whitepearlmgmt.com reviews.whitepearlmgmt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 265 days
windrivermicrobes.com reviews.windrivermicrobes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 Mar 2022 One Off
dextercompany.com reviewsdallas.dextercompany.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Aug 2021 43 days
reviewstoneworthrooftile.com reviewstoneworthrooftile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewtechnologysolutions.com reviewtechnologysolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
reviewthecourse.com reviewthecourse.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Sep 2021 Sep 2021 One Off
reviewunclepetespizza.com reviewunclepetespizza.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
reviewusastoragecenter.com reviewusastoragecenter.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Mar 2022 Mar 2022 One Off
reviewvalleycorporation.com reviewvalleycorporation.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Feb 2022 222 days
reviewzing.com armourtitlecompany.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
indianafoundation.com reviews.indianafoundation.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 284 days
seoforgrowth.reviews seoforgrowth.reviews
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
skylinee3reviews.com skylinee3reviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 296 days
stylestrandmedia.com thomasbeachvacations-reviews.stylestrandmedia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 283 days
wischmann-fahrzeugbau.de bewertung.wischmann-fahrzeugbau.de
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Oct 2021 Oct 2021 One Off
reviewzing.com vins.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jan 2022 Jan 2022 One Off
reviewzing.com bws.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Jan 2022 186 days
reviewzing.com cfosource.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jan 2022 Feb 2022 36 days
dotamy.com dotamy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Feb 2022 Feb 2022 One Off
stylestrandmedia.com emma-fashion-reviews.stylestrandmedia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 May 2022 283 days
excelkcreviews.com excelkcreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 278 days
probateadvance.com feedback.probateadvance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Nov 2021 Mar 2022 119 days
superiorcontractcleaning.com feedback.superiorcontractcleaning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Oct 2021 79 days
healthylooksreviews.com healthylooksreviews.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 281 days
stylestrandmedia.com martinheatandair-reviews.stylestrandmedia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Apr 2022 248 days
reviewzing.com marylandsbest.reviewzing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Mar 2022 257 days
provinziano.review provinziano.review
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PXPSMT4 Jul 2021 Aug 2021 44 days
REVIEWS.ROSEWOODFORTO.COM
Non IP Attributes
Attribute First Last
GTM GTM-5X7LXZJ Apr 2023 Sep 2024
GTM GTM-PXPSMT4 Jul 2021 May 2022
REVIEWS.ROSEWOODFORTO.COM
Overlap Attribute Domains
poctest2.whitelabelexample.com poctest2.whitelabelexample.com
review.beitzellfence.com review.beitzellfence.com
review.ezchildtrack.com review.ezchildtrack.com
review.fusiononemarketing.com review.fusiononemarketing.com
review.lemonadestand.org review.lemonadestand.org
review.zuki.co.za review.zuki.co.za
reviewais.com reviewais.com
reviewallstarmenifee.com reviewallstarmenifee.com
reviewalt-tech.com reviewalt-tech.com
reviewanthonywimpeyplumbing.com reviewanthonywimpeyplumbing.com
reviewaxiom.com reviewaxiom.com
reviewbethanyinsurance.com reviewbethanyinsurance.com
reviewbuildonyourland.com reviewbuildonyourland.com
reviewbuschconsultinginc.com reviewbuschconsultinginc.com
reviewenvisionconsulting.com reviewenvisionconsulting.com
reviewfreshmanagedit.com reviewfreshmanagedit.com
reviewgalaxyit.com reviewgalaxyit.com
reviewgarageinnovations.com reviewgarageinnovations.com
reviewgoingclearinteractive.com reviewgoingclearinteractive.com
reviewgoodshepherdrv.com reviewgoodshepherdrv.com
reviewgtgnetworks.com reviewgtgnetworks.com
reviewhtandrc.com reviewhtandrc.com
reviewitsg.com reviewitsg.com
reviewkuntzlaw.com reviewkuntzlaw.com
reviewmellorlawfirm.com reviewmellorlawfirm.com
reviewmodcabinetry.com reviewmodcabinetry.com
reviewmorningsideplumbing.com reviewmorningsideplumbing.com
reviewneothink.com reviewneothink.com
reviewpatriotpestprescott.com reviewpatriotpestprescott.com
reviewpierson-pierson.com reviewpierson-pierson.com
reviewpraxis.com reviewpraxis.com
reviewprotectionselfstorageprovo.com reviewprotectionselfstorageprovo.com
reviewrednightconsulting.com reviewrednightconsulting.com
reviews.autotrim-md.com reviews.autotrim-md.com
reviews.barnumfloors.com reviews.barnumfloors.com
reviews.chattanoogafurnitureshop.com reviews.chattanoogafurnitureshop.com
reviews.coldspringplasticsurgery.com reviews.coldspringplasticsurgery.com
reviews.eyedesignnewyork.com reviews.eyedesignnewyork.com
reviews.familyfirster.com reviews.familyfirster.com
reviews.fencingdirect.com reviews.fencingdirect.com
reviews.gilbertmdeyecare.com reviews.gilbertmdeyecare.com
reviews.graniteselection.com reviews.graniteselection.com
reviews.gulfcoastvisioncenter.com reviews.gulfcoastvisioncenter.com
reviews.hamburgdentalcare.com reviews.hamburgdentalcare.com
reviews.haylor.com reviews.haylor.com
