Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

ACADEMIATRADUCTORES.COM

ACADEMIATRADUCTORES.COM
Shared Attributes
Domain
wecnqr.com wecnqr.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
aboutlittlehumans.com aboutlittlehumans.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
abundanceacademy.online abundanceacademy.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
abyssimoartschool.com abyssimoartschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academievoorabstractefotografie.nl academievoorabstractefotografie.nl
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academiacosmetica.com academiacosmetica.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 321 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
acepresentationschool.com acepresentationschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
agustinaalgorta.com agustinaalgorta.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academiademodas.com academiademodas.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
bosschicks247.com bosschicks247.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
martinbrossmaninstitute.com martinbrossmaninstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academyofcomposition.com academyofcomposition.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 323 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
abbevilleacademy.org abbevilleacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
accurateenglishacademy.com accurateenglishacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 153 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
warp-9.com warp-9.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 323 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academiadeangeles.com academiadeangeles.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
aammlearning.com aammlearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
maskilim.org maskilim.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academiehsa.com academiehsa.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
acknowlink.com acknowlink.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
activehope.training activehope.training
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
aikiuniversity.com aikiuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 264 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 15 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
mecacfoacademy.com mecacfoacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 329 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
masteringlinting.com masteringlinting.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
martialartscenter.de martialartscenter.de
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
yoohoo.academy yoohoo.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
FS FS-318805607 Feb 2024 Feb 2024 One Off
youtap.education youtap.education
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
martingureasko.com martingureasko.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academiaenergiasolar.com academiaenergiasolar.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
aartoday.com aartoday.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
abawizard.net abawizard.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
FS FS-318805607 Jul 2023 Jul 2023 One Off
acromastermind.com acromastermind.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 15 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
agencyacceleratorcourse.com agencyacceleratorcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 348 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
ailymphatic.com ailymphatic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Feb 2024 219 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
akademiagrowings.com akademiagrowings.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
adobetechacademy.com adobetechacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
masterklassesonline.com masterklassesonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 11 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
acupuncturescholar.com acupuncturescholar.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
720trades.com 720trades.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 15 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
aaronga97.com aaronga97.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 15 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
accountabilitycoachuniversity.com accountabilitycoachuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
teachable.com martial-arts-online.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
33growth.net 33growth.net
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
9-1-1academy.com 9-1-1academy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
a2etraining.com a2etraining.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academyinnerknowing.com academyinnerknowing.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academiaesenciales.com academiaesenciales.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academybizcreators.com academybizcreators.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academyofuniversallawsandprinciples.com academyofuniversallawsandprinciples.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academy-of-success.com academy-of-success.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
4goodacademy.it 4goodacademy.it
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
acnehealingacademy.com acnehealingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
adolescentdogsacademy.co.uk adolescentdogsacademy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
aiportalen.com aiportalen.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
aisha777.com aisha777.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
ajinkyakolhe.com ajinkyakolhe.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
aiguruacademy.com aiguruacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academyubora-ltd.com academyubora-ltd.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
adibusinesssuccess.com adibusinesssuccess.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
abuzeidacademy.online abuzeidacademy.online
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
achoacademy.com achoacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academiaonlinelatorre.com academiaonlinelatorre.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
xpat-u.com xpat-u.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
yafham.com yafham.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
12foundationstonescourse.com 12foundationstonescourse.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
martist-bodywork.com martist-bodywork.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
3deerender.com 3deerender.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
a1assetshq.com a1assetshq.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
academiadehacking.ro academiadehacking.ro
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academuscr.com academuscr.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academycopyriches.com academycopyriches.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academiafarmasiespana.com academiafarmasiespana.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academyserenity.com academyserenity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
accelerations.org accelerations.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
accountingwithindy.com accountingwithindy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
alchemyu.org alchemyu.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
acadianxu.com acadianxu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 331 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
teachable.com masteringimovie.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
codinglab.tw ai-camp.codinglab.tw
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
adenaacademy.com adenaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
12miglia.it 12miglia.it
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
6toolathlete.com 6toolathlete.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
6minutespay.com 6minutespay.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
mbacoachph.com mbacoachph.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
4jibaro.com 4jibaro.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
abundantlife.courses abundantlife.courses
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academiafarmasiportugal.com academiafarmasiportugal.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
academy-of-unlimited-mind.com academy-of-unlimited-mind.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
masteringyourjobsearch.com masteringyourjobsearch.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 23 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
activistacademy.eu activistacademy.eu
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
agentaffiliatelink.com agentaffiliatelink.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
adventures-n-things.com adventures-n-things.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
teachable.com master-investor-academy.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
masteringnewbornphotography.com masteringnewbornphotography.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mathkrumacosk128.com mathkrumacosk128.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 11 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
agilecommunities.com.au agilecommunities.com.au
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
aiproductmanager.org aiproductmanager.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
airdeskr.net airdeskr.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
akmaonline.com akmaonline.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
1eureka.com 1eureka.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
2morrowskill.com 2morrowskill.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
abreuuniversityonline.com abreuuniversityonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
globalsmallbusinessschool.com globalsmallbusinessschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
abstractingthelandscape.com abstractingthelandscape.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
accountingforschools.com accountingforschools.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
actrxtraining.com actrxtraining.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
adrianyanitaonline.com adrianyanitaonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
biamonline.com biamonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
akicikonus.com akicikonus.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
bradwhisnant.com bradwhisnant.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
globalquality.academy globalquality.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 12 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
learn-martialarts.com learn-martialarts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
learnballetonline.com learnballetonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 320 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
learninggodstruth.com learninggodstruth.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
learningtheartlife.com learningtheartlife.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 79 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
legionassistedlivingacademy.com legionassistedlivingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 11 days
lidemy.com lidemy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
arabicoders.com arabicoders.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 325 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
linguisticator.com linguisticator.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 7 days
literaryadventuresforkids.com literaryadventuresforkids.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lonecrowstudio.com lonecrowstudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 1 year, 6 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
longevity.degree longevity.degree
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lyndajanespiritschool.com lyndajanespiritschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
FS FS-318805607 Jul 2023 Jul 2023 One Off
machongate.net machongate.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 320 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
makemusicmoves.com makemusicmoves.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
makingsenseofsponsoredposts.com makingsenseofsponsoredposts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 347 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 1 day
marksmanacademy.org marksmanacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 11 days
mastersandharris.com mastersandharris.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
