Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

VCC.NET

VCC.NET
Shared Attributes
Domain
kristyandlindani.com kristyandlindani.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
kts-verpackungen.de kts-verpackungen.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
laurenlentini.com laurenlentini.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
littleashcanart.com littleashcanart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
llcstudios.com llcstudios.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
loneoaktrucking.com loneoaktrucking.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
longhaulproductions.net longhaulproductions.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
luderstech.com luderstech.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
maacaccess.com maacaccess.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2017 3 years, 142 days
madebycocoa.com madebycocoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
magnoliapublicschools.org magnoliapublicschools.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2014 Jun 2015 1 year, 149 days
managingassaults.com managingassaults.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
marinasalvador.com marinasalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
marketingdereseausolution.com marketingdereseausolution.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2015 Oct 2017 2 years, 125 days
marout-caspian.org marout-caspian.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
massbankruptcylawyer7.com massbankruptcylawyer7.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
mauiclothing.com mauiclothing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
mcla-inc.com mcla-inc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
medflex.com.br medflex.com.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
meii.de meii.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2015 3 years, 232 days
microdivision.co.za microdivision.co.za
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
middleburgsocialsecuritylawyer.com middleburgsocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
midwaybeach.org midwaybeach.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2012 Dec 2012 303 days
mieldequartier.org mieldequartier.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Apr 2017 187 days
mijn-blokje.nl mijn-blokje.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
missourifilm.com missourifilm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Oct 2017 356 days
moehlmillwork.com moehlmillwork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Mar 2012 12 days
morriswebsitedesign.com morriswebsitedesign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
ncgolfcommunity-championhills.com ncgolfcommunity-championhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
nctrianglebirthnetwork.org nctrianglebirthnetwork.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
pixelcloudgames.com pixelcloudgames.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
northbaycorvette.com northbaycorvette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
obs-pernik.bg obs-pernik.bg
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
rapidplans.com.au rapidplans.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
onlineview.dk onlineview.dk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangeparkbraininjurylawyer.com orangeparkbraininjurylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangeparkmotorcycleaccidentlawyer.com orangeparkmotorcycleaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangeparksocialsecuritylawyer.com orangeparksocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangeparktruckaccidentlawyers.com orangeparktruckaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangetiemedia.com orangetiemedia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
orientationcoaching.com orientationcoaching.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
osmaniandco.com osmaniandco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
palatkamedicalmalpracticelawyer.com palatkamedicalmalpracticelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
palatkamotorcycleaccidentlawyers.com palatkamotorcycleaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
pathwaysdropin.org pathwaysdropin.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
paulalexanderphotography.com paulalexanderphotography.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
peces-disco.com peces-disco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
perfectevn.com perfectevn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
photographytouch.com photographytouch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Oct 2017 4 years, 194 days
pixelcloud-games.at pixelcloud-games.at
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
pixelcloudgames.at pixelcloudgames.at
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
pixelko.ca pixelko.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2013 May 2013 One Off
plumbercarlsbad.net plumbercarlsbad.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
pmprollc.com pmprollc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
power2persuade.com power2persuade.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
progressus-alliance.ru progressus-alliance.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
prouspex.com prouspex.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jul 2016 2 years, 290 days
prphair.com prphair.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Oct 2013 201 days
pulomascenterpark.com pulomascenterpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Aug 2017 1 year, 140 days
questra.nl questra.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jul 2016 4 years, 133 days
quincybankruptcylawyer.com quincybankruptcylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
referralfeenetwork.com referralfeenetwork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
reporterstrap.pl reporterstrap.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2016 218 days
reuvenschool.edu.co reuvenschool.edu.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
rhosecosmetics.com rhosecosmetics.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
robertrommel.com robertrommel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
adremcorp.com adremcorp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2017 Oct 2017 268 days
samplelogic.com samplelogic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jan 2016 3 years, 332 days
sarapendlebury.com sarapendlebury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
ahorseandawizard.biz ahorseandawizard.biz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2017 3 years, 142 days
seniorsgiving.com seniorsgiving.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
setdata.es setdata.es
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Aug 2017 1 year, 140 days
altqniah.sa altqniah.sa
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Aug 2017 Oct 2017 57 days
alturnativesource.com alturnativesource.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2017 Oct 2017 238 days
shilohsophiastudios.com shilohsophiastudios.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
almasibley.com almasibley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
aml.com.ve aml.com.ve
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Oct 2017 1 year, 114 days
silverwheelscycling.net silverwheelscycling.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
silzar.com silzar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
site-norte.pt site-norte.pt
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2017 Oct 2017 151 days
americasfinestfitness.com americasfinestfitness.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jul 2016 2 years, 274 days
ameublement-cuisines.com ameublement-cuisines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2016 2 years, 160 days
ane-cob.com ane-cob.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Oct 2017 4 years, 194 days
sknrz.net sknrz.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Dec 2016 281 days
sleepbreeze.com sleepbreeze.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 May 2016 2 years, 206 days
annegret-hartmann.de annegret-hartmann.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
smilesremembered.com smilesremembered.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2012 Dec 2013 364 days
spoonedfork.com spoonedfork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
sriviere.com sriviere.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
artconsultingvancouver.com artconsultingvancouver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
artisanimation.com artisanimation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
standrewsdebates.org standrewsdebates.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
staugustinesocialsecuritylawyer.com staugustinesocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
steadfasteng.com steadfasteng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
steeringwheelsponge.co.uk steeringwheelsponge.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2017 Oct 2017 238 days
abdulwahidjc.com abdulwahidjc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 49 days
studiolegalelavoro.com studiolegalelavoro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
successcopilot.com successcopilot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
successcopilotsupport.com successcopilotsupport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2012 May 2012 69 days
anchorpointministry.org anchorpointministry.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
annette.co.il annette.co.il
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2017 Oct 2017 216 days
sylviabridal.com sylviabridal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Feb 2017 3 years, 120 days
athenamorgen.com athenamorgen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 46 days
tcheruenterprises.com tcheruenterprises.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
taxreturn247.com.au taxreturn247.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
teams.org.in teams.org.in
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Oct 2017 1 year, 2 days
team-academy.nl team-academy.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
avongro.com.au avongro.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
theresourcepeople.com theresourcepeople.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
therunninglab.co.uk therunninglab.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
tiggspondretreatcenter.com tiggspondretreatcenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
bashkigeneration.com bashkigeneration.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
beatdan.com beatdan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
trainsmarter.de trainsmarter.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
tvrcarclub.be tvrcarclub.be
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2017 Oct 2017 238 days
bigfactory.net bigfactory.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
universalaccidentlawyers.com universalaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
vabeachlandscaping.com vabeachlandscaping.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
blazingtrailscenter.com blazingtrailscenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
video-marketing-club.com video-marketing-club.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2016 Oct 2017 1 year, 149 days
voiceovercity.com voiceovercity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
bogan-es.com bogan-es.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
web-for-people.ru web-for-people.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2012 Apr 2012 One Off
boxer-xena.nl boxer-xena.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Oct 2017 1 year, 114 days
bravodevelopments.com bravodevelopments.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
windhamarts.org windhamarts.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2012 252 days
bushgardensaccidentlawyer.com bushgardensaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
business2websolutions.com business2websolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
calgaryweddingvideos.com calgaryweddingvideos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
cantbuystyle.com cantbuystyle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
carolinahealthcaresolutions.com carolinahealthcaresolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jun 2016 2 years, 244 days
carotel.com.au carotel.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2014 Oct 2017 3 years, 274 days
ymonetize.com ymonetize.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2012 223 days
cateringbybrenda.com cateringbybrenda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2013 Aug 2016 3 years, 183 days
zavod-emma.si zavod-emma.si
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
zonenlicht.com zonenlicht.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Oct 2017 5 years, 2 days
change-now.co.uk change-now.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
chargerboxes.com chargerboxes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
cigarkingny.com cigarkingny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
cityexpert.pro cityexpert.pro
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
cityislandpta.com cityislandpta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
claremorechristian.com claremorechristian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
claritymedia.net claritymedia.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
claycountyinjurylawyer.com claycountyinjurylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
cleaningmaster.in cleaningmaster.in
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
cocounsels.com cocounsels.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
commandercsi.com commandercsi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Dec 2016 281 days
connectemerson.com connectemerson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
corvermarinesafety.com corvermarinesafety.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
creativehomesolutions.com creativehomesolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
creativemotion.com.au creativemotion.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
creativepegwork.com creativepegwork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
creloaded.com.au creloaded.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
cremoplast-tech.com cremoplast-tech.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jun 2016 84 days
cuisines-bollery.com cuisines-bollery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
daytonabeachmotorcycleaccidentlawyers.com daytonabeachmotorcycleaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
daytonamedicalmalpracticelawyer.com daytonamedicalmalpracticelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
dbnplanning.com dbnplanning.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