reviews.hearinghelpexpress.com reviews.hearinghelpexpress.com
reviews.howefarmstn.com reviews.howefarmstn.com
reviews.keysrealestate.com reviews.keysrealestate.com
reviews.lakesidebrides.com reviews.lakesidebrides.com
reviews.landscapingthegulfcoast.com reviews.landscapingthegulfcoast.com
reviews.langracing.com reviews.langracing.com
reviews.morgancreekgolf.com reviews.morgancreekgolf.com
reviews.mrtintinc.com reviews.mrtintinc.com
reviews.prsrentals.com reviews.prsrentals.com
reviews.redwoods-golf.com reviews.redwoods-golf.com
reviews.regencymorristown.com reviews.regencymorristown.com
reviews.relocatetohuntsville.com reviews.relocatetohuntsville.com
reviews.sanchezlawpa.com reviews.sanchezlawpa.com
reviews.sferrawaterproofing.com reviews.sferrawaterproofing.com
reviews.shelbyparkmanorapts.com reviews.shelbyparkmanorapts.com
reviews.snac.com reviews.snac.com
reviews.texasjohns.com reviews.texasjohns.com
reviews.theclosingagent.com reviews.theclosingagent.com
reviews.thegrindholmen.com reviews.thegrindholmen.com
reviews.wujekcalcaterra.com reviews.wujekcalcaterra.com
reviews.wyckoffcomfort.com reviews.wyckoffcomfort.com
reviewsolutionsindata.net reviewsolutionsindata.net
reviewthrowerconcrete.com reviewthrowerconcrete.com
reviewtitletree.com reviewtitletree.com
reviewtwintel.com reviewtwintel.com
reviewus.iwdmarketing.com reviewus.iwdmarketing.com
reviewwebertc.com reviewwebertc.com
reviewwisechiropracticcenter.com reviewwisechiropracticcenter.com
snlprime.reviewzing.com snlprime.reviewzing.com
bathdoctor.reviewzing.com bathdoctor.reviewzing.com
watchboxreviews.com watchboxreviews.com
chattanoogareviews.com chattanoogareviews.com
elitetentsandevents.reviewzing.com elitetentsandevents.reviewzing.com
employeereviews.trentonforging.com employeereviews.trentonforging.com
feedback.tintglass.com feedback.tintglass.com
homewisepros.reviewzing.com homewisepros.reviewzing.com
kawreviews.com kawreviews.com
kcpier.reviews kcpier.reviews
kenstrans.reviewzing.com kenstrans.reviewzing.com
prestigeautoreviews.com prestigeautoreviews.com
review.bolemanlaw.com review.bolemanlaw.com
review.catalystfdg.com review.catalystfdg.com
review.inspiredindoorair.com review.inspiredindoorair.com
review.landscape-solutions.net review.landscape-solutions.net
review.njvvc.com review.njvvc.com
review.sponzilli.com review.sponzilli.com
review.treesunlimitednj.com review.treesunlimitednj.com
review.xceedit.com review.xceedit.com
review.zabace.com review.zabace.com
reviewbearacandheating.com reviewbearacandheating.com
reviewdcheadshots.com reviewdcheadshots.com
reviewdmatechsolutions.com reviewdmatechsolutions.com
reviewdowntownbuildingservices.com reviewdowntownbuildingservices.com
reviewecosmartpools.com reviewecosmartpools.com
revieweliteselfstorage.com revieweliteselfstorage.com
reviewgb.com reviewgb.com
reviewhollandmc.com reviewhollandmc.com
reviewinscnet.com reviewinscnet.com
reviewinterstate70towing.com reviewinterstate70towing.com
reviewkoskovichandmurphy.com reviewkoskovichandmurphy.com
reviewnapoli.com reviewnapoli.com
reviewofseyer.com reviewofseyer.com
reviewpawnshopconsulting.com reviewpawnshopconsulting.com
reviewperryelectrical.com reviewperryelectrical.com
reviewrhino-db.com reviewrhino-db.com
reviewrikeshakeen.com reviewrikeshakeen.com
reviews.abateproco.com reviews.abateproco.com
reviews.alonti.com reviews.alonti.com
reviews.assuritytitle.com reviews.assuritytitle.com
reviews.awbroadband.net reviews.awbroadband.net
reviews.bascomgrooms.com reviews.bascomgrooms.com
reviews.boardwalkcleaning.com reviews.boardwalkcleaning.com
reviews.clocktower-dental.com reviews.clocktower-dental.com
reviews.cullomeyecenter.com reviews.cullomeyecenter.com
reviews.drglasberg.com reviews.drglasberg.com
reviews.flexabed.com reviews.flexabed.com
reviews.floridapm.net reviews.floridapm.net
reviews.hutchisonglassandmirror.com reviews.hutchisonglassandmirror.com
reviews.industrialfastenersandsupply.com reviews.industrialfastenersandsupply.com
reviews.kandkheatingandcooling.com reviews.kandkheatingandcooling.com
reviews.keithheatingandair.com reviews.keithheatingandair.com
reviews.medicallicensuregroup.com reviews.medicallicensuregroup.com
reviews.neolytix.com reviews.neolytix.com
reviews.regencybirmingham.com reviews.regencybirmingham.com
reviews.riverwoodretirement.com reviews.riverwoodretirement.com
reviews.rosewoodforto.com reviews.rosewoodforto.com
reviews.triplepeaksroofing.com reviews.triplepeaksroofing.com
reviews.walkerheye.com reviews.walkerheye.com
reviews.wehakeecampforgirls.com reviews.wehakeecampforgirls.com
reviews.westbycreamery.com reviews.westbycreamery.com
reviewsimpleitsolutions.com reviewsimpleitsolutions.com
reviewsqlwatchmen.com reviewsqlwatchmen.com
reviewtelewire.com reviewtelewire.com
reviewthrottlenet.com reviewthrottlenet.com
reviewtochta.com reviewtochta.com
reviewtolarsystems.com reviewtolarsystems.com
reviewvizualsymphony.com reviewvizualsymphony.com
reviewwishartfamilylaw.com reviewwishartfamilylaw.com
bayareawildlife.reviewzing.com bayareawildlife.reviewzing.com
billianlaw.reviewzing.com billianlaw.reviewzing.com
yoursmilepro.com yoursmilepro.com
deancamlin.reviewzing.com deancamlin.reviewzing.com
feedback.generalsolar.net feedback.generalsolar.net
freshmealplanreviews.com freshmealplanreviews.com
govbergreviews.com govbergreviews.com
hhroofingreviews.com hhroofingreviews.com
houselawreviews.com houselawreviews.com
tshirtexpressreviews.com tshirtexpressreviews.com
btmlawreviews.com btmlawreviews.com