FS FS-318805607 Feb 2024 Feb 2024 1 day
benbacal-academy.com benbacal-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 265 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mbcourses.org mbcourses.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 86 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
medical-german.eu medical-german.eu
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
menocourse.com menocourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
michelleleeartsstudio.com michelleleeartsstudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Jan 2024 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
millermanschool.com millermanschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 36 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
millionairetraderssociety.com millionairetraderssociety.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mintplusplus.ch mintplusplus.ch
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
miraclewordu.com miraclewordu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mjsi.org mjsi.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 89 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
moreyouniversity.com moreyouniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 225 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mountainfitnessschool.com mountainfitnessschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mtpeducation.com mtpeducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Apr 2023 Feb 2024 328 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
muaythaisecretonline.com muaythaisecretonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
multiplicationschool.com multiplicationschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
musictherapyonline.org musictherapyonline.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
myarkview.org myarkview.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mybodymycelebration.com mybodymycelebration.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
myccuonline.com myccuonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Mar 2024 272 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mynetworktraining.com mynetworktraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
myrecoveryportal.com myrecoveryportal.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
psal.ms psal.ms
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
halabellydance.com halabellydance.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 79 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
teplu.in teplu.in
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
iceju.org iceju.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2024 1 year, 26 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
girlgonecity.com girlgonecity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
knackcourses.com knackcourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
dojang.org dojang.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
gaivna.com gaivna.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
academianexoyoga.com academianexoyoga.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 7 days
speakenglishwithtiffaniacademy.com speakenglishwithtiffaniacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
picaca.jp picaca.jp
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
bnb.university bnb.university
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 90 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
asvabsuccess.net asvabsuccess.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
rhythm.academy rhythm.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
bassemschool.com bassemschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Mar 2024 301 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
thewat.com thewat.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
audacitybootcamp.com audacitybootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
cphttrainingcenter.com cphttrainingcenter.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
alstocktrades.com alstocktrades.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
formazioneintegrata.com formazioneintegrata.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
awakeinthedreamschool.com awakeinthedreamschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 93 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
haccptrainingonline.ie haccptrainingonline.ie
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ccstarseeds.me ccstarseeds.me
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Aug 2023 Mar 2024 194 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chrystele-pitzalis.com chrystele-pitzalis.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
algolab.so algolab.so
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
altdeep.ai altdeep.ai
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
getthespike.com getthespike.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 326 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
freightbroker911.training freightbroker911.training
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
asiaforexmentoracademy.com asiaforexmentoracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 19 days
accountingcodingcamp.com accountingcodingcamp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 7 days
autismforteachers.com autismforteachers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 14 days
awsdevops.io awsdevops.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
beginblacksmithing.com beginblacksmithing.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
FS FS-318805607 Jan 2023 Jan 2023 One Off
hayashi-shunsuke.com hayashi-shunsuke.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
FS FS-318805607 Mar 2023 Mar 2023 One Off
coursesbycaroline.com coursesbycaroline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
couragemolinauniversity.com couragemolinauniversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
brigadeacademy.com brigadeacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
codingfaculty.com codingfaculty.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
cogni.school cogni.school
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
FS FS-318805607 Jul 2023 Jul 2023 One Off
iso-gps.com iso-gps.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
knowmore.university knowmore.university
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
hypnopower.us hypnopower.us
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 30 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
forteachersbyteachers.net forteachersbyteachers.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
teachable.com bee-friendly-family.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
IC IC-318805607 Feb 2025 Feb 2025 One Off
karaz.academy karaz.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Dec 2023 188 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 14 days
shibariclasses.com shibariclasses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 363 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
learnfinearts.com learnfinearts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
certifiedondemand.com certifiedondemand.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
kyleeanneducation.com kyleeanneducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
laviniabrowncourses.com laviniabrowncourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 329 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lifedesignsociety.com lifedesignsociety.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
gytocourses.com gytocourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
campusdigitaldeespecialistas.com campusdigitaldeespecialistas.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
digitalabcd.com digitalabcd.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 364 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
horsebosses.com horsebosses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
luxebrowngirltravels.com luxebrowngirltravels.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
luxuryfilmmaker.com luxuryfilmmaker.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lvbbi.com lvbbi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
lymcapacitacion.com lymcapacitacion.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mac-seminar.online mac-seminar.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
markzguitar.com markzguitar.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 17 days
FS FS-318805607 Nov 2023 Nov 2023 One Off
darbukaschool.com darbukaschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mazentaichi.com mazentaichi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mcclanahanacademy.com mcclanahanacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
myautomationclass.com myautomationclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 28 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mentality.work mentality.work
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
mervacademy.com mervacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
michelemavi.com michelemavi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
michelleraesobi.com michelleraesobi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
middlemanagermagic.com middlemanagermagic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mildorviolon.com mildorviolon.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 94 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
misiononline.com misiononline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
mmcourses.co.uk mmcourses.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
moolmaninstitute.com moolmaninstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
morimotostudio.com morimotostudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Jan 2024 114 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
moteefe.school moteefe.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
mrquakersteaches.com mrquakersteaches.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 19 days
mteacademy.ca mteacademy.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 348 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mymusicalvoice.com mymusicalvoice.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
uog.training uog.training
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
freedomnation.online freedomnation.online
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
ppcs.nu ppcs.nu
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
voip.school voip.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 35 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
certv.org certv.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 323 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
fbcti.org fbcti.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 332 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
qifit.pl qifit.pl
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
tpd15.com tpd15.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 323 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
bestme.today bestme.today
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
bkeiei.com bkeiei.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
homeschool-university.com homeschool-university.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 328 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 16 days
shopline.tw course.shopline.tw
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
cpaweb.org.uk cpaweb.org.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
homebuildersuniversity.com homebuildersuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
oxfordlearninglab.com oxfordlearninglab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
pornrebootprogram.com pornrebootprogram.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
hustlebuddiesofficial.com hustlebuddiesofficial.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 3 days
FS FS-318805607 Nov 2023 Nov 2023 One Off
skaled.academy skaled.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
shezer.org shezer.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
cherishartzcreative.com cherishartzcreative.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 28 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
cphttraining.com cphttraining.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
functionalfreediving.com functionalfreediving.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 26 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
afrolatinfunk.dance afrolatinfunk.dance
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
wndx.school wndx.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 264 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
fpmasterclass.com fpmasterclass.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