decodreams.com.my decodreams.com.my
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Oct 2016 159 days
deductionandanalysis.com deductionandanalysis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
delama.com.ar delama.com.ar
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
delandnursinghomelawyer.com delandnursinghomelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
digitalstoryteller.net digitalstoryteller.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Jan 2014 310 days
disualstudio.com disualstudio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
djsimcha.com djsimcha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
dmsa.kz dmsa.kz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2013 Oct 2017 4 years, 151 days
dorndempsey.com dorndempsey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
downtowndining.ca downtowndining.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
ducphan.de ducphan.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Dec 2016 3 years, 76 days
dutchdimensions.com dutchdimensions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jun 2017 3 years, 259 days
easygolfadvice.com easygolfadvice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
edgedweaponsolutions.com edgedweaponsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
eigstudies.com eigstudies.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
eigstudies.net eigstudies.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
envisionz.com envisionz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
fairytaleproductions.net fairytaleproductions.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Nov 2012 28 days
fbgatecash.com fbgatecash.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2012 Mar 2012 One Off
feel-good-verlag.de feel-good-verlag.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
feelgood-verlag.de feelgood-verlag.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
filtertexas.com filtertexas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
findmysouvenir.com findmysouvenir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
firstparishbrewster.org firstparishbrewster.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2012 Oct 2013 1 year, 100 days
floridacruiselawyers.net floridacruiselawyers.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fortlauderdalecruiselawyers.com fortlauderdalecruiselawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
girtzindustries.com girtzindustries.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
goodmonsters.com.au goodmonsters.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
hamishniven.co.za hamishniven.co.za
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jan 2013 346 days
happyhikershappycampers.com happyhikershappycampers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
horseandbamboo.org horseandbamboo.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2016 2 years, 160 days
hospitality-films.com hospitality-films.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
hrd.biz hrd.biz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
ideastampa.it ideastampa.it
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
imagehoorn.nl imagehoorn.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2017 Oct 2017 180 days
imperialaquatics.com imperialaquatics.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Feb 2017 4 years, 127 days
imprintintertwine.com imprintintertwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
intermedium.fr intermedium.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2017 Jul 2017 One Off
islippedandfell.net islippedandfell.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvilleworkerscompensationaccidentlawyers.com jacksonvilleworkerscompensationaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jamesnet.net jamesnet.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
kapsalon-prestige.nl kapsalon-prestige.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Oct 2017 1 year, 161 days
koaloha.com koaloha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2013 Apr 2013 One Off
konacoffeesd.com konacoffeesd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
julienaldeguer.com julienaldeguer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
kaloca.com kaloca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jun 2017 5 years, 105 days
kapcityconstruction.com kapcityconstruction.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2013 Oct 2017 4 years, 109 days
karlolack.de karlolack.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Oct 2017 1 year, 161 days
karteksogutma.com.tr karteksogutma.com.tr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Sep 2017 Oct 2017 25 days
kesifarge.com kesifarge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2017 Oct 2017 124 days
kidsfc.com.au kidsfc.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
kmti.org kmti.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Mar 2013 1 year, 35 days
knifefighting.com knifefighting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
koerperstyling.info koerperstyling.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jul 2017 3 years, 267 days
kristinalexandratidwell.com kristinalexandratidwell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
lakecityaccidentlawyer.com lakecityaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
latapatia-fm.com latapatia-fm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2016 3 years, 13 days
laube-web.com laube-web.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
laube-webdesigns.de laube-webdesigns.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
lawrencebankruptcylawyer.org lawrencebankruptcylawyer.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
lbstewart.com lbstewart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
legalrank.ca legalrank.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
littlemanproject.com littlemanproject.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 3 days
geneticroulettemovie.com login.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
londonguards.co.uk londonguards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
madcity.net madcity.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jan 2017 295 days
makeitworkwebdev.com makeitworkwebdev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
mammothadams.com mammothadams.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
manageknifeattacks.com manageknifeattacks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
managingknifeattacks.com managingknifeattacks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
managingsexualassaults.com managingsexualassaults.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
mannainternational.org mannainternational.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
mariecaroletassignon.com mariecaroletassignon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Aug 2016 Oct 2017 1 year, 37 days
marketingformedical.com.au marketingformedical.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
marout-caspian.com marout-caspian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
marout-caspian.ir marout-caspian.ir
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2016 4 years, 240 days
marout-caspian.net marout-caspian.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
medaparatura.kiev.ua medaparatura.kiev.ua
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2017 Oct 2017 71 days
messiahsapien.com messiahsapien.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
middleburgmotorcycleaccidentlawyer.com middleburgmotorcycleaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
miki1.de miki1.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
missourifilm.org missourifilm.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2013 Oct 2017 4 years, 220 days
mobilemojo.us mobilemojo.us
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
monarch-care.nl monarch-care.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
move4life.nl move4life.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2017 4 years, 356 days
muckis-mega-flohmarkt.at muckis-mega-flohmarkt.at
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Oct 2017 1 year, 114 days
mydudedog.com mydudedog.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
nancystarkman.com nancystarkman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2012 Oct 2012 70 days
nationalfoliagefoundation.org nationalfoliagefoundation.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
negearth.com negearth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
newbornbabycareandparentingtips.com newbornbabycareandparentingtips.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
newcastleradiology.com newcastleradiology.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
northbaycorvettes.com northbaycorvettes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
notedco.com notedco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
nzyme.pl nzyme.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
oneluz.com oneluz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
orangeparknursinghomelawyers.com orangeparknursinghomelawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
redclovertech.com redclovertech.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
orientationcoaching.be orientationcoaching.be
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
outofthedabba.com outofthedabba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
palatkadogbitelawyer.com palatkadogbitelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
palatkasocialsecuritydisability.com palatkasocialsecuritydisability.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
palatkasocialsecuritylawyer.com palatkasocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
phase4clinicaltrial.com phase4clinicaltrial.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 49 days
philipcoleman.co.uk philipcoleman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Aug 2012 Aug 2012 One Off
photoenergetic.com photoenergetic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
photosbygeorge.co.uk photosbygeorge.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2017 3 years, 142 days
photosbypro.com photosbypro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
photosthatwork.com photosthatwork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
powercashbuilder.com powercashbuilder.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
pragna-kurnool.org pragna-kurnool.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
presetprism.com presetprism.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
profitpiston.com profitpiston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Mar 2013 One Off
qrnest.com qrnest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Dec 2016 281 days
ramanmac.com ramanmac.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
resophotography.com resophotography.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jan 2017 295 days
arabische-kalligrafie.nl arabische-kalligrafie.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
araneolandworks.com araneolandworks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
rock-ola.eu rock-ola.eu
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
bugeyefilms.com bugeyefilms.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
adolfoalba.net adolfoalba.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Oct 2017 345 days
saginawkm.com saginawkm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Oct 2013 1 year, 9 days
salientbi.com salientbi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
sanjayatour.com sanjayatour.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2013 Jan 2013 One Off
saricacamihalisi.com saricacamihalisi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
aridh.com aridh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
sassygirlcouture.ca sassygirlcouture.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
afinkao.com afinkao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
affichez.ca affichez.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2013 Oct 2013 144 days
agralcoformacion.com agralcoformacion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
ahorseandawizard.net ahorseandawizard.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2017 347 days
seo4ecommerce.co.uk seo4ecommerce.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
seocompanybrighton.co.uk seocompanybrighton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
ajijictaxman.com ajijictaxman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2016 130 days
senseofthewest.com senseofthewest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
seryakov-stroy.ru seryakov-stroy.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Aug 2012 Dec 2012 151 days
sewspecialized.com sewspecialized.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
alyns.su alyns.su
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
shakeralhobaishigroup.com shakeralhobaishigroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
shilohmccloud.com shilohmccloud.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
alexissolutions.com alexissolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
alligateinc.com alligateinc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
shorebeats.com shorebeats.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
silverwheelscycling.org silverwheelscycling.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2013 Nov 2015 2 years, 158 days
signwisesigns.com signwisesigns.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
smalltimoreproductions.com smalltimoreproductions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
smrcompany.net smrcompany.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
smrcorp.net smrcorp.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
smsbuybuy.com smsbuybuy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
snlco.com snlco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2012 Sep 2012 63 days
soapstone-associates.co.uk soapstone-associates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
soleil-prestige.nl soleil-prestige.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Dec 2016 269 days
soloyhelicopters.com soloyhelicopters.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Aug 2017 1 year, 140 days
spy-zone.co.kr spy-zone.co.kr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 4 years, 3 days
ashcanstudio.com ashcanstudio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
steadfasteng.ie steadfasteng.ie
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
stefaniaorlando.com stefaniaorlando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
stevenmelin.com stevenmelin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
stockingerlawnscape.com stockingerlawnscape.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
asianlankahotelschool.com asianlankahotelschool.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2017 Jul 2017 109 days