dragonscale.reviewzing.com dragonscale.reviewzing.com
feedback.thstattoo.com feedback.thstattoo.com
haganandsons.reviewzing.com haganandsons.reviewzing.com
idlcompanyreviews.com idlcompanyreviews.com
localbizreview.co localbizreview.co
reviewascentdata.com reviewascentdata.com
reviewaccountingpartners.com reviewaccountingpartners.com
reviewamanica.com reviewamanica.com
review.angellaire.com review.angellaire.com
review.frontiermarketingllc.com review.frontiermarketingllc.com
review.mydoctorsf.com review.mydoctorsf.com
reviewaquospools.com reviewaquospools.com
reviewfusiontechnology.com reviewfusiontechnology.com
reviewcan-restore.com reviewcan-restore.com
reviewcualtzinsalon.com reviewcualtzinsalon.com
reviewemdtec.com reviewemdtec.com
reviewmarinaj.com reviewmarinaj.com
reviewmarketblazer.com reviewmarketblazer.com
reviewprotectionselfstorage.com reviewprotectionselfstorage.com
reviewquestworkspaces.com reviewquestworkspaces.com
reviews.alcoproductsinc.com reviews.alcoproductsinc.com
reviews.bartenmedia.com reviews.bartenmedia.com
reviews.biosweepal.com reviews.biosweepal.com
reviews.callsouthernpridepestcontrol.com reviews.callsouthernpridepestcontrol.com
reviews.comradeweb.com reviews.comradeweb.com
reviews.cutlerrader.com reviews.cutlerrader.com
reviews.gandgconcrete.com reviews.gandgconcrete.com
reviews.elorenergy.com reviews.elorenergy.com
reviews.factorfunding.com reviews.factorfunding.com
reviews.greatfallsfamilydentistry.com reviews.greatfallsfamilydentistry.com
reviews.islandwidechiropractic.com reviews.islandwidechiropractic.com
reviews.k-and-s.com reviews.k-and-s.com
reviews.lakememorials.com reviews.lakememorials.com
reviews.lakesideweddings.com reviews.lakesideweddings.com
reviews.lasvegaswedding4u.com reviews.lasvegaswedding4u.com
reviews.lcifrederick.com reviews.lcifrederick.com
reviews.levelfinancing.com reviews.levelfinancing.com
reviews.nrilifeinsurance.com reviews.nrilifeinsurance.com
reviews.mywaterfl.com reviews.mywaterfl.com
reviews.naveteam.com reviews.naveteam.com
reviews.parakhplasticsurgery.com reviews.parakhplasticsurgery.com
reviews.pismohomes.com reviews.pismohomes.com
reviews.qcplasticsurgeons.com reviews.qcplasticsurgeons.com
reviews.regencyretirementjackson.com reviews.regencyretirementjackson.com
reviews.rmsaccounting.com reviews.rmsaccounting.com
reviews.royalpalmacademy.com reviews.royalpalmacademy.com
reviews.seekmomentum.com reviews.seekmomentum.com
reviews.shinedentalgroup.com reviews.shinedentalgroup.com
reviews.weightlosssurgeryla.com reviews.weightlosssurgeryla.com
reviews.smilesimdmd.com reviews.smilesimdmd.com
reviews.theheritagedowntown.com reviews.theheritagedowntown.com
reviews.theinternationalkitchen.com reviews.theinternationalkitchen.com
reviews.treeringdigital.com reviews.treeringdigital.com
reviews.troylegalpa.com reviews.troylegalpa.com
reviews.turnerhomefl.com reviews.turnerhomefl.com
reviews.wilderness.co.nz reviews.wilderness.co.nz
reviews.waterfrontplayhouse.org reviews.waterfrontplayhouse.org
reviewtki.com reviewtki.com
reviewwhartonrentals.com reviewwhartonrentals.com
reviewsingerandfalk.com reviewsingerandfalk.com
reviewslaterbrotherswelldrilling.com reviewslaterbrotherswelldrilling.com
reviewsoarvacationrental.com reviewsoarvacationrental.com
reviewsolaceemotional.com reviewsolaceemotional.com
reviewstasmayer.com reviewstasmayer.com
reviewtatefireplaces.com reviewtatefireplaces.com
review.bohannonservices.com review.bohannonservices.com
review.fusionmanagedit.com review.fusionmanagedit.com
review.lumberjax.com review.lumberjax.com
review.renownedbuildingsolutions.com review.renownedbuildingsolutions.com
review.sonjaphoto.com review.sonjaphoto.com
review.sudburygraniteandmarble.com review.sudburygraniteandmarble.com
reviewadvancare.com reviewadvancare.com
reviewallstarhemet.com reviewallstarhemet.com
reviewamericanpestmanagement.com reviewamericanpestmanagement.com
reviewancgroup.com reviewancgroup.com
reviewatlantaplumbersguild.com reviewatlantaplumbersguild.com
reviewbrightlineit.com reviewbrightlineit.com
reviewdatataptech.com reviewdatataptech.com
reviewelitecarpaltunnel.com reviewelitecarpaltunnel.com
reviewfhstickles.com reviewfhstickles.com
reviewgenosseweranddrains.com reviewgenosseweranddrains.com
reviewhenderson.com reviewhenderson.com
reviewicherishhomecare.com reviewicherishhomecare.com
reviewindiestudiosuites.com reviewindiestudiosuites.com
reviewironedge.com reviewironedge.com
reviewisgtech.com reviewisgtech.com
reviewitology.com reviewitology.com
reviewmonarchfamilylaw.com reviewmonarchfamilylaw.com
reviewnorthpoledental.com reviewnorthpoledental.com
reviewpoolicons.com reviewpoolicons.com
reviewresultstech.com reviewresultstech.com
reviewrjggroup.com reviewrjggroup.com
reviews.acswfl.com reviews.acswfl.com
reviews.advancedendocare.com reviews.advancedendocare.com
reviews.americanlegacyfishing.com reviews.americanlegacyfishing.com
reviews.americantent.com reviews.americantent.com
reviews.bethesdahomedesign.com reviews.bethesdahomedesign.com
reviews.bioservusa.com reviews.bioservusa.com
reviews.cougardigitalmarketing.com reviews.cougardigitalmarketing.com
reviews.earthdevelopmentinc.com reviews.earthdevelopmentinc.com
reviews.espwindowtint.com reviews.espwindowtint.com
reviews.floridapestcontrolcenter.com reviews.floridapestcontrolcenter.com
reviews.golfoaks.com reviews.golfoaks.com
reviews.happytrailersales.com reviews.happytrailersales.com
reviews.home4rent.com reviews.home4rent.com
reviews.honeybrookgolf.com reviews.honeybrookgolf.com