vulf.co vulf.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Feb 2024 87 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
atparentingsurvivalschool.com atparentingsurvivalschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
authorgrow.com authorgrow.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
avatarenergymastery.com avatarenergymastery.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 222 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 20 days
brailleskateuniversity.com brailleskateuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
idlab.school idlab.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 94 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
frenchwithvincent.com frenchwithvincent.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 339 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
developedbyed.com developedbyed.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
getstartedplayingukulele.com getstartedplayingukulele.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 17 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
sifcpd.com sifcpd.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
stages.academy stages.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
healthyuonline.org healthyuonline.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
heahealthhub.com heahealthhub.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
childhoodtraumainstitute.com childhoodtraumainstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
iltdp.com iltdp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
frenchdialogues.com frenchdialogues.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
haircamphomeedition.com haircamphomeedition.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 311 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
accordarelabatteria.it accordarelabatteria.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lovemywombacademyonline.com lovemywombacademyonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Feb 2024 342 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mastinkippcoaching.com mastinkippcoaching.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
kurser-for-par.dk kurser-for-par.dk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
michaelandrewlawdojo.com michaelandrewlawdojo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 14 days
manosfilippou.com manosfilippou.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Dec 2023 300 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 2 days
alexandrian.academy alexandrian.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 13 days
allthingsendo.ca allthingsendo.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lowerlaptime.com lowerlaptime.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jan 2024 178 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
mastery.business mastery.business
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
apprendre-java.com apprendre-java.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
1600.io 1600.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
aspireinstitute.tv aspireinstitute.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 345 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 14 days
mikebauermusic.com mikebauermusic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
autotrading.vip autotrading.vip
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
avotek-online.com avotek-online.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 324 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 1 day
minervaeducacionfinanciera.mx minervaeducacionfinanciera.mx
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Oct 2023 239 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
frittsacademy.com frittsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
bear.academy bear.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
turnkeyrentals101.com turnkeyrentals101.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2023 71 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mmi-members.com mmi-members.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 323 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
guitaros.com guitaros.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 3 days
mom-sports.com mom-sports.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 327 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
moteefearabic.com moteefearabic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
moystudio.online moystudio.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
evolvefitnessofficial.com evolvefitnessofficial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
mrflynnib.com mrflynnib.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 25 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
muttsandmischiefacademy.com muttsandmischiefacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
FS FS-318805607 Feb 2024 Feb 2024 One Off
mwgcourses.com mwgcourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 359 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
myteachinghero.com myteachinghero.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
graphicinteriordesignschool.com graphicinteriordesignschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 39 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
grazeu.com grazeu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
janechippsart.school janechippsart.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
makemoneywithcredit.com makemoneywithcredit.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
jennicrowther.co.uk jennicrowther.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
makingsenseofaffiliatemarketing.com makingsenseofaffiliatemarketing.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 354 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
kizentraining.com kizentraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
jenniferrayecourses.com jenniferrayecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
learnitanytime.com learnitanytime.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Oct 2023 237 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
learn.physio learn.physio
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
moneyintelligenceacademy.com moneyintelligenceacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Oct 2023 240 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 12 days
livingarchitectureacademy.com livingarchitectureacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 273 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
linglongchinois.com linglongchinois.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 244 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
polygonrunway.com polygonrunway.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
master-jpcuisine.com master-jpcuisine.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 23 days
miiedu.com miiedu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mindbaracademy.com mindbaracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 326 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
moderncalligraphy101.com moderncalligraphy101.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
mountaindulcimeratoz.com mountaindulcimeratoz.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
myacademyofsuccess.com myacademyofsuccess.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
qtlab.it qtlab.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 354 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 14 days
beckythompsonstudies.com beckythompsonstudies.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
30daystosuccess.academy 30daystosuccess.academy
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Feb 2025 Feb 2025 One Off
HP HP-318805607 Feb 2025 Feb 2025 One Off
americandentalsedation.com americandentalsedation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
cheekyschool.com cheekyschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
HP HP-318805607 Feb 2025 Feb 2025 One Off
americanenglishuniversity.com americanenglishuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
cphtacademy.com cphtacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
christinekmillercourses.com christinekmillercourses.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lilibarbery.tv lilibarbery.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lvrgacademy.com lvrgacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
lionahottaschool.com lionahottaschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 35 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
lissarankinmd.com lissarankinmd.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
littlelighthouseacademy.org littlelighthouseacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 152 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lotphilanthropyu.com lotphilanthropyu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 222 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 1 day
lovedaphnemaecourses.com lovedaphnemaecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 17 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lovelybylindsey-bridalhaireducation.com lovelybylindsey-bridalhaireducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 1 day
lovingright.co lovingright.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lucysartlab.com lucysartlab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
cidn-edu.com cidn-edu.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
sandia.co.za sandia.co.za
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 15 days
doordata.tw school.doordata.tw
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
agenyz.tv agenyz.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
getorganizedgal.com getorganizedgal.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 333 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 3 days
amazonsellerpros.com amazonsellerpros.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
myonlinecnaplatform.com myonlinecnaplatform.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
matusnursingreviewacademy.com matusnursingreviewacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 27 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mindandbusiness.net mindandbusiness.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Jan 2024 29 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
lisapowers.courses lisapowers.courses
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
media101.org media101.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
staer.is staer.is
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
kpi.academy kpi.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mentoriaprofetica.org mentoriaprofetica.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 39 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
awesomeartschool.com awesomeartschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 273 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mindsetclasses.com mindsetclasses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 14 days
azizbashaacademy.com azizbashaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 322 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
balkanarchitect.com balkanarchitect.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 323 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
benja.hk benja.hk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mnairacademy.com mnairacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 90 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
lescreateurs.video lescreateurs.video
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 4 days
dalilkcourse.com dalilkcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
edrone.academy edrone.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
growthschool.com growthschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 87 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
jfdplus.com jfdplus.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
giftedsocietyacademy.org giftedsocietyacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
lorenzofiorentino-corsi.it lorenzofiorentino-corsi.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
multisensorymath.online multisensorymath.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 21 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
garyclarke.tech garyclarke.tech
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 325 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
loftylearning.com loftylearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
mybiomi.com mybiomi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 83 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
graceincolorclassroom.com graceincolorclassroom.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 12 days
groomadogcourse.com groomadogcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
