RISINGINDUSTRIES.CO.IN
Shared Attributes
Domain
ktclaser.com ktclaser.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Sep 2024 Sep 2024 11 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
lyxarpoolsindia.com lyxarpoolsindia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 132 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com metasteel.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com needsinternational.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com princeenterprises.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com aaradhyaindustries.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com saifienterprises.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com akmetals.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com shahindustries.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com astrotech.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com ultratilemachine.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com unitechmachinery.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com bimixmachines.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
boxtechportablecabin.com boxtechportablecabin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Jul 2024 Sep 2024 48 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com zioncabins.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com cookkart.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com dolphinappliances.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
exquisiteartsstudio.com exquisiteartsstudio.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 137 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com farmcutagro.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
gorektechnologies.in gorektechnologies.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Aug 2024 Sep 2024 25 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
haryanabakerymachines.co.in haryanabakerymachines.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Apr 2024 Sep 2024 143 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com hetsinghtandoors.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com jktilesmachinery.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
kiranhydraulics.co.in kiranhydraulics.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Apr 2024 Sep 2024 143 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com kookmate.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
kgnindustry.in kgnindustry.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 134 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
lasermarkingsystem.com lasermarkingsystem.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 133 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com lotusexports.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com mahifoodtechnology.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com nakroninfra.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com nrhygienesolutions.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com packmaster-machinery.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com progressivesystems.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com aeronomequipments.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com shamaglobal.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com ankurtradersandmanufacteres.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com theonekitchenequipment.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com bharattilesmachine.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com cbenterprises.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
foodmachinemanufacturer.com foodmachinemanufacturer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 136 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com foodmartagroengineering.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com frostmaster.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
groovefabinternational.in groovefabinternational.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Aug 2024 Sep 2024 25 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
hydrauliccarwashinglift.com hydrauliccarwashinglift.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Aug 2024 Sep 2024 17 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
idealglobalindustries.com idealglobalindustries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 135 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com rstensile.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com sahjanandengineering.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com arportablecabins.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aksharprecast.net aksharprecast.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Apr 2024 Sep 2024 144 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com shreekrishnaengineeringworks.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com anarrubtech.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com unikoindustries.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com fabtechenterprises.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com greenenergyprojects.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com haimayaengineering.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com hvbexports.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com innbox-modular-prefab.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com jacksonmachine.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
maanagnechiyadevelopers.com maanagnechiyadevelopers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 132 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com meraki-expert.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
multi-packaging.in multi-packaging.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com prajktaenterprises.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com radheykrishnaindustries.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
