WEB192.NETYOU2122.LIVE
Shared Attributes
Domain
linuxtool.net linuxtool.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
matthewmaenner.com matthewmaenner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mdo.fm mdo.fm
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
sd-design.net momgeorge.sd-design.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
nago-wein.at nago-wein.at
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mockupstudio.io neamedia.mockupstudio.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
njtierney.github.io njtierney.github.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
ais-edu.com nursing-and-cambodia.ais-edu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
opslagoffertes.nl opslagoffertes.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
paigefinkelstein.com paigefinkelstein.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
yorunohikage.fr poole.yorunohikage.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
project-rfs.github.io project-rfs.github.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
pruisischblauw.nl pruisischblauw.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
ricemethane.org ricemethane.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
sandrpolymer.com sandrpolymer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
sandeeppatilphotography.com sandeeppatilphotography.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
sierbestratingoffertes.nl sierbestratingoffertes.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
antburton.co.uk antburton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
solidproductsinc.com solidproductsinc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
gearboxbuilt.com standards.gearboxbuilt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
auntieneo.net auntieneo.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
backline-health.com backline-health.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
trungthanh.github.io trungthanh.github.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
betergezegd.github.io betergezegd.github.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
cko.ch uferau.cko.ch
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
velociter.biz velociter.biz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
vrysa.com videos.vrysa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
villageofforestview.com villageofforestview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
ibuprom.pl brand.ibuprom.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
brianliston.org brianliston.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mekari.design ui.mekari.design
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
coaatielugo.com coaatielugo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
codeguide.es codeguide.es
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
spenceraung.me codeguide.spenceraung.me
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
culiti.com culiti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
getpoole.com demo.getpoole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
netyou2122.live democ.netyou2122.live
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
eclipseaerospace.net eclipseaerospace.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
batix.help eins-energie-sachsen-theme.batix.help
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
energizerautomotivebatteries.com energizerautomotivebatteries.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
getbootstrap.com expo.getbootstrap.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
garydog.com garydog.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
sd-design.net garydog.sd-design.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
garykatzpatent.com garykatzpatent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
getbootstrap.ro getbootstrap.ro
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
getpoole.com getpoole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
hagenbuch-consulting.com hagenbuch-consulting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
huber-immobilienkontor.de huber-immobilienkontor.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
getpoole.com hyde.getpoole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
installmentsoftware.com installmentsoftware.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
javadas.com javadas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
keralalottry.com keralalottry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
edespacho.es leonrey.edespacho.es
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
lomelino.com lomelino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
momgeorge.com momgeorge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
notallcss.com notallcss.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
nateharada.com notes.nateharada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
getbootstrap.com getbootstrap.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
onsoft.kr onsoft.kr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
pbwsolicitors.co.uk pbwsolicitors.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