growinginchrist.com growinginchrist.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 264 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
mymodernagentu.com mymodernagentu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 314 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
learnwitheo.com learnwitheo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 264 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
iuda.dance iuda.dance
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
interculturalireland.com interculturalireland.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 4 days
kisss.academy kisss.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Dec 2023 188 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
myyogatime.com myyogatime.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
praxiscenterforaestheticstudies.com praxiscenterforaestheticstudies.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lilium.academy lilium.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
livetantraacademy.com livetantraacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
mantelandtableacademy.com mantelandtableacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 2 days
marketinginblack.com marketinginblack.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
markperrenjones.com markperrenjones.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
musicbycandl.com musicbycandl.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Jan 2024 308 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
mxgraphics-academy.com mxgraphics-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 262 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
marcotafelli.com marcotafelli.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 10 days
imgroadmap.com imgroadmap.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 264 days
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 12 days
kurdzone.org kurdzone.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
emubaonline.com emubaonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
encorecarestudentportal.com encorecarestudentportal.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
lashguyproacademy.com lashguyproacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
leafwingforprofessionals.org leafwingforprofessionals.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
learnabee.com learnabee.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
learncredit.com learncredit.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
learnjam.academy learnjam.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
learnmcas.com learnmcas.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 321 days
learnwithus.ca learnwithus.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 322 days
letterartacademy.com letterartacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
linuxhint.biz linuxhint.biz
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
lookerstudiobible.com lookerstudiobible.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Feb 2024 147 days
lotetreeacademy.com lotetreeacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Oct 2023 189 days
luminouslivingacademy.com luminouslivingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mabusinessuniversity.com mabusinessuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
maconstyles.academy maconstyles.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2024 1 year, 18 days
maestroportillo.com maestroportillo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
magiclab.cl magiclab.cl
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
ddtdetox.com ddtdetox.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mariaraczynska.com mariaraczynska.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 264 days
mdlive.net mdlive.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 15 days
meehanhealthline.com meehanhealthline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
dreamstudiocourse.com dreamstudiocourse.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 14 days
mentalwellbeingacademy.com mentalwellbeingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
metafutureschool.org metafutureschool.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
middleclassmusician.com middleclassmusician.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mindmuscles.academy mindmuscles.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 321 days
herjabb.com herjabb.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 16 days
hish.co hish.co
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
mohab-tech.com mohab-tech.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
moversup.org moversup.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 89 days
mpact.online mpact.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
muakk.tv muakk.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 26 days
musclay.com musclay.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
musichabit.com musichabit.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
musicmasterclasses.be musicmasterclasses.be
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
myfoodmarketing.com myfoodmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
gma.is gma.is
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
ncta.online ncta.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 320 days
drip.vet vin.drip.vet
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
newqi.live newqi.live
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
40wob.com 40wob.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
altenaeducation.com altenaeducation.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
teachable.com manifestitfinesseit.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
vgos.online vgos.online
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
mentesmaestras.org mentesmaestras.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
microblading.tw 21day.microblading.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
expertviz.com expertviz.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
emotionaledu.com emotionaledu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ignitoracademy.com ignitoracademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
cybertrainingpro.com cybertrainingpro.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
itcert2005-online.com itcert2005-online.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
standattuned.au learn.standattuned.au
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
medsy.tr medsy.tr
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
xss0r.store xss0r.store
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
marladelong.com marladelong.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
0cardmastery.com 0cardmastery.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
cadomu.com cadomu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
cgpoly.fr cgpoly.fr
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
ogc2go.com ogc2go.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 27 days
risfastcut.tw course.risfastcut.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
everlastingloveacademy.com everlastingloveacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
incognito.dance incognito.dance
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 4 days
givingnaamwellness.org givingnaamwellness.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
equipu.me equipu.me
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
getreadyforgreatness.com getreadyforgreatness.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
academy-mind-tree-coaching.lu academy-mind-tree-coaching.lu
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
teachable.com marketingcraftbrews.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
kleoly.co.za kleoly.co.za
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
marketpronto.com marketpronto.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
sc.edu.ge sc.edu.ge
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
langchain.site langchain.site
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
chaostocalm.co chaostocalm.co
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
eoslearningcollective.com eoslearningcollective.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
preservethis.org preservethis.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
australian-sports-massage.com australian-sports-massage.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
flippingwheels.com flippingwheels.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
florida-dealer-school.com florida-dealer-school.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
thewco.com.au thewco.com.au
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
ariasprocess.com ariasprocess.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 19 days
blab.academy blab.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
chatarpalarora.com hub.chatarpalarora.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
febreuniversity.com febreuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
fbmusicacademy.com fbmusicacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lilynabil.com lilynabil.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
chefallisonolivia.com courses.chefallisonolivia.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chefxpertise.com leadership.chefxpertise.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chefmcqueenyacademy.com chefmcqueenyacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chau-time.com courses.chau-time.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chemicalengineeringguy.com courses.chemicalengineeringguy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chesswi.com courses.chesswi.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
apprendr.com apprendr.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
childpsychologyworkshops.com.au workshops.childpsychologyworkshops.com.au
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
fpalaunchpad.com fpalaunchpad.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
francescselvaacademy.com francescselvaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chiron-k9.online chiron-k9.online
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
gcdftraining.com gcdftraining.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
churchpianist-traning.com class.churchpianist-traning.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
freelancingfreedom.com freelancingfreedom.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chromasia.com courses.chromasia.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
freemaxpictures.com freemaxpictures.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
hunchocoaching.com hunchocoaching.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chuckgohncoaching.com chuckgohncoaching.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chrismatakas.com classroom.chrismatakas.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
frenchwithkids.com frenchwithkids.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
academiadesupervivencia.com academiadesupervivencia.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
aquariumclass.com aquariumclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Sep 2023 One Off
academiamaquisport.com academiamaquisport.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
luminousheroes.me luminousheroes.me
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
actorsactacademy.com actorsactacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
ghionis.com ghionis.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
luismiranda.com.mx luismiranda.com.mx
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
dementiabydayschool.com dementiabydayschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 8 days
adobe-educa.com adobe-educa.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
m2benterprises.com m2benterprises.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
advanced-academy.com advanced-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 May 2023 One Off
magicalaudios.com magicalaudios.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
fivelensacademy.com fivelensacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
airbrushonlineschool.com airbrushonlineschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
ajmonics.com ajmonics.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 May 2023 One Off
alphatutor.online alphatutor.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
3mranmath.com 3mranmath.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mariaswatercoloracademy.com mariaswatercoloracademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 16 days
marioroberto.tv marioroberto.tv
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
allthingsmathematics.com allthingsmathematics.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 359 days