robust-enterprises.com robust-enterprises.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Jun 2024 Sep 2024 99 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com aandakitchenindustries.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com skfabrication.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com skindustries.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com sktilesmachinery.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com sleekwindowgallery.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com atlantictilemachinery.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com sunlightkitchensolutions.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
ahataindia.in ahataindia.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Apr 2024 Sep 2024 145 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
ayushlighting.in ayushlighting.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Jul 2024 Sep 2024 61 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com babatilesmachinery.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com venuskitchenequipment.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com yashwaterpurifiers.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com zenerrefrigeration.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
confiderindustries.co.in confiderindustries.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Apr 2024 Sep 2024 139 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com daconimpex.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com deeptandoors.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
duke-enterprises.in duke-enterprises.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Apr 2024 Sep 2024 138 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com easternrefrigeration.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
flora-industries.com flora-industries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Aug 2024 Sep 2024 28 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
fortuneengineer.co.in fortuneengineer.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 136 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com gosevaagro.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
greenevolutions.co.in greenevolutions.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Aug 2024 Sep 2024 25 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
hydroking.ltd hydroking.ltd
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Aug 2024 Sep 2024 17 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com indersinghtandoors.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com jai-durge-industries.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com jktilesmachineryassam.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
leadermachinetools.in leadermachinetools.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 133 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
maxindustries.net maxindustries.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 132 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com odishasolutions.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com punekitchenequipments.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com rdindustries.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024 171 days
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
lasercuttingmachine.co lasercuttingmachine.co
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
cementconcretehardener.com cementconcretehardener.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
cementpillar.com cementpillar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
securitycabins.in securitycabins.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
airventilators.co.in airventilators.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
sublimationprintingmachine.in sublimationprintingmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
suparicuttingmachine.com suparicuttingmachine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
asbestoscementsheet.com asbestoscementsheet.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
tensilestructures.co.in tensilestructures.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
automaticgoldrefiningmachine.com automaticgoldrefiningmachine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
barcodeprinters.in barcodeprinters.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
besanmakingmachine.com besanmakingmachine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
brickmakingmachines.in brickmakingmachines.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
claytandoor.in claytandoor.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
commercialkitchenproducts.com commercialkitchenproducts.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
containerhouse.store containerhouse.store
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
electricchainhoist.in electricchainhoist.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
electrichoists.in electrichoists.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
flyashbrickmakingmachine.in flyashbrickmakingmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
cakedisplaycounter.com cakedisplaycounter.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
glasstopfreezer.com glasstopfreezer.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
hvlsfan.info hvlsfan.info
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
iceblockmakingmachine.com iceblockmakingmachine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
idlisteamer.com idlisteamer.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
industrialwaterchiller.in industrialwaterchiller.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
khoyamakingmachine.in khoyamakingmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
kitchencoldroom.com kitchencoldroom.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
conveyorbelt.co.in conveyorbelt.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aajjo.com opsudyog.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Mar 2024 Jun 2024 81 days