reviews.houseofair.com reviews.houseofair.com
reviews.infinitytransportation.net reviews.infinitytransportation.net
reviews.internetmarketingllc.com reviews.internetmarketingllc.com
reviews.islanddentalassociates.com reviews.islanddentalassociates.com
reviews.legacypestcontrolaz.com reviews.legacypestcontrolaz.com
reviews.longislandaccident.com reviews.longislandaccident.com
reviews.mosesmousereye.com reviews.mosesmousereye.com
reviews.neplumbing.net reviews.neplumbing.net
reviews.ocoeeoralsurgery.com reviews.ocoeeoralsurgery.com
reviews.ohioinjurylaw.com reviews.ohioinjurylaw.com
reviews.perfectlocks.com reviews.perfectlocks.com
reviews.powerwashingman.com reviews.powerwashingman.com
reviews.redskiesyoga.com reviews.redskiesyoga.com
reviews.regencyhuntsville.com reviews.regencyhuntsville.com
reviews.regencytuscaloosa.com reviews.regencytuscaloosa.com
reviews.sdakotainternet.com reviews.sdakotainternet.com
reviews.shellislandshuttle.com reviews.shellislandshuttle.com
reviews.socialfirm.com reviews.socialfirm.com
reviews.sugarshackholmen.com reviews.sugarshackholmen.com
reviews.summitcommercialroofing.com reviews.summitcommercialroofing.com
reviews.techfirefly.com reviews.techfirefly.com
reviews.theblugroup.com reviews.theblugroup.com
reviews.thesalonatlakeside.com reviews.thesalonatlakeside.com
reviews.yatesind.com reviews.yatesind.com
reviewsimplesystemsutah.com reviewsimplesystemsutah.com
reviewstrategiccares.com reviewstrategiccares.com
reviewsysarc.com reviewsysarc.com
reviewtechrockstars.com reviewtechrockstars.com
reviewtms.com reviewtms.com
reviewtrinware.com reviewtrinware.com
review.brooksfieldschool.org review.brooksfieldschool.org
americanheritage.reviewzing.com americanheritage.reviewzing.com
teagueelectricreviews.com teagueelectricreviews.com
comancheexcellence.com comancheexcellence.com
dkrus.reviewzing.com dkrus.reviewzing.com
freedominsurance.reviewzing.com freedominsurance.reviewzing.com
fusionelectricreviews.com fusionelectricreviews.com
review.cavewebworks.com review.cavewebworks.com
hinklehardscapes.reviews hinklehardscapes.reviews
kpwildlifecontrol.reviewzing.com kpwildlifecontrol.reviewzing.com
marylandmobilevet.reviewzing.com marylandmobilevet.reviewzing.com
rating.instamaids.com rating.instamaids.com
mrunkph.reviewzing.com mrunkph.reviewzing.com
nadeck.reviewzing.com nadeck.reviewzing.com
review.ckpanhandle.com review.ckpanhandle.com
review.elavatere.com review.elavatere.com
review.netvisits.com review.netvisits.com
review.pagnissealcoating.net review.pagnissealcoating.net
review.pinkroofing.com review.pinkroofing.com
review.procutfirewood.com review.procutfirewood.com
reviewacehomeservicesrepair.com reviewacehomeservicesrepair.com
reviewbsgutter.com reviewbsgutter.com
reviewcareathomellc.com reviewcareathomellc.com
reviewcommonangle.com reviewcommonangle.com
reviewdrfallonspractice.com reviewdrfallonspractice.com
revieweaglecollision.com revieweaglecollision.com
reviewelixistechnology.com reviewelixistechnology.com
reviewfirststorage.com reviewfirststorage.com
reviewfleurandstems.com reviewfleurandstems.com
reviewfusionpaintsupply.com reviewfusionpaintsupply.com
reviewgiaspace.com reviewgiaspace.com
reviewjpthegeek.com reviewjpthegeek.com
reviewkaufmanit.com reviewkaufmanit.com
reviewkramerpools.com reviewkramerpools.com
reviewliquiduspools.com reviewliquiduspools.com
reviewnaturalwonders.com reviewnaturalwonders.com
reviewonboardit.com reviewonboardit.com
reviewparadiseclimatestorage.com reviewparadiseclimatestorage.com
reviewpittmansupply.com reviewpittmansupply.com
reviews.axlehire.com reviews.axlehire.com
reviews.cyclonecontracting.com reviews.cyclonecontracting.com
reviews.dwiteam.com reviews.dwiteam.com
reviews.ecotectpest.com reviews.ecotectpest.com
reviews.generationstrenchless.com reviews.generationstrenchless.com
reviews.haciendapools.net reviews.haciendapools.net
reviews.loganmasterappliance.com reviews.loganmasterappliance.com
reviews.longfence.com reviews.longfence.com
reviews.mnplumbingandhomeservices.com reviews.mnplumbingandhomeservices.com
reviews.ptsdfw.com reviews.ptsdfw.com
reviews.refreshoh.com reviews.refreshoh.com
reviews.rockrecoverycenter.com reviews.rockrecoverycenter.com
reviews.shepherdroofingrenovations.com reviews.shepherdroofingrenovations.com
reviews.southerncrawlspace.com reviews.southerncrawlspace.com
reviews.springerfloorcare.com reviews.springerfloorcare.com
reviews.stacyssensorysolutions.com reviews.stacyssensorysolutions.com
reviews.theabbittgroup.com reviews.theabbittgroup.com
reviews.trentonforging.com reviews.trentonforging.com
reviews.websitesmia.com reviews.websitesmia.com
reviewsouthpointpest.com reviewsouthpointpest.com
reviewstabilitynetworks.com reviewstabilitynetworks.com
reviewsustainable-restoration.com reviewsustainable-restoration.com
reviewthemeadowsraleigh.com reviewthemeadowsraleigh.com
reviewthreatalliance.com reviewthreatalliance.com
reviewunityit.com reviewunityit.com
reviewutwindowexperts.com reviewutwindowexperts.com
reviewvoicendatasolutions.net reviewvoicendatasolutions.net
reviewwizardcpu.com reviewwizardcpu.com
advantageim.reviewzing.com advantageim.reviewzing.com
arhdecks.reviewzing.com arhdecks.reviewzing.com
unlimitedunderground.reviewzing.com unlimitedunderground.reviewzing.com
blog.grade.us blog.grade.us
fairmont.alcofenceco.com fairmont.alcofenceco.com
feedback.woodsonedu.com feedback.woodsonedu.com
flourishbeautystudio.reviewzing.com flourishbeautystudio.reviewzing.com