everythingeboniacademy.com everythingeboniacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
amyscircle.com amyscircle.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
americancrochetassociation.com americancrochetassociation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 1 year, 7 days
arminharris.com arminharris.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
fatherhoodafterdivorce.com fatherhoodafterdivorce.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
maddywestbrook.com maddywestbrook.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mathmanacademy.com mathmanacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
angelchatteracademy.com angelchatteracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 153 days
animeartacademy.com animeartacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
andrewclarkeguitar.com andrewclarkeguitar.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
macrolab.ai macrolab.ai
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
melodieuse.fr melodieuse.fr
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
melodypalace.com melodypalace.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 14 days
artcloud.com.mx artcloud.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
stackskills.com stackskills.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
artmarketacademy.com artmarketacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Nov 2023 296 days
teachable.com aditi-goyal-s-school.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
128academy.com 128academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 79 days
mhtacademy.net mhtacademy.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
figtree.international figtree.international
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
academyhacker.com academyhacker.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
chiropracticmarketinguniversity.com app.chiropracticmarketinguniversity.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
ecomupriseuniversity.com ecomupriseuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ats-hybrid.com ats-hybrid.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mindacademy.me mindacademy.me
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
awelivet.se awelivet.se
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 75 days
ayoubbellabes.com ayoubbellabes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Apr 2023 Oct 2023 191 days
elevatepractices.training elevatepractices.training
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
barnstoneondemand.com barnstoneondemand.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
tmrise.com tmrise.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
basicfilmmakeruniversity.com basicfilmmakeruniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
beabeacon.lgbt beabeacon.lgbt
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 330 days
behavioranalytics.academy behavioranalytics.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
beingman.life beingman.life
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
bellabusinessschool.com bellabusinessschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 225 days
bennett-movement.com bennett-movement.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
bensguitarclub.com bensguitarclub.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Mar 2024 299 days
bestpossibleselfinstitute.com bestpossibleselfinstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bitcademy.org bitcademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 342 days
blackbeltbrokerage.com blackbeltbrokerage.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
blackonboardonline.org blackonboardonline.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 331 days
blendertoprinter.com blendertoprinter.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 321 days
handeyeacademy.com handeyeacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
vnysa.school vnysa.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bibleandworship.com bibleandworship.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
boxcollider.io boxcollider.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
brainacademy.com brainacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
breadcourses.com breadcourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
breadlessons.com breadlessons.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
breemelanson-shop.com breemelanson-shop.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Mar 2024 43 days
brevitycoaching.com brevitycoaching.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
broadwaytowallstreet.com broadwaytowallstreet.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
eteacademy.com eteacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 20 days
buildlivable.com buildlivable.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bulletproofrunners.com bulletproofrunners.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
bushidouniversity.com bushidouniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
businessprotraining.es businessprotraining.es
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 265 days
knxonline.gr knxonline.gr
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
cadmantraining.com cadmantraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
caid.org caid.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Feb 2024 145 days
capitariacursostrading.com capitariacursostrading.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
intellectualpoint-staging.com intellectualpoint-staging.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 10 days
carriemillerpilates.com carriemillerpilates.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
carrytn.com carrytn.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
ccelearn.org ccelearn.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 85 days
cdlpermit.study cdlpermit.study
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
centroestudioshebraicos.com centroestudioshebraicos.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
emilymadillcourses.com emilymadillcourses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chalkright.com chalkright.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
chansam.online chansam.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
charlesandelinacademy.com charlesandelinacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
christianlearning.com christianlearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 326 days
korecekocun.com korecekocun.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
montessori4moms.com montessori4moms.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
ecodehacker.com ecodehacker.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ead.tv ead.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 326 days
ealim.org ealim.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Feb 2024 146 days
greenfirstacademy.com greenfirstacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 316 days
fullstacklibrary.com fullstacklibrary.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
funatsumari-beautyacademy-onlineschool.com funatsumari-beautyacademy-onlineschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 151 days
gageacademy.net gageacademy.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
gamejamschool.com gamejamschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
gamethinkingacademy.com gamethinkingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
gbdcollege.com gbdcollege.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
geigerandspence.com geigerandspence.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
genco.school genco.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
muslimfamilyacademy.com muslimfamilyacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
muskyacademy.com muskyacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
gestationaldiabetescourse.com gestationaldiabetescourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
gigrocket.com gigrocket.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 297 days
glamaway.ca glamaway.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
googleadwordstutorial.com googleadwordstutorial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 321 days
govkidmethod.com govkidmethod.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
graphneuralnets.com graphneuralnets.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
groove2day.com groove2day.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 262 days
gsk-edu.com gsk-edu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 88 days
gymcademy.com gymcademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
hackyourbrainwithnlp.com hackyourbrainwithnlp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 25 days
derekbiggs.com derekbiggs.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
highticketelites.com highticketelites.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
hijamanationacademy.com hijamanationacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
hiswordhealstoday.net hiswordhealstoday.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
plataformaescuelasvisuales.com plataformaescuelasvisuales.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 5 days
itmasterkey.com itmasterkey.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
howtofreedive.com howtofreedive.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 358 days
hsbnschool.org hsbnschool.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Mar 2024 275 days
htdezignschool.com htdezignschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
azstocktrade.com azstocktrade.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
makeitlabacademy.com makeitlabacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
islamabuauf.com islamabuauf.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
istudyjapanese.com istudyjapanese.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
itakelessons.com itakelessons.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 39 days
ithahu.com ithahu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
jfdeducation.com jfdeducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
learnhowtotrades.com learnhowtotrades.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 11 days
deeperbiblecollege.com deeperbiblecollege.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
microempresarial.com microempresarial.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
justudy.co.il justudy.co.il
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
learnyourdrink.com learnyourdrink.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
kamalaleslie.com kamalaleslie.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
keyconceptsinstitute.com keyconceptsinstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
khasang.io khasang.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
bookkeepingfortheentrepreneur.com bookkeepingfortheentrepreneur.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
kimmunity.com.au kimmunity.com.au
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
kitdaletraining.com kitdaletraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 272 days
kkcreditacademy.org kkcreditacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
kkxuniversity.com kkxuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 19 days
korzat.net korzat.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Aug 2023 Mar 2024 214 days
creativeshandbook.io creativeshandbook.io
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
french4me.net french4me.net
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
jordancanova.com jordancanova.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 223 days
lapharmacie-coaching.com lapharmacie-coaching.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 11 days
kafx.org kafx.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 18 days
justbeachystudio.club justbeachystudio.club
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
katiesisk.com katiesisk.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Nov 2023 One Off
kevinfoong.co kevinfoong.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2023 74 days
khadijaacademy.com khadijaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
kinbaku-academy.com kinbaku-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 26 days
kitsapstrongconsulting.com kitsapstrongconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 May 2023 124 days
knittinginenglish.com knittinginenglish.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
koimartialart.com koimartialart.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
krvalues.com krvalues.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
laboratoriodemovimiento.com laboratoriodemovimiento.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
laescueladepealpan.com laescueladepealpan.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Nov 2023 182 days