regularnerd.com regularnerd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
rti-strut.com rti-strut.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
arpracticeconsulting.com arpracticeconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
antivirus-testsieger.de antivirus-testsieger.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
przebadani.pl api.przebadani.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
sskro.me sskro.me
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
steelarttour.or.kr steelarttour.or.kr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
topxuatkhaulaodong.vn topxuatkhaulaodong.vn
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
batix.help vue-bootstrap.batix.help
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
scottbishop.dev bootstrap-icons.scottbishop.dev
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
hancheng.xyz bootstrap.hancheng.xyz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
deepdata.nl bootstrap2docs.deepdata.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
webclub.uz bot.webclub.uz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
wified.ru wified.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
wonderandsteel.com wonderandsteel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
yogazentrum-zillertal.at yogazentrum-zillertal.at
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
cheekypili.fr cheekypili.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
digital-dealers.com docs.digital-dealers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
eduambiental.com.co eduambiental.com.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
heritagehomeskerala.com heritagehomeskerala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
himeyama.github.io himeyama.github.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
hoteludaybhuvan.com hoteludaybhuvan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
jiny.dev html5.jiny.dev
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
sidearmdev.com icons.dev.sidearmdev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
georgestreetphoto.com georgestreetphoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
eineweltsong.de bilderpaare.eineweltsong.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
adngruppe.de adngruppe.de
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
scatili.org scatili.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mockupstudio.io schneller.mockupstudio.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
scradvogados.com.br scradvogados.com.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
ais-edu.com study.ais-edu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
symposium-engineering.com symposium-engineering.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
api4wx.com api4wx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
atlantamuslim.com atlantamuslim.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
avtospas56.ru avtospas56.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
thebittercoffee.com thebittercoffee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
batix.help thueringer-netkom-theme.batix.help
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
barnesfamilychiro.com barnesfamilychiro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
bclair.eu bclair.eu
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
tradichef.fr tradichef.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
twinbeacons.com twinbeacons.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
uferau.ch uferau.ch
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
utakatadesign.com utakatadesign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
utkorose.ru utkorose.ru
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
vap-x.com vap-x.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mario.design blog.mario.design
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
michaelrk02.my.id bootstrap.michaelrk02.my.id
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
hexschool.com bootstrap5.hexschool.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
integrityfinancialservicellc.com campaigns.integrityfinancialservicellc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
zhengwujiarui.com zhengwujiarui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
codeguide.co codeguide.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mockupstudio.io demo.mockupstudio.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
dpmaloney.com dpmaloney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
duffieldlaw.com duffieldlaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
phase2online.com energy.phase2online.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
getbootstrap.com icons.getbootstrap.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
irfancorp.com installmentsoftware.irfancorp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
kretec.com.tw kretec.com.tw
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mdoular.com mdoular.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
michaeldboyd.github.io michaeldboyd.github.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
passlab.github.io passlab.github.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