gztji.dany-holiday.com gztji.dany-holiday.com
marylandprivatemortgage.reviewzing.com marylandprivatemortgage.reviewzing.com
ratewinner.grade.us ratewinner.grade.us
powersealerllc.review powersealerllc.review
review-me.renterspowerhouse.com review-me.renterspowerhouse.com
review.eliterolloff.com review.eliterolloff.com
review.lawndoctordenver.com review.lawndoctordenver.com
review.shaveunion.co.za review.shaveunion.co.za
review.ziamediagroup.com review.ziamediagroup.com
reviewabletransportsolutions.com reviewabletransportsolutions.com
reviewbestrooferil.com reviewbestrooferil.com
reviewcabinet-wholesalers.com reviewcabinet-wholesalers.com
reviewdavidshouseofdiamonds.com reviewdavidshouseofdiamonds.com
reviewfullerwenteinc.com reviewfullerwenteinc.com
reviewlandcautoandtire.com reviewlandcautoandtire.com
reviewlegacybydesign.com reviewlegacybydesign.com
reviewpizzeriadimaria.com reviewpizzeriadimaria.com
reviews.airmedicsac.com reviews.airmedicsac.com
reviews.allfleettowing.com reviews.allfleettowing.com
reviews.allinfamilymed.com reviews.allinfamilymed.com
reviews.burtonasphalt.com reviews.burtonasphalt.com
reviews.chirocareflorida.com reviews.chirocareflorida.com
reviews.choraltracks.com reviews.choraltracks.com
reviews.dwiguy.com reviews.dwiguy.com
reviews.eagleeyemedia.net reviews.eagleeyemedia.net
reviews.empowerfcu.com reviews.empowerfcu.com
reviews.engleservicesheatingandair.com reviews.engleservicesheatingandair.com
reviews.everwellrx.com reviews.everwellrx.com
reviews.flaircommunication.com reviews.flaircommunication.com
reviews.floridafoundationauthority.com reviews.floridafoundationauthority.com
reviews.foundationrecoverysystems.com reviews.foundationrecoverysystems.com
reviews.janescherrn.com reviews.janescherrn.com
reviews.kpmrestoration.com reviews.kpmrestoration.com
reviews.maxwellbuildingservices.com reviews.maxwellbuildingservices.com
reviews.oahupropainters.com reviews.oahupropainters.com
reviews.omniacreativestudio.com reviews.omniacreativestudio.com
reviews.pettispools.com reviews.pettispools.com
reviews.pfeifferautoclinic.com reviews.pfeifferautoclinic.com
reviews.precisioncarpet.net reviews.precisioncarpet.net
reviews.realnets.com reviews.realnets.com
reviews.srstintandgraphics.com reviews.srstintandgraphics.com
reviews.stickyfingers.com reviews.stickyfingers.com
reviews.tamakilaw.com reviews.tamakilaw.com
reviews.tarheelbasementsystems.com reviews.tarheelbasementsystems.com
reviews.tomatinos.com reviews.tomatinos.com
reviews.virginiadentalcenter.com reviews.virginiadentalcenter.com
reviews.webpropulsion.com reviews.webpropulsion.com
reviews.welterconstruction.com reviews.welterconstruction.com
reviews.whitespestcontrol.net reviews.whitespestcontrol.net
reviewsinglepointglobal.com reviewsinglepointglobal.com
reviewsmallworldbigfun.com reviewsmallworldbigfun.com
reviewsyzygy3.com reviewsyzygy3.com
reviewterminalb.com reviewterminalb.com
reviewwavetechnologies.com reviewwavetechnologies.com
reviewyourtridental.com reviewyourtridental.com
reviewzirous.com reviewzirous.com
rossalbers.reviewzing.com rossalbers.reviewzing.com
abcsidingreviews.com abcsidingreviews.com
commerciallyclean.reviewzing.com commerciallyclean.reviewzing.com
discovernchomes-reviews.stylestrandmedia.com discovernchomes-reviews.stylestrandmedia.com
feedback.shift32.com feedback.shift32.com
heartlanddecksreviews.com heartlanddecksreviews.com
kentclean.reviewzing.com kentclean.reviewzing.com
kccs.reviewzing.com kccs.reviewzing.com
leaveiconareview.com leaveiconareview.com
review.excellentautoglass.com review.excellentautoglass.com
review.saundersls.com review.saundersls.com
review3kingsplumbing.com review3kingsplumbing.com
reviewaquamasters.com reviewaquamasters.com
reviewbeartechit.com reviewbeartechit.com
reviewbuildeuropean.com reviewbuildeuropean.com
reviewdiamondducts.com reviewdiamondducts.com
reviewdowntownwindowcleaning.com reviewdowntownwindowcleaning.com
reviewdupreeplumbing.com reviewdupreeplumbing.com
reviewgenerationix.com reviewgenerationix.com
reviewgovernmentauction.com reviewgovernmentauction.com
reviewgxait.com reviewgxait.com
reviewhrct.com reviewhrct.com
reviewitforscrubs.com reviewitforscrubs.com
reviewknoxstoragealcoa.com reviewknoxstoragealcoa.com
reviewkr.com reviewkr.com
reviewmagview.com reviewmagview.com
reviewnebraskahomepediatrics.com reviewnebraskahomepediatrics.com
reviewnoftek.com reviewnoftek.com
reviewomniic.com reviewomniic.com
reviews.allianceinvestigating.com reviews.allianceinvestigating.com
reviews.hoalegal.com reviews.hoalegal.com
reviews.javavinolax.com reviews.javavinolax.com
reviews.jlsinc.net reviews.jlsinc.net
reviews.kingmetals.com reviews.kingmetals.com
reviews.omegapestsolution.com reviews.omegapestsolution.com
reviews.rockfordhomes.net reviews.rockfordhomes.net
reviews.roofsaverstricities.com reviews.roofsaverstricities.com
reviews.rotorooterga.com reviews.rotorooterga.com
reviews.runnetworkrun.com reviews.runnetworkrun.com
reviews.shredsmartusa.com reviews.shredsmartusa.com
reviews.srlawpa.com reviews.srlawpa.com
reviews.treeprosonoma.com reviews.treeprosonoma.com
reviews.urbantreemanagement.com reviews.urbantreemanagement.com
reviews.vistalandscapingofbft.com reviews.vistalandscapingofbft.com
reviewsdriven.com reviewsdriven.com
reviewsmileitdental.com reviewsmileitdental.com
reviewspotteddog.coffee reviewspotteddog.coffee
reviewusresources.com reviewusresources.com
reviewvisualdatacloud.com reviewvisualdatacloud.com
reviewwallaceexcavatingco.com reviewwallaceexcavatingco.com