episcopal.education episcopal.education
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 2 days
futurioncollege.com futurioncollege.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
espabilaeinvierte.com espabilaeinvierte.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
landlordcert.org landlordcert.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 324 days
latindanceonline.com latindanceonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
latindanceshop.com latindanceshop.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Feb 2024 149 days
launch-well.com launch-well.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mpe4prep.com mpe4prep.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lead2flow.nl lead2flow.nl
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
leadgenacademy.courses leadgenacademy.courses
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
leadinforce-academy.com leadinforce-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 325 days
league-of-elites.com league-of-elites.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 1 year, 4 days
learndataengineering.com learndataengineering.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 262 days
learnfengshui.co.uk learnfengshui.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
learning-bytes.com learning-bytes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 25 days
learnthecut.com learnthecut.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
letityoga.it letityoga.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
letslearnthistogether.com letslearnthistogether.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
letspaintflowers.com letspaintflowers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 319 days
letsrecover.co.uk letsrecover.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
levelupmvmt.com levelupmvmt.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
linglongchinese.com linglongchinese.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 327 days
literacytolife.com literacytolife.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
liveyourheartout.academy liveyourheartout.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
loogguitarschool.com loogguitarschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
loripalmquist.com loripalmquist.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 265 days
lydiafernandes.com lydiafernandes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Mar 2024 159 days
firstresponderacademy.ca firstresponderacademy.ca
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
marcelacabrejos.com marcelacabrejos.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
masterfulpainting.com masterfulpainting.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
mazori.com mazori.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
medix.education medix.education
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
andreiikim.ro andreiikim.ro
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
missionfx.us missionfx.us
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
mocktrialky.com mocktrialky.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
mojoversity.com mojoversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
momsquest.org momsquest.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
alist.com.hk alist.com.hk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 14 days
mrotterstudio.com mrotterstudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 322 days
alyshajamesacademy.com alyshajamesacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
makeupfromscratchacademy.com makeupfromscratchacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 273 days
bdsl.courses bdsl.courses
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
learnzonemedia.co.uk learnzonemedia.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
exploreai.org exploreai.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
heroicfm.com heroicfm.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
dronecoach.asia dronecoach.asia
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
feltonmusicschool.com feltonmusicschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
capitellefinance.com capitellefinance.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
kidsyoga.tw class.kidsyoga.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
frenchdialogs.com frenchdialogs.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ehati.education ehati.education
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
isydk.com isydk.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
enjoyingenglish.ca enjoyingenglish.ca
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
joyfulmatchingforyou.com joyfulmatchingforyou.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
novel.academy novel.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
eda-study.com eda-study.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
teachable.com keolafit.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mackpo.com mackpo.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
mncourses.com mncourses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
fit-for-life-toneathomefitness.com fit-for-life-toneathomefitness.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
asemsecuritymultiservice.com asemsecuritymultiservice.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
effectiveelearningpractices.com effectiveelearningpractices.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
dangerousgoodstrainingonline.com dangerousgoodstrainingonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 13 days
dhejobusinesscoach.com dhejobusinesscoach.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
jostai.com jostai.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
tina.tw courses.tina.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lsreei.com lsreei.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
marketmakersny.com marketmakersny.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
cei-ph.com cei-ph.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
dounia-s-school.xyz dounia-s-school.xyz
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
pitec.la pitec.la
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 16 days
informationinyiddish.com informationinyiddish.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
forestrock.com forestrock.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
3chrz.com 3chrz.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ptype.academy ptype.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2024 1 year, 25 days
escapewith.us escapewith.us
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 7 days
damiancejas.com damiancejas.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mbxax.school mbxax.school
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
thecmu.com thecmu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
eyesopenacademy.com eyesopenacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
dogsconnectmentorship.com dogsconnectmentorship.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 14 days
wsc22.com wsc22.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
modernherbalacademy.com modernherbalacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
kirkeneshundesenter.no kirkeneshundesenter.no
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
changethebrief.org alliance.changethebrief.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
homebakingcroissant.com homebakingcroissant.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chattypenguin.com courses.chattypenguin.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
escuelaaudiovisual.com escuelaaudiovisual.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ziptraderu.com ziptraderu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
dougtempleton.com dougtempleton.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chau-time.com masterclass.chau-time.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
cheministry.online courses.cheministry.online
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
cherylportermethod.com course.cherylportermethod.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
ilmonlineclasses.com ilmonlineclasses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chessuniversity.com courses.chessuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
focus5online.com focus5online.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
chineseheritage.co.uk courses.chineseheritage.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chisaxonlinecourse.com masterclass.chisaxonlinecourse.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
daretolivecoaching.com daretolivecoaching.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chocolatesommelierschool.org chocolatesommelierschool.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chilleracademy.com chilleracademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
fpp-academy.com fpp-academy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chinableacademy.com course.chinableacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
excelspeedwork.com excelspeedwork.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
christianwritersinstitute.com learn.christianwritersinstitute.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
christinabrown.com courses.christinabrown.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chronichope.us chronichope.us
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
lets3dsmax.com lets3dsmax.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
christiancompliancetraining.com christiancompliancetraining.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chutzpah101.com chutzpah101.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
robertbakerguitar.com robertbakerguitar.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 23 days
classicalguitar-pro.com classicalguitar-pro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
abraham-education.com abraham-education.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
lloydpestuniversity.com lloydpestuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
academiasemagro.com academiasemagro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 327 days
joynyabongo.com joynyabongo.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
actualiseacademy.com actualiseacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
saguto.golf saguto.golf
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 20 days
click-and-learn.fr click-and-learn.fr
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
freetobewell.com courses.freetobewell.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
cielacademy.com cielacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
atmavida.com atmavida.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
dynamiclanguages.org dynamiclanguages.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
arlansacademy.com arlansacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 362 days
onethirtyseven.org courses.onethirtyseven.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
manaterapija.lv manaterapija.lv
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 2 days
alselectronicclassroom.com alselectronicclassroom.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
manifestationsacademy.com manifestationsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 2 days
alignyourselftosuccessacademy.com alignyourselftosuccessacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
alexhitt.com alexhitt.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 27 days
alivewithyogaonline.com alivewithyogaonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
embedded-coaching.com embedded-coaching.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
elearningfrei.ch elearningfrei.ch
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 8 days
joskeadconsulting.com joskeadconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
amzbusinesssociety.com amzbusinesssociety.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
db-musicacademy.com db-musicacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 13 days
americancraftsmanshopclass.com americancraftsmanshopclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
ametsuchi-dojo.org ametsuchi-dojo.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
drcalinpop-online.com drcalinpop-online.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
digitalecommentor.com digitalecommentor.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
animalcentrededucation.com animalcentrededucation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
anneorteleecourses.com anneorteleecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Feb 2024 258 days
delightcareer.pl delightcareer.pl
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
aprendicesvisuales.com aprendicesvisuales.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