poonawalamachinetools.co.in poonawalamachinetools.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Sep 2024 Sep 2024 One Off
ad-packaging.co.in ad-packaging.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Jul 2024 Sep 2024 76 days
santecindia.in santecindia.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 128 days
shree-ganesh-enterprises.in shree-ganesh-enterprises.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 127 days
sudamaprefab.com sudamaprefab.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 126 days
sunrise-industries.org sunrise-industries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Jun 2024 30 days
yaariindustries.com yaariindustries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 123 days
inshasports.com inshasports.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 135 days
marblegodstatue.net marblegodstatue.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
masalamixermachine.com masalamixermachine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
monkeyhoistmachine.in monkeyhoistmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
ricemillmachinery.net ricemillmachinery.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
roofpufpanel.com roofpufpanel.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aluminiumdoor.in aluminiumdoor.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
tentaircooler.in tentaircooler.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
automaticrollingshutter.in automaticrollingshutter.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
bestmodularkitchen.in bestmodularkitchen.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
visicoolerglasstype.com visicoolerglasstype.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
wirestraighteningmachine.in wirestraighteningmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
cementconcretemixer.in cementconcretemixer.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
conveyorroller.in conveyorroller.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
ductableac.com ductableac.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
cashcountingmachine.net cashcountingmachine.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
hydraulicmachines.net hydraulicmachines.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
hydraulicpress.website hydraulicpress.website
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
idcardprinter.in idcardprinter.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
industrialblowers.co.in industrialblowers.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
industrialshed.in industrialshed.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
robustenterprises.net robustenterprises.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 May 2024 One Off
shreeisradevi.com shreeisradevi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Jun 2024 Sep 2024 98 days
aajjo.com brandrajequipment.aajjo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Jun 2024 Sep 2024 90 days
weldman.co.in weldman.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 124 days
brickmakingmachine.in brickmakingmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
airconditioningsystems.in airconditioningsystems.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
shippingcontainer.in shippingcontainer.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
upvcdoorandwindow.com upvcdoorandwindow.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
upvcroofingsheet.in upvcroofingsheet.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
blastfreezer.net blastfreezer.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
blowmoldingmachines.in blowmoldingmachines.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
waterchillerplant.com waterchillerplant.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
clcblockmakingmachine.com clcblockmakingmachine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
commercialexhaustsystem.com commercialexhaustsystem.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
commercialwashingmachine.in commercialwashingmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
compressedairdryer.co.in compressedairdryer.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
controlpanelonline.net controlpanelonline.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
dalmillmachine.co.in dalmillmachine.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
flourmillmachine.net flourmillmachine.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
highmastpole.in highmastpole.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
hydraulicdrumliftercumtilter.com hydraulicdrumliftercumtilter.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
hydraulicscissorlifttable.com hydraulicscissorlifttable.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
industrialchillers.in industrialchillers.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
industrialscrubber.in industrialscrubber.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
shreemangaldeepsales.in shreemangaldeepsales.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 127 days
skpcpl.in skpcpl.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 127 days
hindustancorporation.org hindustancorporation.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 May 2024 25 days
joypack.in joypack.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 May 2024 26 days
namibind.net namibind.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 125 days
ramvilasbrushworks.com ramvilasbrushworks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Sep 2024 Sep 2024 One Off
ripeningchamber.com ripeningchamber.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
ripeningchamber.in ripeningchamber.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
sanitarynapkinvendingmachine.in sanitarynapkinvendingmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
aluminiumautomaticrollingshutter.com aluminiumautomaticrollingshutter.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
stainlesssteelgate.com stainlesssteelgate.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