patentgary.com patentgary.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
pentagramafilms.com pentagramafilms.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
prashanthambure.github.io prashanthambure.github.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
fredhutch.io fredhutch.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
annhe.xyz annhe.xyz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
spookyaction.art spookyaction.art
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
sproutfund.org sproutfund.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
naasapie.pl api.naasapie.pl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
stucadooroffertes.be stucadooroffertes.be
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
stucadooroffertes.nl stucadooroffertes.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
thecreativepractice.co.uk thecreativepractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
thetipsytrailer.co.uk thetipsytrailer.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
acaiicanadaorg.ca transfert.acaiicanadaorg.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
bestratingoffertes.nl bestratingoffertes.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
bifari.it bifari.it
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
bergren.top vmess.bergren.top
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
transferwise.com bootstrap.transferwise.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
bruidsfotograafoffertes.nl bruidsfotograafoffertes.nl
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
wissam.online wissam.online
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
wtfforms.com wtfforms.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
wtfhtmlcss.com wtfhtmlcss.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
camarasaaventureiro.com.br camarasaaventureiro.com.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
danielbayo.com danielbayo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
ddreamsnepal.com ddreamsnepal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
deepbluemedia.co.za deepbluemedia.co.za
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
digitalredlining.com digitalredlining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
divyanka.me divyanka.me
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
easyone.ro getbootstrap.easyone.ro
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
hfpjc.com hfpjc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
netyou2122.live htm97.netyou2122.live
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
iasagrp.com iasagrp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mockupstudio.io indesfuggerhaus.mockupstudio.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
jakekirsch.com jakekirsch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
jelani.dev jelani.dev
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
katzpatent.com katzpatent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
kristinelund.nu kristinelund.nu
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
getpoole.com lanyon.getpoole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
learnsmart.com.ng learnsmart.com.ng
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mantejsingh.com mantejsingh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
mpresif.com mpresif.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
noahkennedy.co noahkennedy.co
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
nunwan.fr nunwan.fr
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
newera.edu.my opac.newera.edu.my
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
pizzaspartyzonasur.com.ar pizzaspartyzonasur.com.ar
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
advancebaggage.com advancebaggage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-146052 Feb 2023 Feb 2023 One Off
WEB192.NETYOU2122.LIVE
Non IP Attributes
Attribute First Last
UA UA-146052 Feb 2023 Feb 2023
WEB192.NETYOU2122.LIVE
Overlap Attribute Domains
linuxtool.net linuxtool.net
matthewmaenner.com matthewmaenner.com
mdo.fm mdo.fm
momgeorge.sd-design.net momgeorge.sd-design.net
nago-wein.at nago-wein.at
neamedia.mockupstudio.io neamedia.mockupstudio.io
njtierney.github.io njtierney.github.io
nursing-and-cambodia.ais-edu.com nursing-and-cambodia.ais-edu.com
opslagoffertes.nl opslagoffertes.nl
paigefinkelstein.com paigefinkelstein.com
poole.yorunohikage.fr poole.yorunohikage.fr
project-rfs.github.io project-rfs.github.io
pruisischblauw.nl pruisischblauw.nl
ricemethane.org ricemethane.org
sandrpolymer.com sandrpolymer.com
sandeeppatilphotography.com sandeeppatilphotography.com
sierbestratingoffertes.nl sierbestratingoffertes.nl
antburton.co.uk antburton.co.uk
solidproductsinc.com solidproductsinc.com
standards.gearboxbuilt.com standards.gearboxbuilt.com
auntieneo.net auntieneo.net
backline-health.com backline-health.com
trungthanh.github.io trungthanh.github.io
betergezegd.github.io betergezegd.github.io
uferau.cko.ch uferau.cko.ch
velociter.biz velociter.biz
videos.vrysa.com videos.vrysa.com
villageofforestview.com villageofforestview.com
brand.ibuprom.pl brand.ibuprom.pl
brianliston.org brianliston.org
ui.mekari.design ui.mekari.design
coaatielugo.com coaatielugo.com