aptly.co aptly.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Feb 2024 143 days
medicinemusicschool.com medicinemusicschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
imsourceacademy.com imsourceacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 16 days
artisanbakingcenter.com artisanbakingcenter.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
melissakellettart.com.au melissakellettart.com.au
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
superstar.tw master.superstar.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
botoxbootcamp.com botoxbootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
citrixhero.com learn.citrixhero.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
101value.net 101value.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
stoneriverelearning.com stoneriverelearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mhutradingacademy.com mhutradingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
aashishacademy.com aashishacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 28 days
academiadeimpacto.com academiadeimpacto.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
academyrichcopy.com academyrichcopy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
mikemillertechguide.com mikemillertechguide.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
talmid.me talmid.me
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
autoimmunetribecourses.com autoimmunetribecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 23 days
mindpowersports.com mindpowersports.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
aviationgroundschoolsonline.com aviationgroundschoolsonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
awesomepeopleleaders.com awesomepeopleleaders.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
theacl.club theacl.club
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
babilanka.com babilanka.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
mingxin.one mingxin.one
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
banzenkanacademy.com banzenkanacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
atomicmauniversity.com atomicmauniversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 20 days
ministrytrainingnow.com ministrytrainingnow.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
beautymarketingacademy.com beautymarketingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
beginnertomastery.com beginnertomastery.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2023 75 days
behaviorcompassacademy.com behaviorcompassacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 333 days
benshorts.com benshorts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bettertradingportal.com bettertradingportal.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
bewusstes-golf.academy bewusstes-golf.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 222 days
bgcacademy.com bgcacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
billionplg.com billionplg.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
bizimkimyamiz.com bizimkimyamiz.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
darrenenglish.com darrenenglish.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 13 days
blackbusinessu.com blackbusinessu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
blessedtosell.com blessedtosell.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 25 days
gut-ed.com gut-ed.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
vidyapitha.in vidyapitha.in
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bluelight.academy bluelight.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
vmat.edu.vn vmat.edu.vn
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
bodyart.training bodyart.training
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
codervox.com codervox.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
viciu.com viciu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
bscholarshipclass.com bscholarshipclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Jan 2024 One Off
buddytutorial.com buddytutorial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 323 days
mi-courses.com learn.mi-courses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
bumpintoosteo.com.au bumpintoosteo.com.au
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Feb 2024 336 days
globalmarketingcollege.com globalmarketingcollege.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
bvotaekwondo.com bvotaekwondo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Mar 2024 305 days
cactus-school.online cactus-school.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
canadianlaserinstitute.ca canadianlaserinstitute.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
capacitypluscourse.com capacitypluscourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
cardandcraftacademy.com cardandcraftacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 19 days
carlottacastangiayoga.com carlottacastangiayoga.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
catalystartlab.com catalystartlab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
caveofprogramming.com caveofprogramming.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
celldreameracademy.com celldreameracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
drbgroupltd.com drbgroupltd.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
cempschool.com cempschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
ceusforteachers.com ceusforteachers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 89 days
chabakatarab.com chabakatarab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
championsofinfluence.com championsofinfluence.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
chartslogic.com chartslogic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
modality.academy modality.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
theblackbusinessschool.com theblackbusinessschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
moirasdeschool.com moirasdeschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
codebh.fr codebh.fr
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Mar 2024 249 days
mokalemaacademy.com mokalemaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
digitalzaa.shop digitalzaa.shop
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
akasun.co.uk akasun.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 7 days
criticalthinkeracademy.com criticalthinkeracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 24 days
moneythingacademy.com moneythingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
moonbodytemple.com moonbodytemple.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
edu-vietkieu.com edu-vietkieu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
easyt.online easyt.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 361 days
eltjam.academy eltjam.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
essentielsduconseillerenvoyages.ca essentielsduconseillerenvoyages.ca
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
moveshapesschool.com moveshapesschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
fitsitclasses.com fitsitclasses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
goldeneggsfertility.com goldeneggsfertility.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
lifewealthcourses.com lifewealthcourses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 11 days
filmsimplified.com filmsimplified.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Sep 2023 261 days
gadha.ae gadha.ae
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
garyscourse.com garyscourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 22 days
getpublishedcourse.com getpublishedcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
hackingmaang.com hackingmaang.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
artisanfounder.com academy.artisanfounder.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
levelupwarrior.com levelupwarrior.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mwwinstitute.org mwwinstitute.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
glowforgeforbeginners.com glowforgeforbeginners.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
gmalasereducation.com gmalasereducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 35 days
godpreneuracademy.com godpreneuracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
gothink.tv gothink.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 321 days
mydigitalagencyonlineacademy.com mydigitalagencyonlineacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
graebert.academy graebert.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Mar 2024 5 days
importadoresconectados.com importadoresconectados.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 19 days
greatgutguide.com greatgutguide.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
greverbalcourse.com greverbalcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
gsaacademy.com gsaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
guitarinstitute.it guitarinstitute.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
guitarmy.net guitarmy.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
hackersacademy.ca hackersacademy.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 265 days
haleyramsey.com haleyramsey.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2023 One Off
happybackyoga.com happybackyoga.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 67 days
mynlptraining.com mynlptraining.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
myoliftce.com myoliftce.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
harmony-life-academy.com harmony-life-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 1 day
homeschoolbuyer.com homeschoolbuyer.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
educoatti.com educoatti.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
laeruniversity.com laeruniversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
howsongsaremade.com howsongsaremade.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 265 days
hrponlinelearning.com hrponlinelearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
humain360.com humain360.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
huntingcamp.live huntingcamp.live
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
idsei.com idsei.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
itherapist-seitai.com itherapist-seitai.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 16 days
corrozone.co.uk corrozone.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
istitutolavoro.net istitutolavoro.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
iteachone.org iteachone.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 333 days
jessicacere.com jessicacere.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
jgaitpro.com jgaitpro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
jlglobaltech.com jlglobaltech.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Nov 2023 247 days
jobbsokerkoden.no jobbsokerkoden.no
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
joinmeetkevin.com joinmeetkevin.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
formadoresexpertos.com formadoresexpertos.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
cheerfulstrength.net online-offerings.cheerfulstrength.net
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
johncrickett.me johncrickett.me
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
faucettemedia.com faucettemedia.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chesterton.online chesterton.online
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
foxland.ro foxland.ro
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chicreatives.com.tw school.chicreatives.com.tw
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
frankieflanagan.com frankieflanagan.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
elmetodo513.com elmetodo513.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
francaisavecfred.com francaisavecfred.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
freelstep.com freelstep.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
chriswright.photography courses.chriswright.photography
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
churchillcourses.com churchillcourses.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
freelancetax.de freelancetax.de
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
freedomtraders.in freedomtraders.in
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
fluentmedic.co fluentmedic.co
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
livecopilot.com courses.livecopilot.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 24 days
discoverasl.com discoverasl.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
acadegenius.co.uk acadegenius.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2023 One Off