reviewzunigapools.com reviewzunigapools.com
tookdress.com tookdress.com
wazjj.jiuhongwang.com wazjj.jiuhongwang.com
feedback.disastercleanup.com feedback.disastercleanup.com
feedback.post-frame.com feedback.post-frame.com
kcwebdesign.reviews kcwebdesign.reviews
mde.reviewzing.com mde.reviewzing.com
playersfunzone.reviewzing.com playersfunzone.reviewzing.com
review.controlconceptstexas.com review.controlconceptstexas.com
review.crockermovingservices.com review.crockermovingservices.com
review.hotboxcookingwood.com review.hotboxcookingwood.com
review.inadaysmiledentalimplantcenter.com review.inadaysmiledentalimplantcenter.com
review.kwikkarautoservices.com review.kwikkarautoservices.com
review.walterclark.com review.walterclark.com
reviewadvancedmoving.com reviewadvancedmoving.com
reviewbarrwood.com reviewbarrwood.com
reviewchoicesolutions.com reviewchoicesolutions.com
reviewclosetsdesignstudio.com reviewclosetsdesignstudio.com
reviewcorrectoralcare.com reviewcorrectoralcare.com
reviewdentaldash.co reviewdentaldash.co
reviewgbsi.com reviewgbsi.com
reviewhandsofheartland.com reviewhandsofheartland.com
reviewnovustek.com reviewnovustek.com
reviews.aacompanies.com reviews.aacompanies.com
reviews.advancedhomecomfort.com reviews.advancedhomecomfort.com
reviews.afsrepair.com reviews.afsrepair.com
reviews.ampofny.com reviews.ampofny.com
reviews.angelhomehealthcare.com reviews.angelhomehealthcare.com
reviews.artisticaudioentertainment.com reviews.artisticaudioentertainment.com
reviews.aultmanlawpllc.com reviews.aultmanlawpllc.com
reviews.aurumcontracting.com reviews.aurumcontracting.com
reviews.basementsbybq.com reviews.basementsbybq.com
reviews.cashautosalvage.com reviews.cashautosalvage.com
reviews.completebasementsystems.net reviews.completebasementsystems.net
reviews.danielswaterproofing.com reviews.danielswaterproofing.com
reviews.deluxeplumbing.com reviews.deluxeplumbing.com
reviews.dfwprophoto.com reviews.dfwprophoto.com
reviews.dkm.agency reviews.dkm.agency
reviews.gaudylaw.com reviews.gaudylaw.com
reviews.gc.plumbing reviews.gc.plumbing
reviews.gobonafide.com reviews.gobonafide.com
reviews.lplenterprises.com reviews.lplenterprises.com
reviews.mistbodybar.com reviews.mistbodybar.com
reviews.patriotair.com reviews.patriotair.com
reviews.ridofitvancouver.ca reviews.ridofitvancouver.ca
reviews.rockpmc.com reviews.rockpmc.com
reviews.serenitywatersspa.com reviews.serenitywatersspa.com
reviews.sleep-tech.net reviews.sleep-tech.net
reviews.soflasolar.com reviews.soflasolar.com
reviews.syracusenybride.com reviews.syracusenybride.com
reviews.themobstopholmen.com reviews.themobstopholmen.com
reviews.treeshades.com reviews.treeshades.com
reviews.tylericasystems.com reviews.tylericasystems.com
reviewtalenttermite.com reviewtalenttermite.com
reviewus.ericksrealty.com reviewus.ericksrealty.com
reviewus.myqualityroof.com reviewus.myqualityroof.com
reviewus.trecpro.com reviewus.trecpro.com
reviewutahluxurytours.com reviewutahluxurytours.com
reviews.woodchuckdelivery.com reviews.woodchuckdelivery.com
aetreereviews.com aetreereviews.com
skylinee3.reviews skylinee3.reviews
springboard.reviewzing.com springboard.reviewzing.com
thank-you.copiavineyards.com thank-you.copiavineyards.com
bobhamilton.reviews bobhamilton.reviews
feedback.barronbraces.com feedback.barronbraces.com
feedback.pawindowtint.com feedback.pawindowtint.com
feedback.reifmanlawfirm.com feedback.reifmanlawfirm.com
feedback.tier1vet.com feedback.tier1vet.com
customdeckbuilders.reviewzing.com customdeckbuilders.reviewzing.com
employees.barron-industries.com employees.barron-industries.com
giareviews.com giareviews.com
hamiltonize.com hamiltonize.com
lcirecycling.reviewzing.com lcirecycling.reviewzing.com
leave-a-review.com.au leave-a-review.com.au
reviewa1qualityheatac.com reviewa1qualityheatac.com
reviewabovetherimplumber.com reviewabovetherimplumber.com
reviewadrytech.com reviewadrytech.com
reviewainmd.com reviewainmd.com
review.xponent21.com review.xponent21.com
revieweyesighthawaii.com revieweyesighthawaii.com
reviewfortisfire.com reviewfortisfire.com
reviewgorillaboxtough.com reviewgorillaboxtough.com
reviewheartlandtowingrecovery.net reviewheartlandtowingrecovery.net
reviewbreadcrumbcyber.com reviewbreadcrumbcyber.com
reviewcdpest.com reviewcdpest.com
reviewchattywire.com reviewchattywire.com
reviewcopecosmeticderm.com reviewcopecosmeticderm.com
reviewcustommotowheels.com reviewcustommotowheels.com
reviewcyopsecurity.com reviewcyopsecurity.com
reviewdestinationinspiration.com reviewdestinationinspiration.com
reviewelmwoodselfstorage.com reviewelmwoodselfstorage.com
reviewmicalline.com reviewmicalline.com
reviewmwcompanies.com reviewmwcompanies.com
reviewmyrsi.com reviewmyrsi.com
reviewparagonpartnersco.com reviewparagonpartnersco.com
reviewpooltch.com reviewpooltch.com
reviewrapidrentals.com reviewrapidrentals.com
reviewrvfmillsriver.com reviewrvfmillsriver.com
reviews.atdsolar.com reviews.atdsolar.com
reviews.bocaratonestatelawyer.com reviews.bocaratonestatelawyer.com
reviews.captainpestpatrol.com reviews.captainpestpatrol.com
reviews.gainesvilleaudiologist.com reviews.gainesvilleaudiologist.com
reviews.intelinetsystems.com reviews.intelinetsystems.com
reviews.iwantscrap.com reviews.iwantscrap.com
reviews.jarvisfirm.com reviews.jarvisfirm.com
reviews.pagenstechergroup.com reviews.pagenstechergroup.com
reviews.raygidich.com reviews.raygidich.com
reviews.recloans360.com reviews.recloans360.com
reviews.royalemanagement.com reviews.royalemanagement.com