autofilterwatersofteners.com autofilterwatersofteners.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
bandsealingmachine.net bandsealingmachine.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
barbedwiremakingmachine.com barbedwiremakingmachine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
chainpulleyblock.in chainpulleyblock.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
chatdisplaycounter.com chatdisplaycounter.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
chipsmakingmachine.in chipsmakingmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
displaycounter.net displaycounter.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
exhaustfans.co.in exhaustfans.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
cakedisplaycounter.net cakedisplaycounter.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
gazebotensilestructure.com gazebotensilestructure.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
goldrefiningmachine.in goldrefiningmachine.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
goodslift.net goodslift.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
highliftpallettruck.com highliftpallettruck.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
hydraulichandpallettrucks.com hydraulichandpallettrucks.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
modularcoldrooms.in modularcoldrooms.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
mushroomcoldstorage.com mushroomcoldstorage.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024 One Off
vashisht-enterprises.com vashisht-enterprises.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN Jun 2024 Sep 2024 93 days
jrmseng.co.in jrmseng.co.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 May 2024 26 days
pentagonmachinestools.com pentagonmachinestools.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 127 days
potentwater.in potentwater.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-J3VC4M77BN May 2024 Sep 2024 127 days
RISINGINDUSTRIES.CO.IN
Non IP Attributes
Attribute First Last
GTM GTM-G-J3VC4M77BN Mar 2024 Sep 2024
CA CA-PUB-8173272091944445 Sep 2024 Sep 2024
RISINGINDUSTRIES.CO.IN
Overlap Attribute Domains
ktclaser.com ktclaser.com
lyxarpoolsindia.com lyxarpoolsindia.com
metasteel.aajjo.com metasteel.aajjo.com
needsinternational.aajjo.com needsinternational.aajjo.com
princeenterprises.aajjo.com princeenterprises.aajjo.com
aaradhyaindustries.aajjo.com aaradhyaindustries.aajjo.com
saifienterprises.aajjo.com saifienterprises.aajjo.com
akmetals.aajjo.com akmetals.aajjo.com
shahindustries.aajjo.com shahindustries.aajjo.com
astrotech.aajjo.com astrotech.aajjo.com
ultratilemachine.aajjo.com ultratilemachine.aajjo.com
unitechmachinery.aajjo.com unitechmachinery.aajjo.com
bimixmachines.aajjo.com bimixmachines.aajjo.com
boxtechportablecabin.com boxtechportablecabin.com
zioncabins.aajjo.com zioncabins.aajjo.com
cookkart.aajjo.com cookkart.aajjo.com
dolphinappliances.aajjo.com dolphinappliances.aajjo.com
exquisiteartsstudio.com exquisiteartsstudio.com
farmcutagro.aajjo.com farmcutagro.aajjo.com
gorektechnologies.in gorektechnologies.in
haryanabakerymachines.co.in haryanabakerymachines.co.in
hetsinghtandoors.aajjo.com hetsinghtandoors.aajjo.com
jktilesmachinery.aajjo.com jktilesmachinery.aajjo.com
kiranhydraulics.co.in kiranhydraulics.co.in
kookmate.aajjo.com kookmate.aajjo.com
kgnindustry.in kgnindustry.in
lasermarkingsystem.com lasermarkingsystem.com
lotusexports.aajjo.com lotusexports.aajjo.com
mahifoodtechnology.aajjo.com mahifoodtechnology.aajjo.com
nakroninfra.aajjo.com nakroninfra.aajjo.com
nrhygienesolutions.aajjo.com nrhygienesolutions.aajjo.com
packmaster-machinery.aajjo.com packmaster-machinery.aajjo.com
progressivesystems.aajjo.com progressivesystems.aajjo.com
aeronomequipments.aajjo.com aeronomequipments.aajjo.com
shamaglobal.aajjo.com shamaglobal.aajjo.com
ankurtradersandmanufacteres.aajjo.com ankurtradersandmanufacteres.aajjo.com
theonekitchenequipment.aajjo.com theonekitchenequipment.aajjo.com
bharattilesmachine.aajjo.com bharattilesmachine.aajjo.com
cbenterprises.aajjo.com cbenterprises.aajjo.com
foodmachinemanufacturer.com foodmachinemanufacturer.com
foodmartagroengineering.aajjo.com foodmartagroengineering.aajjo.com
frostmaster.aajjo.com frostmaster.aajjo.com
groovefabinternational.in groovefabinternational.in
hydrauliccarwashinglift.com hydrauliccarwashinglift.com
idealglobalindustries.com idealglobalindustries.com
rstensile.aajjo.com rstensile.aajjo.com
sahjanandengineering.aajjo.com sahjanandengineering.aajjo.com
arportablecabins.aajjo.com arportablecabins.aajjo.com
aksharprecast.net aksharprecast.net
shreekrishnaengineeringworks.aajjo.com shreekrishnaengineeringworks.aajjo.com
anarrubtech.aajjo.com anarrubtech.aajjo.com
unikoindustries.aajjo.com unikoindustries.aajjo.com
fabtechenterprises.aajjo.com fabtechenterprises.aajjo.com
greenenergyprojects.aajjo.com greenenergyprojects.aajjo.com
haimayaengineering.aajjo.com haimayaengineering.aajjo.com
hvbexports.aajjo.com hvbexports.aajjo.com
innbox-modular-prefab.aajjo.com innbox-modular-prefab.aajjo.com
jacksonmachine.aajjo.com jacksonmachine.aajjo.com
maanagnechiyadevelopers.com maanagnechiyadevelopers.com
meraki-expert.aajjo.com meraki-expert.aajjo.com
multi-packaging.in multi-packaging.in
prajktaenterprises.aajjo.com prajktaenterprises.aajjo.com
radheykrishnaindustries.aajjo.com radheykrishnaindustries.aajjo.com
risingindustries.co.in risingindustries.co.in
robust-enterprises.com robust-enterprises.com
aandakitchenindustries.aajjo.com aandakitchenindustries.aajjo.com
skfabrication.aajjo.com skfabrication.aajjo.com
skindustries.aajjo.com skindustries.aajjo.com
sktilesmachinery.aajjo.com sktilesmachinery.aajjo.com
sleekwindowgallery.aajjo.com sleekwindowgallery.aajjo.com
atlantictilemachinery.aajjo.com atlantictilemachinery.aajjo.com
sunlightkitchensolutions.aajjo.com sunlightkitchensolutions.aajjo.com
ahataindia.in ahataindia.in
ayushlighting.in ayushlighting.in
babatilesmachinery.aajjo.com babatilesmachinery.aajjo.com