sugarrushny.com sugarrushny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 May 2016 2 years, 209 days
aldeguer.fr aldeguer.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
synergy-cycling.dk synergy-cycling.dk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Oct 2017 1 year, 161 days
tabalersdecastellbisbal.com tabalersdecastellbisbal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
atrivision.com atrivision.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2016 2 years, 160 days
atrivision.nl atrivision.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 46 days
technisilence.com technisilence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Oct 2017 1 year, 161 days
aucklandweddingcarhire.co.nz aucklandweddingcarhire.co.nz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2013 Oct 2017 4 years, 121 days
telemarketingforbusiness.com.au telemarketingforbusiness.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
austincanon.com austincanon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
texascruiseshiplawyer.com texascruiseshiplawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
theatrefactory.com.au theatrefactory.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
theredthreadcafe.com theredthreadcafe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
thesotisgroup.com thesotisgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Apr 2017 1 year, 18 days
banquethallsindelhi.net banquethallsindelhi.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
bardoniapt.com bardoniapt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
tischlerei-braune.de tischlerei-braune.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2016 Oct 2017 282 days
barrieoldfield.com.au barrieoldfield.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
tompapay.info tompapay.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
torontoeventphotographer.com torontoeventphotographer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Feb 2017 325 days
transitinsurance.com transitinsurance.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Mar 2017 5 years, 13 days
treestation.co.uk treestation.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Aug 2017 3 years, 300 days
tributelofts.net tributelofts.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
tulagi.info tulagi.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
txtwatcher.net txtwatcher.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
biocharge.in biocharge.in
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
uswirlnm.com uswirlnm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Aug 2013 Aug 2016 3 years, 29 days
birminghamscrapcar.co.uk birminghamscrapcar.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2017 Aug 2017 181 days
bizbuilder.com bizbuilder.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2012 Oct 2017 4 years, 284 days
venturebynature.dk venturebynature.dk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Jan 2017 258 days
vettergymnasiet.se vettergymnasiet.se
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2013 Oct 2017 4 years, 78 days
videoproductionsunlimitedllc.com videoproductionsunlimitedllc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
bluechipalliance.com bluechipalliance.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
boganentertainmentsolutions.com boganentertainmentsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
bonelite.com bonelite.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
warehouseservicesplus.com warehouseservicesplus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
weelittlepigs.com weelittlepigs.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
wendyehrlichassociates.com wendyehrlichassociates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
brunswicksocialsecuritylawyer.com brunswicksocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
winksend.com winksend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2017 347 days
winningwebprojects.com winningwebprojects.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
winseed.biz winseed.biz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
buildequinox.com buildequinox.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2012 May 2016 3 years, 130 days
buildingmeasurementone.com buildingmeasurementone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
xavier-gueit.fr xavier-gueit.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
calvaryonlineschool.com calvaryonlineschool.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2017 Oct 2017 156 days
carmodymcguanebuilders.com carmodymcguanebuilders.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
yougreen.org yougreen.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Apr 2017 165 days
youngman.kr youngman.kr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2013 Oct 2013 255 days
mimpilivelove.com mimpilivelove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2016 130 days
catherinelevison.com catherinelevison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2012 May 2013 1 year, 18 days
ccninc.com ccninc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
zahidsultan.com zahidsultan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
channeldynamix.net channeldynamix.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
openmobility.biz en.openmobility.biz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2017 Oct 2017 101 days
chris-jill.com chris-jill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2016 Oct 2017 294 days
cigarwarehouseny.com cigarwarehouseny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
cigarworldnj.com cigarworldnj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
com-verte.com com-verte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
com-verte.fr com-verte.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
construccionescayero.com construccionescayero.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
craigmcphotography.com craigmcphotography.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
cunningtonendodontics.co.uk cunningtonendodontics.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
dalhoova.fr dalhoova.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Sep 2017 1 year, 164 days
damicolawoffices.com damicolawoffices.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jun 2016 4 years, 115 days
daytonasocialsecuritylawyer.com daytonasocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
definitiefontharen-ipl.nl definitiefontharen-ipl.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2016 218 days
delamapasteleria.com delamapasteleria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
diningtour.ca diningtour.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
disneyworldinjurylawyer.com disneyworldinjurylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
dpictmedia.com dpictmedia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
dued.it dued.it
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
ecogreet.com ecogreet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
ecoquestsolutions.com.au ecoquestsolutions.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
edmontonleakybasements.com edmontonleakybasements.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
edricivan.com edricivan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2016 102 days
enetworx.ca enetworx.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jun 2017 3 years, 234 days
estheticwise.com estheticwise.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
exclusivefijiguide.com exclusivefijiguide.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fastrol.tv fastrol.tv
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fbphoto.ca fbphoto.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2013 Mar 2017 3 years, 304 days
fernandinamotorcycleaccidentlawyer.com fernandinamotorcycleaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
ferrotech.ca ferrotech.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 May 2016 2 years, 209 days
ferrum.co.in ferrum.co.in
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
festincelebraciones.es festincelebraciones.es
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2012 Oct 2017 4 years, 307 days
firesigninc2.com firesigninc2.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 248 days
fisioterapiaconde.com fisioterapiaconde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Aug 2016 2 years, 321 days
flirtuniversity.de flirtuniversity.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2012 Jan 2013 33 days
followthecrossministries.com followthecrossministries.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
frameworklifecoaching.com frameworklifecoaching.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
gainesvillemotorcycleaccidentlawyer.com gainesvillemotorcycleaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
georgestreetcafe.com georgestreetcafe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
greatbizapps.com greatbizapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
gregoirebasdevant.com gregoirebasdevant.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
hadria.hr hadria.hr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
heathersmithsmallbusiness.com heathersmithsmallbusiness.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Aug 2017 4 years, 137 days
helenejousse.fr helenejousse.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Sep 2017 Oct 2017 25 days
helmbooks.com helmbooks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2015 Apr 2015 28 days
hertscarpets.com hertscarpets.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Aug 2017 1 year, 57 days
hicc.org.uk hicc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
hiccuk.org hiccuk.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
homesteadlandupgrades.com homesteadlandupgrades.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
hopevalleycamp.com hopevalleycamp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Oct 2013 1 year, 9 days
imaginginc.com imaginginc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2016 Sep 2017 1 year, 124 days
imho-ict.com imho-ict.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
infinitemoment.ca infinitemoment.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
initiat.nl initiat.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2016 218 days
isflstudents.es isflstudents.es
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
itforlondon.net itforlondon.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvillecruiselawyers.com jacksonvillecruiselawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvillemeshlawyer.com jacksonvillemeshlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvillesocialsecuritylawyers.com jacksonvillesocialsecuritylawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvilletruckaccidentlawyers.com jacksonvilletruckaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
rdsnetwork.org rdsnetwork.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jan 2017 295 days
reconquerirsonex.eu reconquerirsonex.eu
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
region1workforcewestvirginia.org region1workforcewestvirginia.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jan 2013 346 days
rensselaer.nl rensselaer.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jun 2017 1 year, 74 days
acrystone.com acrystone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Apr 2017 1 year, 19 days
acumade.com acumade.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
rushrex.com rushrex.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2016 3 years, 13 days
aakritiinterio.com aakritiinterio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
adigitalorange.com adigitalorange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
adolfoalba.com adolfoalba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Oct 2016 One Off
advantagespecialties.ca advantagespecialties.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
aestheticwise.com aestheticwise.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
sbsgroup.ie sbsgroup.ie
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
screwstocks.com screwstocks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
agrocomltd.com agrocomltd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Dec 2016 281 days
ahluwaliaconsulting.com ahluwaliaconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2017 347 days
alondrasailing.com alondrasailing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
sgcancer.org sgcancer.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Oct 2017 1 year, 161 days
altqniah.com altqniah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Jul 2017 276 days
alpharesearch.nl alpharesearch.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
shilohsophia.com shilohsophia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
sigrid-mutscheller.de sigrid-mutscheller.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
silverwheelscycling.com silverwheelscycling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Oct 2015 3 years, 14 days
american-german-consulting.com american-german-consulting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jan 2017 3 years, 90 days
simplegate.de simplegate.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
sistamoments.com sistamoments.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
smrcomp.com smrcomp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
aniseconsulting.com.au aniseconsulting.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
spiritlife.tv spiritlife.tv
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Jun 2016 One Off
1000wordsphotographybynicolewilke.com 1000wordsphotographybynicolewilke.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2013 Oct 2013 116 days
staugustineinjurylawyers.com staugustineinjurylawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
staugustinemotorcycleaccidentlawyer.com staugustinemotorcycleaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
staugustinenursinghomelawyer.com staugustinenursinghomelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
stroy-inter.ru stroy-inter.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2017 1 year, 45 days
styletide.com styletide.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
totalpayroll.net alabama.totalpayroll.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2017 Sep 2017 155 days
geneticroulettemovie.com support.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
aldeguer.org aldeguer.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
susannesbeauty.com susannesbeauty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
tagfx.com tagfx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Oct 2017 343 days
tabortotspreschool.com tabortotspreschool.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
arabyadesign.com arabyadesign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
tamadaufa.ru tamadaufa.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 May 2016 2 years, 225 days