reviews.shrenovations.org reviews.shrenovations.org
reviews.smartconcepts.co reviews.smartconcepts.co
reviews.thejerryreidagency.com reviews.thejerryreidagency.com
reviewselfstoragenc.com reviewselfstoragenc.com
reviews.zavazonepotomacmills.com reviews.zavazonepotomacmills.com
reviews90.com reviews90.com
reviewsafetynetinc.com reviewsafetynetinc.com
reviewtjtravelcenters.com reviewtjtravelcenters.com
reviewtommysglass.net reviewtommysglass.net
reviewtotalit.com reviewtotalit.com
reviewskilcheck.com reviewskilcheck.com
reviewtamissalon.com reviewtamissalon.com
reviewtaylormadepools.com reviewtaylormadepools.com
pppreviews.iwdmarketing.com pppreviews.iwdmarketing.com
smokingpigreport.com smokingpigreport.com
avalimousine.grade.us avalimousine.grade.us
spotswoodtrailmassage.reviewzing.com spotswoodtrailmassage.reviewzing.com
winterton.reviewzing.com winterton.reviewzing.com
feedback.mybluewateradventures.com feedback.mybluewateradventures.com
feedback.pghwindowfilm.com feedback.pghwindowfilm.com
feedback.solartint.com feedback.solartint.com
feedbackforbudgetblinds.com feedbackforbudgetblinds.com
feedbackforron.com feedbackforron.com
freedommobility.reviewzing.com freedommobility.reviewzing.com
generalautoservice.reviewzing.com generalautoservice.reviewzing.com
reviewaceplumbing.com reviewaceplumbing.com
reviewallisontranstech.com reviewallisontranstech.com
review.digitalhyve.com review.digitalhyve.com
review.nmdreamhouse.com review.nmdreamhouse.com
review.riceac.com review.riceac.com
reviewgreenwire.com reviewgreenwire.com
reviewicscomplete.com reviewicscomplete.com
reviewcornelsplumbing.com reviewcornelsplumbing.com
reviewinet.com reviewinet.com
reviewk2techgroup.com reviewk2techgroup.com
reviewmaplandandhomes.com reviewmaplandandhomes.com
reviewmidstateohd.com reviewmidstateohd.com
reviewmiu.com reviewmiu.com
reviewnetworkprovidence.com reviewnetworkprovidence.com
reviewofficialfinders.com reviewofficialfinders.com
reviewomnisrehab.com reviewomnisrehab.com
reviewourvineyard.com reviewourvineyard.com
reviewrts.com reviewrts.com
reviews.advanceacmiami.com reviews.advanceacmiami.com
reviews.allfleetinc.com reviews.allfleetinc.com
reviews.bluecorddynamics.com reviews.bluecorddynamics.com
reviews.countryfootcare.com reviews.countryfootcare.com
reviews.darleysplumbing.com reviews.darleysplumbing.com
reviews.dentistsinalexandria.com reviews.dentistsinalexandria.com
reviews.drymich.com reviews.drymich.com
reviews.elite-dental.com reviews.elite-dental.com
reviews.greaternewhavenobgyn.net reviews.greaternewhavenobgyn.net
reviews.hartdesign.com reviews.hartdesign.com
reviews.jessicadumas.net reviews.jessicadumas.net
reviews.junkcarmedics.com reviews.junkcarmedics.com
reviews.kwikkarautoservices.com reviews.kwikkarautoservices.com
reviews.ohiobasementauthority.com reviews.ohiobasementauthority.com
reviews.orcawhalewatch.com reviews.orcawhalewatch.com
reviews.matthewkellyassociates.com reviews.matthewkellyassociates.com
reviews.sealytractor.com reviews.sealytractor.com
reviews.rhhomeslimited.com reviews.rhhomeslimited.com
reviews.saharagrill.com reviews.saharagrill.com
reviews.seattlethera.com reviews.seattlethera.com
reviews.secretweapondigital.com reviews.secretweapondigital.com
reviews.shophondacity.com reviews.shophondacity.com
reviews.tonigagehomes.com reviews.tonigagehomes.com
reviews.windowdecor.com reviews.windowdecor.com
reviewscstat.dextercompany.com reviewscstat.dextercompany.com
reviews.ylaw.co reviews.ylaw.co
reviewsteleconsultants.webpropulsion.com reviewsteleconsultants.webpropulsion.com
reviewteamlogicsantarosa.com reviewteamlogicsantarosa.com
reviewteamrehab.com reviewteamrehab.com
reviewtekscape.com reviewtekscape.com
reviewchuckitinstorage.com reviewchuckitinstorage.com
reviewcloud9detail.com reviewcloud9detail.com
reviewcurrentteksolutions.com reviewcurrentteksolutions.com
reviewdatotechnologysolutions.com reviewdatotechnologysolutions.com
reviewdiversified-is.com reviewdiversified-is.com
reviewforuminfotech.com reviewforuminfotech.com
reviewfourspc.com reviewfourspc.com
reviewhandhtreeservice.com reviewhandhtreeservice.com
reviewlandmarksignusa.com reviewlandmarksignusa.com
reviewmcclureandstewart.com reviewmcclureandstewart.com
reviewmikehansenroofing.com reviewmikehansenroofing.com
reviewniceandneathomes.com reviewniceandneathomes.com
reviewnorthtexasstorage.net reviewnorthtexasstorage.net
reviewolympicstorage.com reviewolympicstorage.com
reviewpartyrentalca.com reviewpartyrentalca.com
reviews-fhmi.seniorhelpers.com reviews-fhmi.seniorhelpers.com
reviews.barron-industries.com reviews.barron-industries.com
reviews.buenavistawildlifesafari.com reviews.buenavistawildlifesafari.com
reviews.chillsquad.com reviews.chillsquad.com
reviews.conserv-air.com reviews.conserv-air.com
reviews.finalcutroofing.com reviews.finalcutroofing.com
reviews.garbetthomes.com reviews.garbetthomes.com
reviews.hpmlawyers.com reviews.hpmlawyers.com
reviews.kitchencabinetguys.net reviews.kitchencabinetguys.net
reviews.lmminc.com reviews.lmminc.com
reviews.motorhomesforsale.co.nz reviews.motorhomesforsale.co.nz
reviews.northtexasluxurylawns.com reviews.northtexasluxurylawns.com
reviews.olivecoffeecart.com reviews.olivecoffeecart.com
reviews.pcunw.com reviews.pcunw.com
reviews.riverworksmarketing.com reviews.riverworksmarketing.com
reviews.shepherd-electric.net reviews.shepherd-electric.net
reviews.skintightmedspa.com reviews.skintightmedspa.com
reviewsidedumpindustries.com reviewsidedumpindustries.com