venuskitchenequipment.aajjo.com venuskitchenequipment.aajjo.com
yashwaterpurifiers.aajjo.com yashwaterpurifiers.aajjo.com
zenerrefrigeration.aajjo.com zenerrefrigeration.aajjo.com
confiderindustries.co.in confiderindustries.co.in
daconimpex.aajjo.com daconimpex.aajjo.com
deeptandoors.aajjo.com deeptandoors.aajjo.com
duke-enterprises.in duke-enterprises.in
easternrefrigeration.aajjo.com easternrefrigeration.aajjo.com
flora-industries.com flora-industries.com
fortuneengineer.co.in fortuneengineer.co.in
gosevaagro.aajjo.com gosevaagro.aajjo.com
greenevolutions.co.in greenevolutions.co.in
hydroking.ltd hydroking.ltd
indersinghtandoors.aajjo.com indersinghtandoors.aajjo.com
jai-durge-industries.aajjo.com jai-durge-industries.aajjo.com
jktilesmachineryassam.aajjo.com jktilesmachineryassam.aajjo.com
leadermachinetools.in leadermachinetools.in
maxindustries.net maxindustries.net
odishasolutions.aajjo.com odishasolutions.aajjo.com
punekitchenequipments.aajjo.com punekitchenequipments.aajjo.com
rdindustries.aajjo.com rdindustries.aajjo.com
aajjo.com aajjo.com
lasercuttingmachine.co lasercuttingmachine.co
cementconcretehardener.com cementconcretehardener.com
cementpillar.com cementpillar.com
securitycabins.in securitycabins.in
airventilators.co.in airventilators.co.in
sublimationprintingmachine.in sublimationprintingmachine.in
suparicuttingmachine.com suparicuttingmachine.com
asbestoscementsheet.com asbestoscementsheet.com
tensilestructures.co.in tensilestructures.co.in
automaticgoldrefiningmachine.com automaticgoldrefiningmachine.com
barcodeprinters.in barcodeprinters.in
besanmakingmachine.com besanmakingmachine.com
brickmakingmachines.in brickmakingmachines.in
claytandoor.in claytandoor.in
commercialkitchenproducts.com commercialkitchenproducts.com
containerhouse.store containerhouse.store
electricchainhoist.in electricchainhoist.in
electrichoists.in electrichoists.in
flyashbrickmakingmachine.in flyashbrickmakingmachine.in
cakedisplaycounter.com cakedisplaycounter.com
glasstopfreezer.com glasstopfreezer.com
hvlsfan.info hvlsfan.info
iceblockmakingmachine.com iceblockmakingmachine.com
idlisteamer.com idlisteamer.com
industrialwaterchiller.in industrialwaterchiller.in
khoyamakingmachine.in khoyamakingmachine.in
kitchencoldroom.com kitchencoldroom.com
conveyorbelt.co.in conveyorbelt.co.in
opsudyog.aajjo.com opsudyog.aajjo.com
poonawalamachinetools.co.in poonawalamachinetools.co.in
ad-packaging.co.in ad-packaging.co.in
santecindia.in santecindia.in
shree-ganesh-enterprises.in shree-ganesh-enterprises.in
sudamaprefab.com sudamaprefab.com
sunrise-industries.org sunrise-industries.org
yaariindustries.com yaariindustries.com
inshasports.com inshasports.com
marblegodstatue.net marblegodstatue.net
masalamixermachine.com masalamixermachine.com
monkeyhoistmachine.in monkeyhoistmachine.in
ricemillmachinery.net ricemillmachinery.net
roofpufpanel.com roofpufpanel.com
aluminiumdoor.in aluminiumdoor.in
tentaircooler.in tentaircooler.in
automaticrollingshutter.in automaticrollingshutter.in
bestmodularkitchen.in bestmodularkitchen.in
visicoolerglasstype.com visicoolerglasstype.com
wirestraighteningmachine.in wirestraighteningmachine.in
cementconcretemixer.in cementconcretemixer.in
conveyorroller.in conveyorroller.in
ductableac.com ductableac.com
cashcountingmachine.net cashcountingmachine.net
hydraulicmachines.net hydraulicmachines.net
hydraulicpress.website hydraulicpress.website
idcardprinter.in idcardprinter.in
industrialblowers.co.in industrialblowers.co.in
industrialshed.in industrialshed.in
robustenterprises.net robustenterprises.net
shreeisradevi.com shreeisradevi.com
brandrajequipment.aajjo.com brandrajequipment.aajjo.com
weldman.co.in weldman.co.in
brickmakingmachine.in brickmakingmachine.in
airconditioningsystems.in airconditioningsystems.in
shippingcontainer.in shippingcontainer.in
upvcdoorandwindow.com upvcdoorandwindow.com
upvcroofingsheet.in upvcroofingsheet.in
blastfreezer.net blastfreezer.net
blowmoldingmachines.in blowmoldingmachines.in
waterchillerplant.com waterchillerplant.com
clcblockmakingmachine.com clcblockmakingmachine.com
commercialexhaustsystem.com commercialexhaustsystem.com
commercialwashingmachine.in commercialwashingmachine.in
compressedairdryer.co.in compressedairdryer.co.in
controlpanelonline.net controlpanelonline.net
dalmillmachine.co.in dalmillmachine.co.in
flourmillmachine.net flourmillmachine.net
highmastpole.in highmastpole.in
hydraulicdrumliftercumtilter.com hydraulicdrumliftercumtilter.com
hydraulicscissorlifttable.com hydraulicscissorlifttable.com
industrialchillers.in industrialchillers.in
industrialscrubber.in industrialscrubber.in
shreemangaldeepsales.in shreemangaldeepsales.in
skpcpl.in skpcpl.in
hindustancorporation.org hindustancorporation.org
joypack.in joypack.in
namibind.net namibind.net
ramvilasbrushworks.com ramvilasbrushworks.com
ripeningchamber.com ripeningchamber.com
ripeningchamber.in ripeningchamber.in
sanitarynapkinvendingmachine.in sanitarynapkinvendingmachine.in
aluminiumautomaticrollingshutter.com aluminiumautomaticrollingshutter.com
stainlesssteelgate.com stainlesssteelgate.com
autofilterwatersofteners.com autofilterwatersofteners.com
bandsealingmachine.net bandsealingmachine.net
barbedwiremakingmachine.com barbedwiremakingmachine.com
chainpulleyblock.in chainpulleyblock.in
chatdisplaycounter.com chatdisplaycounter.com
chipsmakingmachine.in chipsmakingmachine.in
displaycounter.net displaycounter.net
exhaustfans.co.in exhaustfans.co.in
cakedisplaycounter.net cakedisplaycounter.net
gazebotensilestructure.com gazebotensilestructure.com
goldrefiningmachine.in goldrefiningmachine.in
goodslift.net goodslift.net
highliftpallettruck.com highliftpallettruck.com
hydraulichandpallettrucks.com hydraulichandpallettrucks.com
modularcoldrooms.in modularcoldrooms.in
mushroomcoldstorage.com mushroomcoldstorage.com
vashisht-enterprises.com vashisht-enterprises.com
jrmseng.co.in jrmseng.co.in
pentagonmachinestools.com pentagonmachinestools.com
potentwater.in potentwater.in
RISINGINDUSTRIES.CO.IN
IP History

Click the IP addresses to see over domains using them.