atalaya9izquierdo.com atalaya9izquierdo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
atoztopnbest.com atoztopnbest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Oct 2012 One Off
atrivision.be atrivision.be
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Feb 2017 325 days
atrivision.co.uk atrivision.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Feb 2017 325 days
atrivision.eu atrivision.eu
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Feb 2017 325 days
teambuildingsolutionsuk.com teambuildingsolutionsuk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
resellersecrets.net resellersecrets.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Nov 2012 Oct 2013 346 days
axatrading.com axatrading.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2017 Oct 2017 238 days
thechandeliercleaner.com thechandeliercleaner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2013 Apr 2013 35 days
thetrainingteam.com.au thetrainingteam.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
tonialewis.com tonialewis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2013 Jul 2013 1 day
fatcow.com bbharding2.fatcow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2017 Jun 2017 56 days
topagentmarketing.com topagentmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Dec 2016 281 days
toxa.od.ua toxa.od.ua
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2017 Jun 2017 One Off
totalpayroll.net totalpayroll.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2017 Oct 2017 180 days
trafficmamma.com trafficmamma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Oct 2017 1 year, 114 days
beehivebi.com beehivebi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2012 245 days
travel2eu.com travel2eu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
trendmediallc.com trendmediallc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2013 Sep 2017 4 years, 195 days
besanimation.com besanimation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
tuttlinger-triathlon.de tuttlinger-triathlon.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 65 days
urokidelai.ru urokidelai.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
valiantdesignco.com valiantdesignco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
bkts.by bkts.by
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
veritagroup.com veritagroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2016 Oct 2017 1 year, 84 days
versatilehawaii.com versatilehawaii.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
versatilemortgagellc.com versatilemortgagellc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
victoriafloraldesign.com victoriafloraldesign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
virtualvoronezh.ru virtualvoronezh.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
bloomprep.com bloomprep.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
vitaslen.nl vitaslen.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
walkerartstudio.com walkerartstudio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2017 3 years, 142 days
wassabbi.com wassabbi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Dec 2016 197 days
welcometothegoodlife.org welcometothegoodlife.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
wildsky.com.au wildsky.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2012 Oct 2016 4 years, 145 days
bstreetband.com bstreetband.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2013 Oct 2017 4 years, 151 days
wisecare.pl wisecare.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
caltex-kvzm.sk caltex-kvzm.sk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
capegolfteam.com capegolfteam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
capwta.ca capwta.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
yamilen.com yamilen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
yendva3.com yendva3.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
carydicristina.com carydicristina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
cdlgoiatuba.com.br cdlgoiatuba.com.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Mar 2017 129 days
centralwvaging.org centralwvaging.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2012 Oct 2017 4 years, 304 days
cgallant.com cgallant.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
zoebjorkman.com zoebjorkman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Aug 2016 161 days
chanchanonline.com chanchanonline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
cherishtoys.nl cherishtoys.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
christiangjerde.com christiangjerde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
cityprojectgroup.com cityprojectgroup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Feb 2017 3 years, 120 days
geneticroulettemovie.com m.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
claycountyaccidentlawyer.com claycountyaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
colorofwoman.com colorofwoman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 10 days
consultingsuccess.com.au consultingsuccess.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2012 Oct 2013 1 year, 191 days
countertopsbywillett.com countertopsbywillett.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
createtechnologies.com createtechnologies.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2017 Oct 2017 One Off
creativewebsolutions.co.uk creativewebsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
crosscheque.com.au crosscheque.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
crspiritsstudio.com crspiritsstudio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Sep 2016 2 years, 334 days
csipropertymanagement.com csipropertymanagement.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Sep 2012 Sep 2012 One Off
dalhoova.com dalhoova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Sep 2017 1 year, 164 days
dasheenjewelry.com dasheenjewelry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2013 Apr 2013 One Off
davinakotulski.com davinakotulski.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2015 Jul 2017 2 years, 153 days
decideonline.com decideonline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Mar 2017 129 days
dimodas.com.br dimodas.com.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
disneyworldaccidentlawyers.com disneyworldaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
eastgategraphics.com eastgategraphics.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
ecogreen.co.id ecogreen.co.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2014 Apr 2014 55 days
edgetech.pro edgetech.pro
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jun 2017 1 year, 74 days
edmontonwetbasement.com edmontonwetbasement.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
electronicacastillo.es electronicacastillo.es
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
elementsintime.com elementsintime.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
ethicalplanet.ca ethicalplanet.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
fernandinadogbitelawyer.com fernandinadogbitelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fernandinasocialsecuritylawyer.com fernandinasocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
filebankruptcyinworcester.com filebankruptcyinworcester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
finnbytes.com finnbytes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
firmcapitalsolutions.com firmcapitalsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Nov 2016 Sep 2017 283 days
floridacocounsels.com floridacocounsels.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Sep 2017 3 years, 333 days
floridarolloverlawyers.com floridarolloverlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
flyinguphill.com flyinguphill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2016 114 days
for-each.com for-each.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
frankensolar.co.uk frankensolar.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
ftlauderdalecruiselawyers.com ftlauderdalecruiselawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
ftlauderdalemalpracticelawyers.net ftlauderdalemalpracticelawyers.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
funerariateixeiradocoutofilho.com funerariateixeiradocoutofilho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Nov 2016 3 years, 41 days
funews.ru funews.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Oct 2016 125 days
gainesvillenursinghomelawyer.com gainesvillenursinghomelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
gator-tail.ru gator-tail.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
globads.com globads.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
globaltorchlight.com globaltorchlight.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 May 2016 4 years, 77 days
godsfamily.org godsfamily.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
golfteepictures.com golfteepictures.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
gracechurchlaurens.com gracechurchlaurens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Sep 2017 1 year, 173 days
groupe-curious.com groupe-curious.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Nov 2012 Oct 2017 4 years, 310 days
haisai-english.com haisai-english.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
harmonyenergyworks.com harmonyenergyworks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
geneticroulettemovie.com help.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
hotelazucenas.com hotelazucenas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
hrforyourbusiness.com.au hrforyourbusiness.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jan 2017 3 years, 105 days
hudaatulumam.org hudaatulumam.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
icgcltd.com icgcltd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
inbalancepilates.com.au inbalancepilates.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
indygomedia.com indygomedia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
inspiredlettings.com inspiredlettings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2013 Jan 2013 One Off
instaglobalcollect.com instaglobalcollect.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Dec 2016 281 days
integrativeinsurance.com integrativeinsurance.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
internetsadik.ru internetsadik.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2012 Dec 2012 214 days
iolinscience.com.au iolinscience.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
iotzone.co iotzone.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2016 Oct 2017 282 days
jacksonvillenursinghomelawyers.com jacksonvillenursinghomelawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvillepradaxalawyer.com jacksonvillepradaxalawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvilleveteransdisabilitylawyer.com jacksonvilleveteransdisabilitylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
janewilkensmichael.com janewilkensmichael.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2017 3 years, 142 days
jaydixit.com jaydixit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jgbcomms.co.uk jgbcomms.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2017 Oct 2017 One Off
jrmi.org jrmi.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Dec 2012 315 days
keelaphotography.com keelaphotography.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
lagranbaita.com lagranbaita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
lakecitynursinghomelawyer.com lakecitynursinghomelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
lakle.com lakle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2013 Oct 2014 1 year, 152 days
lanceburnsphotography.com lanceburnsphotography.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
laphotostudio.co laphotostudio.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 49 days
lavaconsult.be lavaconsult.be
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Oct 2012 One Off
lavaconsult.eu lavaconsult.eu
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2012 Dec 2012 One Off
lenbaget.ru lenbaget.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Nov 2012 Oct 2013 343 days
leselidze21.ru leselidze21.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2017 May 2017 One Off
localsurfer.com.au localsurfer.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
longtonladybirds.co.uk longtonladybirds.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Sep 2017 1 year, 164 days
totalpayroll.net louisiana.totalpayroll.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2017 Oct 2017 180 days
malaxiavisa.com malaxiavisa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2016 2 years, 160 days
mandingue.org mandingue.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
martinekalaw.com martinekalaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Aug 2012 Sep 2017 5 years, 37 days
maryfinsterer.com maryfinsterer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2013 Oct 2013 255 days
miamicruiselawyers.com miamicruiselawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
miamipaininstitute.com miamipaininstitute.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
micheleathenamorgen.com micheleathenamorgen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
mieldequartier.com mieldequartier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Apr 2017 5 years, 49 days
miguel-nistal.com miguel-nistal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
mindator.de mindator.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
mondhamedia.com mondhamedia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Mar 2016 One Off
myhairaintnappy.com myhairaintnappy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jan 2017 4 years, 326 days
nathanwittman.com nathanwittman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
nationalfoliagefoundation.com nationalfoliagefoundation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
poweron.fr network.poweron.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Oct 2017 4 years, 194 days
neuhd.com neuhd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
newyorkwritersintensive.com newyorkwritersintensive.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2012 Oct 2013 1 year, 225 days
nicewebsites.fr nicewebsites.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
officialdriversupdate.com officialdriversupdate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
offshoreintegratedservices.com offshoreintegratedservices.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Aug 2016 Oct 2017 1 year, 37 days
openmobility.biz openmobility.biz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2017 Oct 2017 180 days
orangeparkdogbitelawyer.com orangeparkdogbitelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangeparkmedicalmalpracticelawyer.com orangeparkmedicalmalpracticelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangeparkmotorcycleaccidentlawyers.com orangeparkmotorcycleaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangeparkveteransdisabilitylawyer.com orangeparkveteransdisabilitylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