reviewstehlfamilydental.com reviewstehlfamilydental.com
reviewswimstatepoolservice.com reviewswimstatepoolservice.com
reviewtechnologybeyond.com reviewtechnologybeyond.com
reviewtimelesspools.com reviewtimelesspools.com
reviewvelocityit.com reviewvelocityit.com
reviewvfsfire.com reviewvfsfire.com
reviewzerorezwasatchback.com reviewzerorezwasatchback.com
seoye7.com seoye7.com
uovuf.hijoushiki.net uovuf.hijoushiki.net
vienna.alcofenceco.com vienna.alcofenceco.com
bradleyreviews.com bradleyreviews.com
yxnac.nvmanba.com yxnac.nvmanba.com
go.grade.us go.grade.us
feedback.michigantherapyinstitute.com feedback.michigantherapyinstitute.com
feedback.pulaskilawfirm.com feedback.pulaskilawfirm.com
patriotpools.reviewzing.com patriotpools.reviewzing.com
platinumexteriors.reviewzing.com platinumexteriors.reviewzing.com
poctest.whitelabelexample.com poctest.whitelabelexample.com
review.absairinc.com review.absairinc.com
review.blackpearlva.com review.blackpearlva.com
review.northernillinoisrecovery.com review.northernillinoisrecovery.com
review.nytrafficticket.com review.nytrafficticket.com
review.plsauto.com review.plsauto.com
reviewcainandco.com reviewcainandco.com
reviewfortunemarketing.com reviewfortunemarketing.com
reviewgreatlakesimaging.com reviewgreatlakesimaging.com
reviewgrumblesroofing.com reviewgrumblesroofing.com
reviewinsognacpa.com reviewinsognacpa.com
reviewjudetechnology.com reviewjudetechnology.com
reviewmachinait.com reviewmachinait.com
reviewmammamarias.com reviewmammamarias.com
reviewmarshalllifestylemedicine.com reviewmarshalllifestylemedicine.com
reviewnoctechs.com reviewnoctechs.com
reviewpro.today reviewpro.today
reviewproservicebuilders.com reviewproservicebuilders.com
reviewryantechinc.com reviewryantechinc.com
reviews.airprofessionalsinc.com reviews.airprofessionalsinc.com
reviews.allentownasthma.com reviews.allentownasthma.com
reviews.allvinylgraphicsolutions.com reviews.allvinylgraphicsolutions.com
reviews.baumholtzplasticsurgery.com reviews.baumholtzplasticsurgery.com
reviews.bellestreeservicepa.com reviews.bellestreeservicepa.com
reviews.buzzkillpestcontrol.com reviews.buzzkillpestcontrol.com
reviews.carvision.com reviews.carvision.com
reviews.cleanright123.com reviews.cleanright123.com
reviews.cloutair.com reviews.cloutair.com
reviews.customerserv.com reviews.customerserv.com
reviews.diamondjacks.com reviews.diamondjacks.com
reviews.dryprosystems.com reviews.dryprosystems.com
reviews.firstpagemedia.com reviews.firstpagemedia.com
reviews.generations-care.com reviews.generations-care.com
reviews.handmiami.com reviews.handmiami.com
reviews.hixonhomeimprovements.com reviews.hixonhomeimprovements.com
reviews.madisongaragedoorservices.com reviews.madisongaragedoorservices.com
reviews.managedservicesgroupllc.com reviews.managedservicesgroupllc.com
reviews.mandwpest.com reviews.mandwpest.com
reviews.mazzeolaw.ca reviews.mazzeolaw.ca
reviews.michiganheadandneck.com reviews.michiganheadandneck.com
reviews.mmclawpa.com reviews.mmclawpa.com
reviews.myersrealty.com reviews.myersrealty.com
reviews.newimagecsc.com reviews.newimagecsc.com
reviews.newzealandluxuryescapes.com reviews.newzealandluxuryescapes.com
reviews.ocean13ocmd.com reviews.ocean13ocmd.com
reviews.pawindowtint.com reviews.pawindowtint.com
reviews.restoration-pro.com reviews.restoration-pro.com
reviews.richarddiehlpaving.com reviews.richarddiehlpaving.com
reviews.rlpmax.ca reviews.rlpmax.ca
reviews.robertsdaledental.com reviews.robertsdaledental.com
reviews.specialtydrapery.com reviews.specialtydrapery.com
reviews.talbertgutters.com reviews.talbertgutters.com
reviews.thebasementguyscleveland.com reviews.thebasementguyscleveland.com
reviews.titleonemanagement.com reviews.titleonemanagement.com
reviews.txcrimdefense.com reviews.txcrimdefense.com
reviews.utilitywraps.com reviews.utilitywraps.com
reviews.vantmarketing.com reviews.vantmarketing.com
reviews.whitepearlmgmt.com reviews.whitepearlmgmt.com
reviews.windrivermicrobes.com reviews.windrivermicrobes.com
reviewsdallas.dextercompany.com reviewsdallas.dextercompany.com
reviewstoneworthrooftile.com reviewstoneworthrooftile.com
reviewtechnologysolutions.com reviewtechnologysolutions.com
reviewthecourse.com reviewthecourse.com
reviewunclepetespizza.com reviewunclepetespizza.com
reviewusastoragecenter.com reviewusastoragecenter.com
reviewvalleycorporation.com reviewvalleycorporation.com
armourtitlecompany.reviewzing.com armourtitlecompany.reviewzing.com
reviews.indianafoundation.com reviews.indianafoundation.com
seoforgrowth.reviews seoforgrowth.reviews
skylinee3reviews.com skylinee3reviews.com
thomasbeachvacations-reviews.stylestrandmedia.com thomasbeachvacations-reviews.stylestrandmedia.com
bewertung.wischmann-fahrzeugbau.de bewertung.wischmann-fahrzeugbau.de
vins.reviewzing.com vins.reviewzing.com
bws.reviewzing.com bws.reviewzing.com
cfosource.reviewzing.com cfosource.reviewzing.com
dotamy.com dotamy.com
emma-fashion-reviews.stylestrandmedia.com emma-fashion-reviews.stylestrandmedia.com
excelkcreviews.com excelkcreviews.com
feedback.probateadvance.com feedback.probateadvance.com
feedback.superiorcontractcleaning.com feedback.superiorcontractcleaning.com
healthylooksreviews.com healthylooksreviews.com
martinheatandair-reviews.stylestrandmedia.com martinheatandair-reviews.stylestrandmedia.com
marylandsbest.reviewzing.com marylandsbest.reviewzing.com
provinziano.review provinziano.review
REVIEWS.ROSEWOODFORTO.COM
IP History

🚫 We do not have any IP usage history for this domain.