codeguide.es codeguide.es
codeguide.spenceraung.me codeguide.spenceraung.me
culiti.com culiti.com
demo.getpoole.com demo.getpoole.com
democ.netyou2122.live democ.netyou2122.live
eclipseaerospace.net eclipseaerospace.net
eins-energie-sachsen-theme.batix.help eins-energie-sachsen-theme.batix.help
energizerautomotivebatteries.com energizerautomotivebatteries.com
expo.getbootstrap.com expo.getbootstrap.com
garydog.com garydog.com
garydog.sd-design.net garydog.sd-design.net
garykatzpatent.com garykatzpatent.com
getbootstrap.ro getbootstrap.ro
getpoole.com getpoole.com
hagenbuch-consulting.com hagenbuch-consulting.com
huber-immobilienkontor.de huber-immobilienkontor.de
hyde.getpoole.com hyde.getpoole.com
installmentsoftware.com installmentsoftware.com
javadas.com javadas.com
keralalottry.com keralalottry.com
leonrey.edespacho.es leonrey.edespacho.es
lomelino.com lomelino.com
momgeorge.com momgeorge.com
notallcss.com notallcss.com
notes.nateharada.com notes.nateharada.com
getbootstrap.com getbootstrap.com
onsoft.kr onsoft.kr
pbwsolicitors.co.uk pbwsolicitors.co.uk
regularnerd.com regularnerd.com
rti-strut.com rti-strut.com
arpracticeconsulting.com arpracticeconsulting.com
antivirus-testsieger.de antivirus-testsieger.de
api.przebadani.pl api.przebadani.pl
sskro.me sskro.me
steelarttour.or.kr steelarttour.or.kr
topxuatkhaulaodong.vn topxuatkhaulaodong.vn
vue-bootstrap.batix.help vue-bootstrap.batix.help
bootstrap-icons.scottbishop.dev bootstrap-icons.scottbishop.dev
bootstrap.hancheng.xyz bootstrap.hancheng.xyz
bootstrap2docs.deepdata.nl bootstrap2docs.deepdata.nl
bot.webclub.uz bot.webclub.uz
wified.ru wified.ru
wonderandsteel.com wonderandsteel.com
yogazentrum-zillertal.at yogazentrum-zillertal.at
cheekypili.fr cheekypili.fr
docs.digital-dealers.com docs.digital-dealers.com
eduambiental.com.co eduambiental.com.co
heritagehomeskerala.com heritagehomeskerala.com
himeyama.github.io himeyama.github.io
hoteludaybhuvan.com hoteludaybhuvan.com
html5.jiny.dev html5.jiny.dev
icons.dev.sidearmdev.com icons.dev.sidearmdev.com
georgestreetphoto.com georgestreetphoto.com
bilderpaare.eineweltsong.de bilderpaare.eineweltsong.de
adngruppe.de adngruppe.de
scatili.org scatili.org
schneller.mockupstudio.io schneller.mockupstudio.io
scradvogados.com.br scradvogados.com.br
study.ais-edu.com study.ais-edu.com
symposium-engineering.com symposium-engineering.com
api4wx.com api4wx.com
atlantamuslim.com atlantamuslim.com
avtospas56.ru avtospas56.ru
thebittercoffee.com thebittercoffee.com
thueringer-netkom-theme.batix.help thueringer-netkom-theme.batix.help
barnesfamilychiro.com barnesfamilychiro.com
bclair.eu bclair.eu
tradichef.fr tradichef.fr
twinbeacons.com twinbeacons.com
uferau.ch uferau.ch
utakatadesign.com utakatadesign.com
utkorose.ru utkorose.ru
vap-x.com vap-x.com
blog.mario.design blog.mario.design
bootstrap.michaelrk02.my.id bootstrap.michaelrk02.my.id
bootstrap5.hexschool.com bootstrap5.hexschool.com
web192.netyou2122.live web192.netyou2122.live
campaigns.integrityfinancialservicellc.com campaigns.integrityfinancialservicellc.com
zhengwujiarui.com zhengwujiarui.com
codeguide.co codeguide.co
demo.mockupstudio.io demo.mockupstudio.io
dpmaloney.com dpmaloney.com
duffieldlaw.com duffieldlaw.com
energy.phase2online.com energy.phase2online.com
icons.getbootstrap.com icons.getbootstrap.com
installmentsoftware.irfancorp.com installmentsoftware.irfancorp.com
kretec.com.tw kretec.com.tw
mdoular.com mdoular.com
michaeldboyd.github.io michaeldboyd.github.io
passlab.github.io passlab.github.io
patentgary.com patentgary.com
pentagramafilms.com pentagramafilms.com
prashanthambure.github.io prashanthambure.github.io
fredhutch.io fredhutch.io
annhe.xyz annhe.xyz
spookyaction.art spookyaction.art
sproutfund.org sproutfund.org
api.naasapie.pl api.naasapie.pl
stucadooroffertes.be stucadooroffertes.be
stucadooroffertes.nl stucadooroffertes.nl
thecreativepractice.co.uk thecreativepractice.co.uk
thetipsytrailer.co.uk thetipsytrailer.co.uk
transfert.acaiicanadaorg.ca transfert.acaiicanadaorg.ca
bestratingoffertes.nl bestratingoffertes.nl
bifari.it bifari.it
vmess.bergren.top vmess.bergren.top
bootstrap.transferwise.com bootstrap.transferwise.com
bruidsfotograafoffertes.nl bruidsfotograafoffertes.nl
wissam.online wissam.online
wtfforms.com wtfforms.com
wtfhtmlcss.com wtfhtmlcss.com
camarasaaventureiro.com.br camarasaaventureiro.com.br
danielbayo.com danielbayo.com
ddreamsnepal.com ddreamsnepal.com
deepbluemedia.co.za deepbluemedia.co.za
digitalredlining.com digitalredlining.com
divyanka.me divyanka.me
getbootstrap.easyone.ro getbootstrap.easyone.ro
hfpjc.com hfpjc.com
htm97.netyou2122.live htm97.netyou2122.live
iasagrp.com iasagrp.com
indesfuggerhaus.mockupstudio.io indesfuggerhaus.mockupstudio.io
jakekirsch.com jakekirsch.com
jelani.dev jelani.dev
katzpatent.com katzpatent.com
kristinelund.nu kristinelund.nu
lanyon.getpoole.com lanyon.getpoole.com
learnsmart.com.ng learnsmart.com.ng
mantejsingh.com mantejsingh.com
mpresif.com mpresif.com
noahkennedy.co noahkennedy.co
nunwan.fr nunwan.fr
opac.newera.edu.my opac.newera.edu.my
pizzaspartyzonasur.com.ar pizzaspartyzonasur.com.ar
advancebaggage.com advancebaggage.com
WEB192.NETYOU2122.LIVE
IP History

Click the IP addresses to see over domains using them.