strikingsupport.com originalstriking.strikingsupport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orlandomotorcycleaccidentlawyers.com orlandomotorcycleaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
paceyouththeatre.com paceyouththeatre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
palatkasocialsecurity.com palatkasocialsecurity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
par5fitness.com par5fitness.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2017 Oct 2017 268 days
paradoxcollegefunding.com paradoxcollegefunding.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Sep 2017 5 years, 204 days
parotomasyon.com parotomasyon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2017 Aug 2017 66 days
richardmoss.com richardmoss.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2013 Apr 2013 One Off
picsave.co.uk picsave.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2016 Jun 2017 309 days
pinpoil.es pinpoil.es
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2012 Oct 2017 5 years, 205 days
pinshot.com pinshot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
plannedforperfection.co.uk plannedforperfection.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
plataformanatural.com plataformanatural.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Oct 2017 345 days
policechiefstraining.org policechiefstraining.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Jul 2016 30 days
portcanaveralcruiselawyers.com portcanaveralcruiselawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
poweron.fr poweron.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2012 Oct 2012 182 days
practicalcombatives.com practicalcombatives.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
pscarmody.com pscarmody.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
ashcanart.com ashcanart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
remaxheritagedev.com remaxheritagedev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
reporterstrap.com reporterstrap.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
reptechcenter.com reptechcenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
resonancesocial.com resonancesocial.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2012 Jan 2013 234 days
retrotechy.net retrotechy.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
geneticroulettemovie.com reviews.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
rollovercrashlawyers.com rollovercrashlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
roofraisersinc.com roofraisersinc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
rosapinc.com rosapinc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
rosapinc.com.br rosapinc.com.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
arthurm.com arthurm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
saintadalbert.org saintadalbert.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
saintadalbertparish.org saintadalbertparish.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2013 Oct 2017 4 years, 220 days
santiagoaeropuerto.com santiagoaeropuerto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
adamsdental.com adamsdental.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2012 Sep 2012 63 days
scarboroughdj.com scarboroughdj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
scoliosis-back-brace.ca scoliosis-back-brace.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 127 days
scrapcarbuyers.co.uk scrapcarbuyers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2017 May 2017 63 days
sddh.org.br sddh.org.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
seaworldaccidentlawyers.com seaworldaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
seaworldinjurylawyer.com seaworldinjurylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
ahorseandawizard.com ahorseandawizard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
alohaseptic.com alohaseptic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
geneticroulettemovie.com shop.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
alistairhorscroft.com alistairhorscroft.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jan 2013 320 days
alliancedancecompany.org alliancedancecompany.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
shubomania.com shubomania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
simplesteps.co.nz simplesteps.co.nz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
sitesmobiles.com.br sitesmobiles.com.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
sixflagsinjurylawyer.com sixflagsinjurylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
skygrafika.ru skygrafika.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
smrcompany.com smrcompany.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
smt-france.fr smt-france.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2017 Oct 2017 238 days
annulmentlaw.info annulmentlaw.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
anprime.ru anprime.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
soumitragoswami.com soumitragoswami.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
soyaoilcoatings.com soyaoilcoatings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
geneticroulettemovie.com ssl.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
atherpath.com atherpath.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
staugustinemedicalmalpracticelawyer.com staugustinemedicalmalpracticelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
streetlife.net.au streetlife.net.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2016 2 years, 160 days
strikingmultiflex.com strikingmultiflex.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Nov 2016 Mar 2017 101 days
hanaanitrace.com suar.hanaanitrace.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Jun 2017 3 years, 234 days
atlassolutionsinc.net atlassolutionsinc.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
sunpire.com sunpire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
superiorheating.com superiorheating.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
sweatcostudios.com sweatcostudios.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Oct 2017 4 years, 344 days
aldeguer.eu aldeguer.eu
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
amokcombatives.com amokcombatives.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
applejackduo.co.uk applejackduo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
telemarketing-services.com.au telemarketing-services.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
temkinsproperties.com temkinsproperties.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Feb 2017 3 years, 120 days
tentswithcompliments.com tentswithcompliments.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
terrywherrysports.com terrywherrysports.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
geneticroulettemovie.com auth.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
teslatestandtag.com teslatestandtag.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
thegroundfloor.info thegroundfloor.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Sep 2016 4 years, 205 days
thetaylorsgrp.co.uk thetaylorsgrp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2016 102 days
baloncubaba.com baloncubaba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
timelapser.es timelapser.es
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
tompapay.com tompapay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
toyoursuccesstoday.com toyoursuccesstoday.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
resellersecrets.net training.resellersecrets.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
trollblues.com trollblues.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
truefit.in truefit.in
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
trusecurity.com.au trusecurity.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Aug 2016 142 days
tvent.nl tvent.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
txtwatcher.com txtwatcher.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
ubax.net ubax.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jun 2017 5 years, 105 days
bgrowth.cl bgrowth.cl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2016 196 days
unikaconsultingllc.com unikaconsultingllc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
uniteustransport.com uniteustransport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2016 Oct 2017 282 days
updesign.fr updesign.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
vedvidnyan.com vedvidnyan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
vegetaledesign.com vegetaledesign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
verita-group.com verita-group.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
vgscanning.com vgscanning.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
vietgiaphatcompany.com vietgiaphatcompany.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
vitalitydentalarts.com vitalitydentalarts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 May 2012 99 days
bloomfloraldesign.com.au bloomfloraldesign.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
blumenhaus-loos.de blumenhaus-loos.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
blumenloos.de blumenloos.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
bogdanow.eu bogdanow.eu
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
walnutcreekcrossfit.com walnutcreekcrossfit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
wearevarsity.info wearevarsity.info
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
websitebazaar.com websitebazaar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Mar 2013 One Off
bravenewgirls.com bravenewgirls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Mar 2017 143 days
breathoflifecenter.com breathoflifecenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
weymouthboatcharters.co.uk weymouthboatcharters.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jan 2017 295 days
whitelightandwishes.com whitelightandwishes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
winone.com winone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
brunswicknursinghomelawyer.com brunswicknursinghomelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
womenofwholeness.org womenofwholeness.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
wongpriscilla.com wongpriscilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
workpermitservices.co.uk workpermitservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
bushgardensinjurylawyer.com bushgardensinjurylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
buymcgen.com buymcgen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2015 Apr 2015 One Off
xlc.com.my xlc.com.my
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
capetownrestaurantguide.co.za capetownrestaurantguide.co.za
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
carnivalcruiseshiplawyer.com carnivalcruiseshiplawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
yofi.de yofi.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
youproducevideo.com youproducevideo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 65 days
yourcmsexperts.com yourcmsexperts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
openmobility.biz ca.openmobility.biz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2017 Oct 2017 101 days
charmanfinancialmanagement.co.uk charmanfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jun 2016 4 years, 115 days
chinagysourcing.com chinagysourcing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
cmogul.com cmogul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
cnpmedical.com cnpmedical.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2017 3 years, 142 days
coorparoo.org.au coorparoo.org.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
creativepeg.com creativepeg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
daytonanursinghomelawyer.com daytonanursinghomelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
defensetechnologycorporation.com defensetechnologycorporation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
delseyfinancial.com delseyfinancial.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 46 days
detailclimaticsystems.com detailclimaticsystems.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2017 Sep 2017 99 days
gracechurchlaurens.org dev.gracechurchlaurens.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2016 Sep 2017 1 year, 50 days
digic.it digic.it
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
doecdoe.com doecdoe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
drsea.org drsea.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jan 2013 Oct 2017 4 years, 260 days
duerr-metalltechnik.de duerr-metalltechnik.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
dumitrualex.ro dumitrualex.ro
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Sep 2017 Oct 2017 25 days
edgetechnical.pro edgetechnical.pro
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
edgetechnical.us edgetechnical.us
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Sep 2016 Oct 2017 1 year, 24 days
ekotechs.com ekotechs.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Aug 2013 Jan 2014 150 days
emedecoration.com emedecoration.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2016 Oct 2017 1 year, 96 days
emigratemalaysia.com emigratemalaysia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
entspannung-trainieren.de entspannung-trainieren.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
erikandsadie.com erikandsadie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
euroasiagroup.co euroasiagroup.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
exp-network.com exp-network.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2012 May 2012 One Off
farbenbau.at farbenbau.at
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fernandinainjurylawyer.com fernandinainjurylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fernandinamalpracticelawyers.com fernandinamalpracticelawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fiberfighters.com fiberfighters.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Dec 2016 3 years, 64 days
fincalanouer.com fincalanouer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
fix-mypc.com fix-mypc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
flaka.nl flaka.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Dec 2013 Mar 2015 1 year, 102 days
fnm.pl fnm.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Oct 2017 1 year, 2 days
fnur.it fnur.it
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
fontmap.co.uk fontmap.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
fontsandflourish.com fontsandflourish.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fotografobari.com fotografobari.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
fredrlp.com fredrlp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
fscaccounting.com fscaccounting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
gainesvillemalpracticelawyers.com gainesvillemalpracticelawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
gainesvillesocialsecuritylawyer.com gainesvillesocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
geeq.at geeq.at
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
geneticroulettemovie.com geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Sep 2012 Jan 2013 147 days
gensip.com gensip.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2017 Oct 2017 151 days
gilberteiche.com gilberteiche.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
globaltorchlight.co.uk globaltorchlight.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
gonzaleztreeservice.com gonzaleztreeservice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
gracechurchlaurens.org gracechurchlaurens.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Sep 2017 1 year, 173 days
gweb-design.com gweb-design.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
gwprovide.org gwprovide.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Oct 2016 One Off
gytality.com gytality.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
healingcrystalwisdom.com healingcrystalwisdom.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
heather-smith.com.au heather-smith.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
helenroditis.com helenroditis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
hitechcontrolsystems.in hitechcontrolsystems.in
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Jan 2017 258 days
home-office-solutions.com home-office-solutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Aug 2016 161 days
honestsportsbookreview.com honestsportsbookreview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Sep 2017 5 years, 204 days
ice-stqb.org ice-stqb.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2016 Oct 2017 1 year, 114 days
icreatestories.com icreatestories.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2013 May 2014 341 days
ikarart.pl ikarart.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
ingienous.com ingienous.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jun 2013 Oct 2017 4 years, 109 days
isflstudents.com isflstudents.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
iso-roco.com iso-roco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
istocklandscape.com istocklandscape.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
itbikes.com itbikes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2012 May 2013 1 year, 33 days
jacksonvillekneeimplantlawyer.com jacksonvillekneeimplantlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvilleinjurylawyers.net jacksonvilleinjurylawyers.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jacksonvillemotorcycleaccidentlawyers.com jacksonvillemotorcycleaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
janicescherer.com janicescherer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
jmoorecustomhomes.com jmoorecustomhomes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
kamenconsultant.com kamenconsultant.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 May 2016 Oct 2017 1 year, 149 days
karri.no karri.no
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
kerstinkrick.com kerstinkrick.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
kiltedfrogtestsite.com kiltedfrogtestsite.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
konyanetsisbayi.com konyanetsisbayi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
lacarbuyingservice.com lacarbuyingservice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
lakecitysocialsecuritylawyer.com lakecitysocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
lakewood-condos.com lakewood-condos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
laurawennstrom.com laurawennstrom.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 241 days
leadermed.ru leadermed.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
leddenperry.com leddenperry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
leefishermusic.com leefishermusic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
lemuria-rlt.com lemuria-rlt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
linkvisum.com linkvisum.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
luders.us luders.us
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Sep 2016 Oct 2017 1 year, 24 days
magnoliascience.org magnoliascience.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2015 Mar 2015 One Off
makeitwork.com makeitwork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Jul 2012 136 days
manzoinsurance.com manzoinsurance.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Apr 2016 Oct 2017 1 year, 161 days
marble-polishing-sa.com marble-polishing-sa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Nov 2016 246 days
markcolliton.com markcolliton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 236 days
marketingfordentists.com.au marketingfordentists.com.au
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
marketingwrangler.com marketingwrangler.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Aug 2016 142 days
marython.com marython.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
maxeffron.com maxeffron.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 May 2017 3 years, 207 days
mega-fly.ru mega-fly.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Nov 2016 50 days
mexicobaila.com mexicobaila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2017 5 years, 229 days
mijnautoistekoop.nl mijnautoistekoop.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
mikilazar.de mikilazar.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
mildredconsulting.com mildredconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
missionbenefits.com missionbenefits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2012 Oct 2012 One Off
motorcycleaccidentanswers.com motorcycleaccidentanswers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
mybbaseball.com mybbaseball.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
nationalfoliagefoundation.net nationalfoliagefoundation.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
naztek.com naztek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
nbcadocs.com nbcadocs.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
newearthgreendepot.com newearthgreendepot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Mar 2016 2 years, 160 days
geneticroulettemovie.com news.geneticroulettemovie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jul 2017 1 year, 107 days
niagaraonthelakemagazine.com niagaraonthelakemagazine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
niagarasigns.com niagarasigns.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Sep 2017 1 year, 173 days
nonameconcepts.com nonameconcepts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
nonstopphoto.pl nonstopphoto.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
nrtgraphics.com nrtgraphics.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
nzbc.org.nz nzbc.org.nz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Mar 2013 1 year, 35 days
ocalaaccidentlawyers.com ocalaaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
ofc-us.com ofc-us.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
sus.org.rs sus.org.rs
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
omyoga.ma omyoga.ma
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orangeparksocialsecuritydisabilitylawyer.com orangeparksocialsecuritydisabilitylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orbjava.com orbjava.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orlandoautomobileaccidentlawyers.com orlandoautomobileaccidentlawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orlandonursinghomelawyers.com orlandonursinghomelawyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
orlandopetconnections.com orlandopetconnections.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
outsidethezoneadventures.com outsidethezoneadventures.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2013 Oct 2013 201 days
paddleguy.com paddleguy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
palatkanursinghomelawyer.com palatkanursinghomelawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
palmcoastsocialsecuritylawyer.com palmcoastsocialsecuritylawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
peacesoffashion.com peacesoffashion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Jul 2014 Jul 2014 One Off
pemeticpresents.com pemeticpresents.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Oct 2017 1 year, 198 days
pixelcloud-games.com pixelcloud-games.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
plonsky.com plonsky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
pmg-consult.com pmg-consult.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 May 2016 49 days
pmpmanage.com pmpmanage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2016 Feb 2017 106 days
perdisolutions.com perdisolutions.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Feb 2012 One Off
prphq.com prphq.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Mar 2016 Jan 2017 295 days
putnamcountyaccidentlawyer.com putnamcountyaccidentlawyer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
quantumpictures.co.uk quantumpictures.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2017 3 years, 358 days
rachelczar.com rachelczar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Feb 2012 Oct 2013 1 year, 240 days
redmadonnaradio.com redmadonnaradio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
reiaonline.org reiaonline.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-18880824 Oct 2013 Oct 2013 One Off
VCC.NET
Non IP Attributes
Attribute First Last
UA UA-18880824 Feb 2012 Oct 2017
VCC.NET
Overlap Attribute Domains
kristyandlindani.com kristyandlindani.com
kts-verpackungen.de kts-verpackungen.de
laurenlentini.com laurenlentini.com
littleashcanart.com littleashcanart.com
llcstudios.com llcstudios.com
loneoaktrucking.com loneoaktrucking.com
longhaulproductions.net longhaulproductions.net
luderstech.com luderstech.com
maacaccess.com maacaccess.com
madebycocoa.com madebycocoa.com
magnoliapublicschools.org magnoliapublicschools.org
managingassaults.com managingassaults.com
marinasalvador.com marinasalvador.com
marketingdereseausolution.com marketingdereseausolution.com
marout-caspian.org marout-caspian.org
massbankruptcylawyer7.com massbankruptcylawyer7.com
mauiclothing.com mauiclothing.com
mcla-inc.com mcla-inc.com
medflex.com.br medflex.com.br
meii.de meii.de
microdivision.co.za microdivision.co.za
middleburgsocialsecuritylawyer.com middleburgsocialsecuritylawyer.com
midwaybeach.org midwaybeach.org
mieldequartier.org mieldequartier.org
mijn-blokje.nl mijn-blokje.nl
missourifilm.com missourifilm.com
moehlmillwork.com moehlmillwork.com
morriswebsitedesign.com morriswebsitedesign.com
ncgolfcommunity-championhills.com ncgolfcommunity-championhills.com
nctrianglebirthnetwork.org nctrianglebirthnetwork.org
pixelcloudgames.com pixelcloudgames.com
northbaycorvette.com northbaycorvette.com
obs-pernik.bg obs-pernik.bg
rapidplans.com.au rapidplans.com.au
onlineview.dk onlineview.dk
orangeparkbraininjurylawyer.com orangeparkbraininjurylawyer.com
orangeparkmotorcycleaccidentlawyer.com orangeparkmotorcycleaccidentlawyer.com
orangeparksocialsecuritylawyer.com orangeparksocialsecuritylawyer.com
orangeparktruckaccidentlawyers.com orangeparktruckaccidentlawyers.com
orangetiemedia.com orangetiemedia.com
orientationcoaching.com orientationcoaching.com
osmaniandco.com osmaniandco.com
palatkamedicalmalpracticelawyer.com palatkamedicalmalpracticelawyer.com
palatkamotorcycleaccidentlawyers.com palatkamotorcycleaccidentlawyers.com
pathwaysdropin.org pathwaysdropin.org
paulalexanderphotography.com paulalexanderphotography.com
peces-disco.com peces-disco.com
perfectevn.com perfectevn.com
photographytouch.com photographytouch.com
pixelcloud-games.at pixelcloud-games.at
pixelcloudgames.at pixelcloudgames.at
pixelko.ca pixelko.ca
plumbercarlsbad.net plumbercarlsbad.net
pmprollc.com pmprollc.com
power2persuade.com power2persuade.com
progressus-alliance.ru progressus-alliance.ru
prouspex.com prouspex.com
prphair.com prphair.com
pulomascenterpark.com pulomascenterpark.com
questra.nl questra.nl
quincybankruptcylawyer.com quincybankruptcylawyer.com
referralfeenetwork.com referralfeenetwork.com
reporterstrap.pl reporterstrap.pl
reuvenschool.edu.co reuvenschool.edu.co
rhosecosmetics.com rhosecosmetics.com
robertrommel.com robertrommel.com
adremcorp.com adremcorp.com
samplelogic.com samplelogic.com
sarapendlebury.com sarapendlebury.com
ahorseandawizard.biz ahorseandawizard.biz
seniorsgiving.com seniorsgiving.com
setdata.es setdata.es
altqniah.sa altqniah.sa
alturnativesource.com alturnativesource.com
shilohsophiastudios.com shilohsophiastudios.com
almasibley.com almasibley.com
aml.com.ve aml.com.ve
silverwheelscycling.net silverwheelscycling.net
silzar.com silzar.com
site-norte.pt site-norte.pt
americasfinestfitness.com americasfinestfitness.com
ameublement-cuisines.com ameublement-cuisines.com
ane-cob.com ane-cob.com
sknrz.net sknrz.net
sleepbreeze.com sleepbreeze.com
annegret-hartmann.de annegret-hartmann.de
smilesremembered.com smilesremembered.com
spoonedfork.com spoonedfork.com
sriviere.com sriviere.com
artconsultingvancouver.com artconsultingvancouver.com
artisanimation.com artisanimation.com
standrewsdebates.org standrewsdebates.org
staugustinesocialsecuritylawyer.com staugustinesocialsecuritylawyer.com
steadfasteng.com steadfasteng.com
steeringwheelsponge.co.uk steeringwheelsponge.co.uk
abdulwahidjc.com abdulwahidjc.com
studiolegalelavoro.com studiolegalelavoro.com
successcopilot.com successcopilot.com
successcopilotsupport.com successcopilotsupport.com
anchorpointministry.org anchorpointministry.org
annette.co.il annette.co.il
sylviabridal.com sylviabridal.com
athenamorgen.com athenamorgen.com
tcheruenterprises.com tcheruenterprises.com
taxreturn247.com.au taxreturn247.com.au
teams.org.in teams.org.in
team-academy.nl team-academy.nl
avongro.com.au avongro.com.au
theresourcepeople.com theresourcepeople.com
therunninglab.co.uk therunninglab.co.uk
tiggspondretreatcenter.com tiggspondretreatcenter.com
bashkigeneration.com bashkigeneration.com
beatdan.com beatdan.com
trainsmarter.de trainsmarter.de
tvrcarclub.be tvrcarclub.be
bigfactory.net bigfactory.net
universalaccidentlawyers.com universalaccidentlawyers.com
vabeachlandscaping.com vabeachlandscaping.com
blazingtrailscenter.com blazingtrailscenter.com
video-marketing-club.com video-marketing-club.com
voiceovercity.com voiceovercity.com
bogan-es.com bogan-es.com
web-for-people.ru web-for-people.ru
boxer-xena.nl boxer-xena.nl
bravodevelopments.com bravodevelopments.com
windhamarts.org windhamarts.org
bushgardensaccidentlawyer.com bushgardensaccidentlawyer.com
business2websolutions.com business2websolutions.com
calgaryweddingvideos.com calgaryweddingvideos.com
cantbuystyle.com cantbuystyle.com
carolinahealthcaresolutions.com carolinahealthcaresolutions.com
carotel.com.au carotel.com.au
ymonetize.com ymonetize.com
cateringbybrenda.com cateringbybrenda.com
zavod-emma.si zavod-emma.si
zonenlicht.com zonenlicht.com
change-now.co.uk change-now.co.uk
chargerboxes.com chargerboxes.com
cigarkingny.com cigarkingny.com
cityexpert.pro cityexpert.pro
cityislandpta.com cityislandpta.com
claremorechristian.com claremorechristian.com
claritymedia.net claritymedia.net
claycountyinjurylawyer.com claycountyinjurylawyer.com
cleaningmaster.in cleaningmaster.in
cocounsels.com cocounsels.com
commandercsi.com commandercsi.com
connectemerson.com connectemerson.com
corvermarinesafety.com corvermarinesafety.com
creativehomesolutions.com creativehomesolutions.com
creativemotion.com.au creativemotion.com.au
creativepegwork.com creativepegwork.com
creloaded.com.au creloaded.com.au
cremoplast-tech.com cremoplast-tech.com
cuisines-bollery.com cuisines-bollery.com
daytonabeachmotorcycleaccidentlawyers.com daytonabeachmotorcycleaccidentlawyers.com
daytonamedicalmalpracticelawyer.com daytonamedicalmalpracticelawyer.com
dbnplanning.com dbnplanning.com
decodreams.com.my decodreams.com.my
deductionandanalysis.com deductionandanalysis.com
delama.com.ar delama.com.ar
delandnursinghomelawyer.com delandnursinghomelawyer.com
digitalstoryteller.net digitalstoryteller.net
disualstudio.com disualstudio.com
djsimcha.com djsimcha.com
dmsa.kz dmsa.kz
dorndempsey.com dorndempsey.com
downtowndining.ca downtowndining.ca
ducphan.de ducphan.de
dutchdimensions.com dutchdimensions.com
easygolfadvice.com easygolfadvice.com
edgedweaponsolutions.com edgedweaponsolutions.com
eigstudies.com eigstudies.com
eigstudies.net eigstudies.net
envisionz.com envisionz.com
fairytaleproductions.net fairytaleproductions.net
fbgatecash.com fbgatecash.com
feel-good-verlag.de feel-good-verlag.de
feelgood-verlag.de feelgood-verlag.de
filtertexas.com filtertexas.com
findmysouvenir.com findmysouvenir.com
firstparishbrewster.org firstparishbrewster.org
floridacruiselawyers.net floridacruiselawyers.net
fortlauderdalecruiselawyers.com fortlauderdalecruiselawyers.com
girtzindustries.com girtzindustries.com
goodmonsters.com.au goodmonsters.com.au
hamishniven.co.za hamishniven.co.za
happyhikershappycampers.com happyhikershappycampers.com
horseandbamboo.org horseandbamboo.org
hospitality-films.com hospitality-films.com
hrd.biz hrd.biz
ideastampa.it ideastampa.it
imagehoorn.nl imagehoorn.nl
imperialaquatics.com imperialaquatics.com
imprintintertwine.com imprintintertwine.com
intermedium.fr intermedium.fr
islippedandfell.net islippedandfell.net
jacksonvilleworkerscompensationaccidentlawyers.com jacksonvilleworkerscompensationaccidentlawyers.com
jamesnet.net jamesnet.net
kapsalon-prestige.nl kapsalon-prestige.nl
koaloha.com koaloha.com
konacoffeesd.com konacoffeesd.com
julienaldeguer.com julienaldeguer.com
kaloca.com kaloca.com
kapcityconstruction.com kapcityconstruction.com
karlolack.de karlolack.de
karteksogutma.com.tr karteksogutma.com.tr
kesifarge.com kesifarge.com
kidsfc.com.au kidsfc.com.au
kmti.org kmti.org
knifefighting.com knifefighting.com
koerperstyling.info koerperstyling.info
kristinalexandratidwell.com kristinalexandratidwell.com
lakecityaccidentlawyer.com lakecityaccidentlawyer.com
latapatia-fm.com latapatia-fm.com
laube-web.com laube-web.com
laube-webdesigns.de laube-webdesigns.de
lawrencebankruptcylawyer.org lawrencebankruptcylawyer.org
lbstewart.com lbstewart.com
legalrank.ca legalrank.ca
littlemanproject.com littlemanproject.com
login.geneticroulettemovie.com login.geneticroulettemovie.com
londonguards.co.uk londonguards.co.uk
madcity.net madcity.net
makeitworkwebdev.com makeitworkwebdev.com
mammothadams.com mammothadams.com
manageknifeattacks.com manageknifeattacks.com
managingknifeattacks.com managingknifeattacks.com
managingsexualassaults.com managingsexualassaults.com
mannainternational.org mannainternational.org
mariecaroletassignon.com mariecaroletassignon.com
marketingformedical.com.au marketingformedical.com.au
marout-caspian.com marout-caspian.com
marout-caspian.ir marout-caspian.ir
marout-caspian.net marout-caspian.net
medaparatura.kiev.ua medaparatura.kiev.ua
messiahsapien.com messiahsapien.com
middleburgmotorcycleaccidentlawyer.com middleburgmotorcycleaccidentlawyer.com
miki1.de miki1.de
missourifilm.org missourifilm.org
mobilemojo.us mobilemojo.us
monarch-care.nl monarch-care.nl
move4life.nl move4life.nl
muckis-mega-flohmarkt.at muckis-mega-flohmarkt.at
mydudedog.com mydudedog.com
nancystarkman.com nancystarkman.com
nationalfoliagefoundation.org nationalfoliagefoundation.org
negearth.com negearth.com
newbornbabycareandparentingtips.com newbornbabycareandparentingtips.com
newcastleradiology.com newcastleradiology.com
northbaycorvettes.com northbaycorvettes.com
notedco.com notedco.com
nzyme.pl nzyme.pl
oneluz.com oneluz.com
orangeparknursinghomelawyers.com orangeparknursinghomelawyers.com
redclovertech.com redclovertech.com
orientationcoaching.be orientationcoaching.be
outofthedabba.com outofthedabba.com
palatkadogbitelawyer.com palatkadogbitelawyer.com
palatkasocialsecuritydisability.com palatkasocialsecuritydisability.com
palatkasocialsecuritylawyer.com palatkasocialsecuritylawyer.com
phase4clinicaltrial.com phase4clinicaltrial.com
philipcoleman.co.uk philipcoleman.co.uk
photoenergetic.com photoenergetic.com
photosbygeorge.co.uk photosbygeorge.co.uk
photosbypro.com photosbypro.com
photosthatwork.com photosthatwork.com
powercashbuilder.com powercashbuilder.com
pragna-kurnool.org pragna-kurnool.org
presetprism.com presetprism.com
profitpiston.com profitpiston.com
qrnest.com qrnest.com
ramanmac.com ramanmac.com
resophotography.com resophotography.com
arabische-kalligrafie.nl arabische-kalligrafie.nl
araneolandworks.com araneolandworks.com
rock-ola.eu rock-ola.eu
bugeyefilms.com bugeyefilms.com
adolfoalba.net adolfoalba.net
saginawkm.com saginawkm.com
salientbi.com salientbi.com
sanjayatour.com sanjayatour.com
saricacamihalisi.com saricacamihalisi.com
aridh.com aridh.com
sassygirlcouture.ca sassygirlcouture.ca
afinkao.com afinkao.com
affichez.ca affichez.ca
agralcoformacion.com agralcoformacion.com
ahorseandawizard.net ahorseandawizard.net
seo4ecommerce.co.uk seo4ecommerce.co.uk
seocompanybrighton.co.uk seocompanybrighton.co.uk
ajijictaxman.com ajijictaxman.com
senseofthewest.com senseofthewest.com
seryakov-stroy.ru seryakov-stroy.ru
sewspecialized.com sewspecialized.com
alyns.su alyns.su
shakeralhobaishigroup.com shakeralhobaishigroup.com
shilohmccloud.com shilohmccloud.com
alexissolutions.com alexissolutions.com
alligateinc.com alligateinc.com
shorebeats.com shorebeats.com
silverwheelscycling.org silverwheelscycling.org
signwisesigns.com signwisesigns.com
smalltimoreproductions.com smalltimoreproductions.com
smrcompany.net smrcompany.net
smrcorp.net smrcorp.net
smsbuybuy.com smsbuybuy.com
snlco.com snlco.com
soapstone-associates.co.uk soapstone-associates.co.uk
soleil-prestige.nl soleil-prestige.nl
soloyhelicopters.com soloyhelicopters.com
spy-zone.co.kr spy-zone.co.kr
ashcanstudio.com ashcanstudio.com
steadfasteng.ie steadfasteng.ie
stefaniaorlando.com stefaniaorlando.com
stevenmelin.com stevenmelin.com
stockingerlawnscape.com stockingerlawnscape.com
asianlankahotelschool.com asianlankahotelschool.com
sugarrushny.com sugarrushny.com
aldeguer.fr aldeguer.fr
synergy-cycling.dk synergy-cycling.dk
tabalersdecastellbisbal.com tabalersdecastellbisbal.com
atrivision.com atrivision.com
atrivision.nl atrivision.nl
technisilence.com technisilence.com
aucklandweddingcarhire.co.nz aucklandweddingcarhire.co.nz
telemarketingforbusiness.com.au telemarketingforbusiness.com.au
austincanon.com austincanon.com
texascruiseshiplawyer.com texascruiseshiplawyer.com
theatrefactory.com.au theatrefactory.com.au
theredthreadcafe.com theredthreadcafe.com
thesotisgroup.com thesotisgroup.com
banquethallsindelhi.net banquethallsindelhi.net
bardoniapt.com bardoniapt.com
tischlerei-braune.de tischlerei-braune.de
barrieoldfield.com.au barrieoldfield.com.au
tompapay.info tompapay.info
torontoeventphotographer.com torontoeventphotographer.com
transitinsurance.com transitinsurance.com
treestation.co.uk treestation.co.uk
tributelofts.net tributelofts.net
tulagi.info tulagi.info
txtwatcher.net txtwatcher.net
biocharge.in biocharge.in
uswirlnm.com uswirlnm.com
birminghamscrapcar.co.uk birminghamscrapcar.co.uk
bizbuilder.com bizbuilder.com
vcc.net vcc.net
venturebynature.dk venturebynature.dk
vettergymnasiet.se vettergymnasiet.se
videoproductionsunlimitedllc.com videoproductionsunlimitedllc.com
bluechipalliance.com bluechipalliance.com
boganentertainmentsolutions.com boganentertainmentsolutions.com
bonelite.com bonelite.com
warehouseservicesplus.com warehouseservicesplus.com
weelittlepigs.com weelittlepigs.com
wendyehrlichassociates.com wendyehrlichassociates.com
brunswicksocialsecuritylawyer.com brunswicksocialsecuritylawyer.com
winksend.com winksend.com
winningwebprojects.com winningwebprojects.com
winseed.biz winseed.biz
buildequinox.com buildequinox.com
buildingmeasurementone.com buildingmeasurementone.com
xavier-gueit.fr xavier-gueit.fr
calvaryonlineschool.com calvaryonlineschool.com
carmodymcguanebuilders.com carmodymcguanebuilders.com
yougreen.org yougreen.org
youngman.kr youngman.kr
mimpilivelove.com mimpilivelove.com
catherinelevison.com catherinelevison.com
ccninc.com ccninc.com
zahidsultan.com zahidsultan.com
channeldynamix.net channeldynamix.net
en.openmobility.biz en.openmobility.biz
chris-jill.com chris-jill.com
cigarwarehouseny.com cigarwarehouseny.com
cigarworldnj.com cigarworldnj.com
com-verte.com com-verte.com
com-verte.fr com-verte.fr
construccionescayero.com construccionescayero.com
craigmcphotography.com craigmcphotography.com
cunningtonendodontics.co.uk cunningtonendodontics.co.uk
dalhoova.fr dalhoova.fr
damicolawoffices.com damicolawoffices.com
daytonasocialsecuritylawyer.com daytonasocialsecuritylawyer.com
definitiefontharen-ipl.nl definitiefontharen-ipl.nl
delamapasteleria.com delamapasteleria.com
diningtour.ca diningtour.ca
disneyworldinjurylawyer.com disneyworldinjurylawyer.com
dpictmedia.com dpictmedia.com
dued.it dued.it
ecogreet.com ecogreet.com
ecoquestsolutions.com.au ecoquestsolutions.com.au
edmontonleakybasements.com edmontonleakybasements.com
edricivan.com edricivan.com
enetworx.ca enetworx.ca
estheticwise.com estheticwise.com
exclusivefijiguide.com exclusivefijiguide.com
fastrol.tv fastrol.tv
fbphoto.ca fbphoto.ca
fernandinamotorcycleaccidentlawyer.com fernandinamotorcycleaccidentlawyer.com
ferrotech.ca ferrotech.ca
ferrum.co.in ferrum.co.in
festincelebraciones.es festincelebraciones.es
firesigninc2.com firesigninc2.com
fisioterapiaconde.com fisioterapiaconde.com
flirtuniversity.de flirtuniversity.de
followthecrossministries.com followthecrossministries.com
frameworklifecoaching.com frameworklifecoaching.com
gainesvillemotorcycleaccidentlawyer.com gainesvillemotorcycleaccidentlawyer.com
georgestreetcafe.com georgestreetcafe.com
greatbizapps.com greatbizapps.com
gregoirebasdevant.com gregoirebasdevant.com
hadria.hr hadria.hr
heathersmithsmallbusiness.com heathersmithsmallbusiness.com
helenejousse.fr helenejousse.fr
helmbooks.com helmbooks.com
hertscarpets.com hertscarpets.com
hicc.org.uk hicc.org.uk
hiccuk.org hiccuk.org
homesteadlandupgrades.com homesteadlandupgrades.com
hopevalleycamp.com hopevalleycamp.com
imaginginc.com imaginginc.com
imho-ict.com imho-ict.com
infinitemoment.ca infinitemoment.ca
initiat.nl initiat.nl
isflstudents.es isflstudents.es
itforlondon.net itforlondon.net
jacksonvillecruiselawyers.com jacksonvillecruiselawyers.com
jacksonvillemeshlawyer.com jacksonvillemeshlawyer.com
jacksonvillesocialsecuritylawyers.com jacksonvillesocialsecuritylawyers.com
jacksonvilletruckaccidentlawyers.com jacksonvilletruckaccidentlawyers.com
rdsnetwork.org rdsnetwork.org
reconquerirsonex.eu reconquerirsonex.eu
region1workforcewestvirginia.org region1workforcewestvirginia.org
rensselaer.nl rensselaer.nl
acrystone.com acrystone.com
acumade.com acumade.com
rushrex.com rushrex.com
aakritiinterio.com aakritiinterio.com
adigitalorange.com adigitalorange.com
adolfoalba.com adolfoalba.com
advantagespecialties.ca advantagespecialties.ca
aestheticwise.com aestheticwise.com
sbsgroup.ie sbsgroup.ie
screwstocks.com screwstocks.com
agrocomltd.com agrocomltd.com
ahluwaliaconsulting.com ahluwaliaconsulting.com
alondrasailing.com alondrasailing.com
sgcancer.org sgcancer.org
altqniah.com altqniah.com
alpharesearch.nl alpharesearch.nl
shilohsophia.com shilohsophia.com
sigrid-mutscheller.de sigrid-mutscheller.de
silverwheelscycling.com silverwheelscycling.com
american-german-consulting.com american-german-consulting.com
simplegate.de simplegate.de
sistamoments.com sistamoments.com
smrcomp.com smrcomp.com
aniseconsulting.com.au aniseconsulting.com.au
spiritlife.tv spiritlife.tv
1000wordsphotographybynicolewilke.com 1000wordsphotographybynicolewilke.com
staugustineinjurylawyers.com staugustineinjurylawyers.com
staugustinemotorcycleaccidentlawyer.com staugustinemotorcycleaccidentlawyer.com
staugustinenursinghomelawyer.com staugustinenursinghomelawyer.com
stroy-inter.ru stroy-inter.ru
styletide.com styletide.com
alabama.totalpayroll.net alabama.totalpayroll.net
support.geneticroulettemovie.com support.geneticroulettemovie.com
aldeguer.org aldeguer.org
susannesbeauty.com susannesbeauty.com
tagfx.com tagfx.com
tabortotspreschool.com tabortotspreschool.com
arabyadesign.com arabyadesign.com
tamadaufa.ru tamadaufa.ru
atalaya9izquierdo.com atalaya9izquierdo.com
atoztopnbest.com atoztopnbest.com
atrivision.be atrivision.be
atrivision.co.uk atrivision.co.uk
atrivision.eu atrivision.eu
teambuildingsolutionsuk.com teambuildingsolutionsuk.com
resellersecrets.net resellersecrets.net
axatrading.com axatrading.com
thechandeliercleaner.com thechandeliercleaner.com
thetrainingteam.com.au thetrainingteam.com.au
tonialewis.com tonialewis.com
bbharding2.fatcow.com bbharding2.fatcow.com
topagentmarketing.com topagentmarketing.com
toxa.od.ua toxa.od.ua
totalpayroll.net totalpayroll.net
trafficmamma.com trafficmamma.com
beehivebi.com beehivebi.com
travel2eu.com travel2eu.com
trendmediallc.com trendmediallc.com
besanimation.com besanimation.com
tuttlinger-triathlon.de tuttlinger-triathlon.de
urokidelai.ru urokidelai.ru
valiantdesignco.com valiantdesignco.com
bkts.by bkts.by
veritagroup.com veritagroup.com
versatilehawaii.com versatilehawaii.com
versatilemortgagellc.com versatilemortgagellc.com
victoriafloraldesign.com victoriafloraldesign.com
virtualvoronezh.ru virtualvoronezh.ru
bloomprep.com bloomprep.com
vitaslen.nl vitaslen.nl
walkerartstudio.com walkerartstudio.com
wassabbi.com wassabbi.com
welcometothegoodlife.org welcometothegoodlife.org
wildsky.com.au wildsky.com.au
bstreetband.com bstreetband.com
wisecare.pl wisecare.pl
caltex-kvzm.sk caltex-kvzm.sk
capegolfteam.com capegolfteam.com
capwta.ca capwta.ca
yamilen.com yamilen.com
yendva3.com yendva3.com
carydicristina.com carydicristina.com
cdlgoiatuba.com.br cdlgoiatuba.com.br
centralwvaging.org centralwvaging.org
cgallant.com cgallant.com
zoebjorkman.com zoebjorkman.com
chanchanonline.com chanchanonline.com
cherishtoys.nl cherishtoys.nl
christiangjerde.com christiangjerde.com
cityprojectgroup.com cityprojectgroup.com
m.geneticroulettemovie.com m.geneticroulettemovie.com
claycountyaccidentlawyer.com claycountyaccidentlawyer.com
colorofwoman.com colorofwoman.com
consultingsuccess.com.au consultingsuccess.com.au
countertopsbywillett.com countertopsbywillett.com
createtechnologies.com createtechnologies.com
creativewebsolutions.co.uk creativewebsolutions.co.uk
crosscheque.com.au crosscheque.com.au
crspiritsstudio.com crspiritsstudio.com
csipropertymanagement.com csipropertymanagement.com
dalhoova.com dalhoova.com
dasheenjewelry.com dasheenjewelry.com
davinakotulski.com davinakotulski.com
decideonline.com decideonline.com
dimodas.com.br dimodas.com.br
disneyworldaccidentlawyers.com disneyworldaccidentlawyers.com
eastgategraphics.com eastgategraphics.com
ecogreen.co.id ecogreen.co.id
edgetech.pro edgetech.pro
edmontonwetbasement.com edmontonwetbasement.com
electronicacastillo.es electronicacastillo.es
elementsintime.com elementsintime.com
ethicalplanet.ca ethicalplanet.ca
fernandinadogbitelawyer.com fernandinadogbitelawyer.com
fernandinasocialsecuritylawyer.com fernandinasocialsecuritylawyer.com
filebankruptcyinworcester.com filebankruptcyinworcester.com
finnbytes.com finnbytes.com
firmcapitalsolutions.com firmcapitalsolutions.com
floridacocounsels.com floridacocounsels.com
floridarolloverlawyers.com floridarolloverlawyers.com
flyinguphill.com flyinguphill.com
for-each.com for-each.com
frankensolar.co.uk frankensolar.co.uk
ftlauderdalecruiselawyers.com ftlauderdalecruiselawyers.com
ftlauderdalemalpracticelawyers.net ftlauderdalemalpracticelawyers.net
funerariateixeiradocoutofilho.com funerariateixeiradocoutofilho.com
funews.ru funews.ru
gainesvillenursinghomelawyer.com gainesvillenursinghomelawyer.com
gator-tail.ru gator-tail.ru
globads.com globads.com
globaltorchlight.com globaltorchlight.com
godsfamily.org godsfamily.org
golfteepictures.com golfteepictures.com
gracechurchlaurens.com gracechurchlaurens.com
groupe-curious.com groupe-curious.com
haisai-english.com haisai-english.com
harmonyenergyworks.com harmonyenergyworks.com
help.geneticroulettemovie.com help.geneticroulettemovie.com
hotelazucenas.com hotelazucenas.com
hrforyourbusiness.com.au hrforyourbusiness.com.au
hudaatulumam.org hudaatulumam.org
icgcltd.com icgcltd.com
inbalancepilates.com.au inbalancepilates.com.au
indygomedia.com indygomedia.com
inspiredlettings.com inspiredlettings.com
instaglobalcollect.com instaglobalcollect.com
integrativeinsurance.com integrativeinsurance.com
internetsadik.ru internetsadik.ru
iolinscience.com.au iolinscience.com.au
iotzone.co iotzone.co
jacksonvillenursinghomelawyers.com jacksonvillenursinghomelawyers.com
jacksonvillepradaxalawyer.com jacksonvillepradaxalawyer.com
jacksonvilleveteransdisabilitylawyer.com jacksonvilleveteransdisabilitylawyer.com
janewilkensmichael.com janewilkensmichael.com
jaydixit.com jaydixit.com
jgbcomms.co.uk jgbcomms.co.uk
jrmi.org jrmi.org
keelaphotography.com keelaphotography.com
lagranbaita.com lagranbaita.com
lakecitynursinghomelawyer.com lakecitynursinghomelawyer.com
lakle.com lakle.com
lanceburnsphotography.com lanceburnsphotography.com
laphotostudio.co laphotostudio.co
lavaconsult.be lavaconsult.be
lavaconsult.eu lavaconsult.eu
lenbaget.ru lenbaget.ru
leselidze21.ru leselidze21.ru
localsurfer.com.au localsurfer.com.au
longtonladybirds.co.uk longtonladybirds.co.uk
louisiana.totalpayroll.net louisiana.totalpayroll.net
malaxiavisa.com malaxiavisa.com
mandingue.org mandingue.org
martinekalaw.com martinekalaw.com
maryfinsterer.com maryfinsterer.com
miamicruiselawyers.com miamicruiselawyers.com
miamipaininstitute.com miamipaininstitute.com
micheleathenamorgen.com micheleathenamorgen.com
mieldequartier.com mieldequartier.com
miguel-nistal.com miguel-nistal.com
mindator.de mindator.de
mondhamedia.com mondhamedia.com
myhairaintnappy.com myhairaintnappy.com
nathanwittman.com nathanwittman.com
nationalfoliagefoundation.com nationalfoliagefoundation.com
network.poweron.fr network.poweron.fr
neuhd.com neuhd.com
newyorkwritersintensive.com newyorkwritersintensive.com
nicewebsites.fr nicewebsites.fr
officialdriversupdate.com officialdriversupdate.com
offshoreintegratedservices.com offshoreintegratedservices.com
openmobility.biz openmobility.biz
orangeparkdogbitelawyer.com orangeparkdogbitelawyer.com
orangeparkmedicalmalpracticelawyer.com orangeparkmedicalmalpracticelawyer.com
orangeparkmotorcycleaccidentlawyers.com orangeparkmotorcycleaccidentlawyers.com
orangeparkveteransdisabilitylawyer.com orangeparkveteransdisabilitylawyer.com
originalstriking.strikingsupport.com originalstriking.strikingsupport.com
orlandomotorcycleaccidentlawyers.com orlandomotorcycleaccidentlawyers.com
paceyouththeatre.com paceyouththeatre.com
palatkasocialsecurity.com palatkasocialsecurity.com
par5fitness.com par5fitness.com
paradoxcollegefunding.com paradoxcollegefunding.com
parotomasyon.com parotomasyon.com
richardmoss.com richardmoss.com
picsave.co.uk picsave.co.uk
pinpoil.es pinpoil.es
pinshot.com pinshot.com
plannedforperfection.co.uk plannedforperfection.co.uk
plataformanatural.com plataformanatural.com
policechiefstraining.org policechiefstraining.org
portcanaveralcruiselawyers.com portcanaveralcruiselawyers.com
poweron.fr poweron.fr
practicalcombatives.com practicalcombatives.com
pscarmody.com pscarmody.com
ashcanart.com ashcanart.com
remaxheritagedev.com remaxheritagedev.com
reporterstrap.com reporterstrap.com
reptechcenter.com reptechcenter.com
resonancesocial.com resonancesocial.com
retrotechy.net retrotechy.net
reviews.geneticroulettemovie.com reviews.geneticroulettemovie.com
rollovercrashlawyers.com rollovercrashlawyers.com
roofraisersinc.com roofraisersinc.com
rosapinc.com rosapinc.com
rosapinc.com.br rosapinc.com.br
arthurm.com arthurm.com
saintadalbert.org saintadalbert.org
saintadalbertparish.org saintadalbertparish.org
santiagoaeropuerto.com santiagoaeropuerto.com
adamsdental.com adamsdental.com
scarboroughdj.com scarboroughdj.com
scoliosis-back-brace.ca scoliosis-back-brace.ca
scrapcarbuyers.co.uk scrapcarbuyers.co.uk
sddh.org.br sddh.org.br
seaworldaccidentlawyers.com seaworldaccidentlawyers.com
seaworldinjurylawyer.com seaworldinjurylawyer.com
ahorseandawizard.com ahorseandawizard.com
alohaseptic.com alohaseptic.com
shop.geneticroulettemovie.com shop.geneticroulettemovie.com
alistairhorscroft.com alistairhorscroft.com
alliancedancecompany.org alliancedancecompany.org
shubomania.com shubomania.com
simplesteps.co.nz simplesteps.co.nz
sitesmobiles.com.br sitesmobiles.com.br
sixflagsinjurylawyer.com sixflagsinjurylawyer.com
skygrafika.ru skygrafika.ru
smrcompany.com smrcompany.com
smt-france.fr smt-france.fr
annulmentlaw.info annulmentlaw.info
anprime.ru anprime.ru
soumitragoswami.com soumitragoswami.com
soyaoilcoatings.com soyaoilcoatings.com
ssl.geneticroulettemovie.com ssl.geneticroulettemovie.com
atherpath.com atherpath.com
staugustinemedicalmalpracticelawyer.com staugustinemedicalmalpracticelawyer.com
streetlife.net.au streetlife.net.au
strikingmultiflex.com strikingmultiflex.com
suar.hanaanitrace.com suar.hanaanitrace.com
atlassolutionsinc.net atlassolutionsinc.net
sunpire.com sunpire.com
superiorheating.com superiorheating.com
sweatcostudios.com sweatcostudios.com
aldeguer.eu aldeguer.eu
amokcombatives.com amokcombatives.com
applejackduo.co.uk applejackduo.co.uk
telemarketing-services.com.au telemarketing-services.com.au
temkinsproperties.com temkinsproperties.com
tentswithcompliments.com tentswithcompliments.com
terrywherrysports.com terrywherrysports.com
auth.geneticroulettemovie.com auth.geneticroulettemovie.com
teslatestandtag.com teslatestandtag.com
thegroundfloor.info thegroundfloor.info
thetaylorsgrp.co.uk thetaylorsgrp.co.uk
baloncubaba.com baloncubaba.com
timelapser.es timelapser.es
tompapay.com tompapay.com
toyoursuccesstoday.com toyoursuccesstoday.com
training.resellersecrets.net training.resellersecrets.net
trollblues.com trollblues.com
truefit.in truefit.in
trusecurity.com.au trusecurity.com.au
tvent.nl tvent.nl
txtwatcher.com txtwatcher.com
ubax.net ubax.net
bgrowth.cl bgrowth.cl
unikaconsultingllc.com unikaconsultingllc.com
uniteustransport.com uniteustransport.com
updesign.fr updesign.fr
vedvidnyan.com vedvidnyan.com
vegetaledesign.com vegetaledesign.com
verita-group.com verita-group.com
vgscanning.com vgscanning.com
vietgiaphatcompany.com vietgiaphatcompany.com
vitalitydentalarts.com vitalitydentalarts.com
bloomfloraldesign.com.au bloomfloraldesign.com.au
blumenhaus-loos.de blumenhaus-loos.de
blumenloos.de blumenloos.de
bogdanow.eu bogdanow.eu
walnutcreekcrossfit.com walnutcreekcrossfit.com
wearevarsity.info wearevarsity.info
websitebazaar.com websitebazaar.com
bravenewgirls.com bravenewgirls.com
breathoflifecenter.com breathoflifecenter.com
weymouthboatcharters.co.uk weymouthboatcharters.co.uk
whitelightandwishes.com whitelightandwishes.com
winone.com winone.com
brunswicknursinghomelawyer.com brunswicknursinghomelawyer.com
womenofwholeness.org womenofwholeness.org
wongpriscilla.com wongpriscilla.com
workpermitservices.co.uk workpermitservices.co.uk
bushgardensinjurylawyer.com bushgardensinjurylawyer.com
buymcgen.com buymcgen.com
xlc.com.my xlc.com.my
capetownrestaurantguide.co.za capetownrestaurantguide.co.za
carnivalcruiseshiplawyer.com carnivalcruiseshiplawyer.com
yofi.de yofi.de
youproducevideo.com youproducevideo.com
yourcmsexperts.com yourcmsexperts.com
ca.openmobility.biz ca.openmobility.biz
charmanfinancialmanagement.co.uk charmanfinancialmanagement.co.uk
chinagysourcing.com chinagysourcing.com
cmogul.com cmogul.com
cnpmedical.com cnpmedical.com
coorparoo.org.au coorparoo.org.au
creativepeg.com creativepeg.com
daytonanursinghomelawyer.com daytonanursinghomelawyer.com
defensetechnologycorporation.com defensetechnologycorporation.com
delseyfinancial.com delseyfinancial.com
detailclimaticsystems.com detailclimaticsystems.com
dev.gracechurchlaurens.org dev.gracechurchlaurens.org
digic.it digic.it
doecdoe.com doecdoe.com
drsea.org drsea.org
duerr-metalltechnik.de duerr-metalltechnik.de
dumitrualex.ro dumitrualex.ro
edgetechnical.pro edgetechnical.pro
edgetechnical.us edgetechnical.us
ekotechs.com ekotechs.com
emedecoration.com emedecoration.com
emigratemalaysia.com emigratemalaysia.com
entspannung-trainieren.de entspannung-trainieren.de
erikandsadie.com erikandsadie.com
euroasiagroup.co euroasiagroup.co
exp-network.com exp-network.com
farbenbau.at farbenbau.at
fernandinainjurylawyer.com fernandinainjurylawyer.com
fernandinamalpracticelawyers.com fernandinamalpracticelawyers.com
fiberfighters.com fiberfighters.com
fincalanouer.com fincalanouer.com
fix-mypc.com fix-mypc.com
flaka.nl flaka.nl
fnm.pl fnm.pl
fnur.it fnur.it
fontmap.co.uk fontmap.co.uk
fontsandflourish.com fontsandflourish.com
fotografobari.com fotografobari.com
fredrlp.com fredrlp.com
fscaccounting.com fscaccounting.com
gainesvillemalpracticelawyers.com gainesvillemalpracticelawyers.com
gainesvillesocialsecuritylawyer.com gainesvillesocialsecuritylawyer.com
geeq.at geeq.at
geneticroulettemovie.com geneticroulettemovie.com
gensip.com gensip.com
gilberteiche.com gilberteiche.com
globaltorchlight.co.uk globaltorchlight.co.uk
gonzaleztreeservice.com gonzaleztreeservice.com
gracechurchlaurens.org gracechurchlaurens.org
gweb-design.com gweb-design.com
gwprovide.org gwprovide.org
gytality.com gytality.com
healingcrystalwisdom.com healingcrystalwisdom.com
heather-smith.com.au heather-smith.com.au
helenroditis.com helenroditis.com
hitechcontrolsystems.in hitechcontrolsystems.in
home-office-solutions.com home-office-solutions.com
honestsportsbookreview.com honestsportsbookreview.com
ice-stqb.org ice-stqb.org
icreatestories.com icreatestories.com
ikarart.pl ikarart.pl
ingienous.com ingienous.com
isflstudents.com isflstudents.com
iso-roco.com iso-roco.com
istocklandscape.com istocklandscape.com
itbikes.com itbikes.com
jacksonvillekneeimplantlawyer.com jacksonvillekneeimplantlawyer.com
jacksonvilleinjurylawyers.net jacksonvilleinjurylawyers.net
jacksonvillemotorcycleaccidentlawyers.com jacksonvillemotorcycleaccidentlawyers.com
janicescherer.com janicescherer.com
jmoorecustomhomes.com jmoorecustomhomes.com
kamenconsultant.com kamenconsultant.com
karri.no karri.no
kerstinkrick.com kerstinkrick.com
kiltedfrogtestsite.com kiltedfrogtestsite.com
konyanetsisbayi.com konyanetsisbayi.com
lacarbuyingservice.com lacarbuyingservice.com
lakecitysocialsecuritylawyer.com lakecitysocialsecuritylawyer.com
lakewood-condos.com lakewood-condos.com
laurawennstrom.com laurawennstrom.com
leadermed.ru leadermed.ru
leddenperry.com leddenperry.com
leefishermusic.com leefishermusic.com
lemuria-rlt.com lemuria-rlt.com
linkvisum.com linkvisum.com
luders.us luders.us
magnoliascience.org magnoliascience.org
makeitwork.com makeitwork.com
manzoinsurance.com manzoinsurance.com
marble-polishing-sa.com marble-polishing-sa.com
markcolliton.com markcolliton.com
marketingfordentists.com.au marketingfordentists.com.au
marketingwrangler.com marketingwrangler.com
marython.com marython.com
maxeffron.com maxeffron.com
mega-fly.ru mega-fly.ru
mexicobaila.com mexicobaila.com
mijnautoistekoop.nl mijnautoistekoop.nl
mikilazar.de mikilazar.de
mildredconsulting.com mildredconsulting.com
missionbenefits.com missionbenefits.com
motorcycleaccidentanswers.com motorcycleaccidentanswers.com
mybbaseball.com mybbaseball.com
nationalfoliagefoundation.net nationalfoliagefoundation.net
naztek.com naztek.com
nbcadocs.com nbcadocs.com
newearthgreendepot.com newearthgreendepot.com
news.geneticroulettemovie.com news.geneticroulettemovie.com
niagaraonthelakemagazine.com niagaraonthelakemagazine.com
niagarasigns.com niagarasigns.com
nonameconcepts.com nonameconcepts.com
nonstopphoto.pl nonstopphoto.pl
nrtgraphics.com nrtgraphics.com
nzbc.org.nz nzbc.org.nz
ocalaaccidentlawyers.com ocalaaccidentlawyers.com
ofc-us.com ofc-us.com
sus.org.rs sus.org.rs
omyoga.ma omyoga.ma
orangeparksocialsecuritydisabilitylawyer.com orangeparksocialsecuritydisabilitylawyer.com
orbjava.com orbjava.com
orlandoautomobileaccidentlawyers.com orlandoautomobileaccidentlawyers.com
orlandonursinghomelawyers.com orlandonursinghomelawyers.com
orlandopetconnections.com orlandopetconnections.com
outsidethezoneadventures.com outsidethezoneadventures.com
paddleguy.com paddleguy.com
palatkanursinghomelawyer.com palatkanursinghomelawyer.com
palmcoastsocialsecuritylawyer.com palmcoastsocialsecuritylawyer.com
peacesoffashion.com peacesoffashion.com
pemeticpresents.com pemeticpresents.com
pixelcloud-games.com pixelcloud-games.com
plonsky.com plonsky.com
pmg-consult.com pmg-consult.com
pmpmanage.com pmpmanage.com
perdisolutions.com perdisolutions.com
prphq.com prphq.com
putnamcountyaccidentlawyer.com putnamcountyaccidentlawyer.com
quantumpictures.co.uk quantumpictures.co.uk
rachelczar.com rachelczar.com
redmadonnaradio.com redmadonnaradio.com
reiaonline.org reiaonline.org
VCC.NET
IP History

Click the IP addresses to see over domains using them.