activcaretraining.com activcaretraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
infosecschool.net infosecschool.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mbuzz.fr mbuzz.fr
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
lrnaudio.sk lrnaudio.sk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
sagelogica.com sagelogica.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
lumierevirtual.com lumierevirtual.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
eden-smart.academy eden-smart.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
embakify.com embakify.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
advancedalignertraining.com advancedalignertraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
enhancedignite.com enhancedignite.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
agaartstudioclasses.com agaartstudioclasses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
aircraftprofit.com aircraftprofit.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 39 days
makingsocialwaves.com makingsocialwaves.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 1 day
alqamiedu.com alqamiedu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 17 days
fretcraftmusic.com fretcraftmusic.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
algoaddict.com algoaddict.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 266 days
machicuradigital.com machicuradigital.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
algopro.ai algopro.ai
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 359 days
marketingmastery.jp marketingmastery.jp
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
marriagefunshop.com marriagefunshop.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 23 days
fbamasteryprogram.com fbamasteryprogram.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
cipskills.com cipskills.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
amazonmokymai.lt amazonmokymai.lt
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
dukeweb3.com dukeweb3.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
icanlearnnow.com icanlearnnow.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lamat.fi lamat.fi
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
skilly.co.il skilly.co.il
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 89 days
artoflivingwell.org.uk artoflivingwell.org.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 323 days
artofyoubellydance.com artofyoubellydance.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 1 year, 8 days
cipraniconsulting.com courses.cipraniconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
anywherestartup.com anywherestartup.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 22 days
edityourlandscapes.com edityourlandscapes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 21 days
maxamedcabdullaahi.com maxamedcabdullaahi.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
anjayamajiart.com anjayamajiart.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 32 days
maypiano.me maypiano.me
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mazequest.org mazequest.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
enjoyrealenglish.com enjoyrealenglish.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Apr 2023 Mar 2024 327 days
apegcommunity.com apegcommunity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
ivyleagueprofitsacademy.com ivyleagueprofitsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mekademien.se mekademien.se
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
appbrewery.com appbrewery.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
entrepreneurtraining.education entrepreneurtraining.education
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mgeteam.training mgeteam.training
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
abdulacademy.com abdulacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 328 days
academiaimperial.com academiaimperial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
academiatrencadis.com academiatrencadis.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
citychanger.org courses.citychanger.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
academy-chiekoegged.com academy-chiekoegged.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
cityhallessentials.com courses.cityhallessentials.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
inkaeticaret.com inkaeticaret.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
aliboucoding.com aliboucoding.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 90 days
aprendecontabella.com aprendecontabella.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
assessport-academy.com assessport-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
luzinterior.com.mx luzinterior.com.mx
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
frome2p.com frome2p.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
tetmo.com tetmo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
dkschoolofhypnosis.com dkschoolofhypnosis.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
feldenkrais-akademie.com feldenkrais-akademie.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
thb.academy thb.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
axtonliu.ai axtonliu.ai
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
azlansensei-e-learning.com azlansensei-e-learning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
baileylineroadlearning.com baileylineroadlearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
agileprojectmanagementacademy.com agileprojectmanagementacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
baytalmosawer.online baytalmosawer.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
befit4akhirah.com befit4akhirah.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
bellpianopopcourseonline.com bellpianopopcourseonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
benatural.com.sg benatural.com.sg
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
benjajap.com benjajap.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
benlevinmusicschool.com benlevinmusicschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
algo-academy.com algo-academy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
beyondtheboxacademy.com beyondtheboxacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 345 days
billhelmtuina.com billhelmtuina.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
billyphillips.com billyphillips.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
fflhnwbootcamp.com fflhnwbootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
bitwisecourses.com bitwisecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
blackexpertsempire.com blackexpertsempire.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
blendeducation.org blendeducation.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
blockchainbloom.com blockchainbloom.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 26 days
betterbakingschool.com betterbakingschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bloggingbootcamp.com bloggingbootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
boarddirectortraining.com boarddirectortraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bobbielyonscaninecampus.com bobbielyonscaninecampus.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
boldexpressivepaintingworkshops.com boldexpressivepaintingworkshops.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
borderstatesecuritytraining.com borderstatesecuritytraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
brainery.io brainery.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bravobellabras.com bravobellabras.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 84 days
breakthroughfreelancing.com breakthroughfreelancing.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
edu-server.com edu-server.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
brokentobalanced.com brokentobalanced.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 89 days
budeducation.com budeducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
businessprofitimprovementplan.com businessprofitimprovementplan.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 25 days
bynadiablanco.com bynadiablanco.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
cafezinhobrasileiro.com cafezinhobrasileiro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mlacases.com mlacases.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
cameducation.co.uk cameducation.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 9 days
campus-ateneojazz.com campus-ateneojazz.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 27 days
campus-ribas.com campus-ribas.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
campusparentesis.com campusparentesis.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 90 days
canopy.games canopy.games
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
cuddlefishacademy.com cuddlefishacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
casasdeoracion.online casasdeoracion.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
catherineedwardsacademy.com catherineedwardsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
centering.life centering.life
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
malikrezzoug.com codeveloppement.malikrezzoug.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 15 days
cfoo-education.com cfoo-education.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
changewithcolleen.com changewithcolleen.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Mar 2024 5 days
everybodyplayguitar.com everybodyplayguitar.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
millenniumfinancialuniversity.com millenniumfinancialuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
creator.school creator.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
empoweredplayconnections.com empoweredplayconnections.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
drpi.hr drpi.hr
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
gulfvatacademy.com gulfvatacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 3 days
devs.online devs.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 348 days
eddieoneillsonlineschool.com eddieoneillsonlineschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 12 days
dropshippingtitans.com dropshippingtitans.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 16 days
mosaicartsonline.com mosaicartsonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 13 days
globalriskacademy.com globalriskacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
encafe.org encafe.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
teachable.com fotograevepro.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
teachable.com movesmade4me.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mrphysio.net mrphysio.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
mrphysio.com.au mrphysio.com.au
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
dapinstitute.com dapinstitute.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
fscourses.com fscourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 321 days
gaeilgelejane.com gaeilgelejane.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
educatedbye.com educatedbye.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 14 days
gateway.university gateway.university
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 26 days
gavinlund.co.za gavinlund.co.za
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 78 days
getoffyouracidacademy.com getoffyouracidacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2023 71 days
gettingguru.com gettingguru.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mographmentor.com mographmentor.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
globalcte.com globalcte.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
globalneurosurgicalalliance.com globalneurosurgicalalliance.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Aug 2023 Mar 2024 214 days
mavericktradingacademy.io mavericktradingacademy.io
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
gonego.co gonego.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 25 days
greenzebra.online greenzebra.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
gregoryblumberg-bootcamp.com gregoryblumberg-bootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2023 77 days
griffinandbellvision.com griffinandbellvision.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
growonthreads.com growonthreads.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 227 days
guitarensemblemethod.com guitarensemblemethod.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
guitarlessons.nyc guitarlessons.nyc
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
guitarpass.com guitarpass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 20 days
croblastoff.com croblastoff.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
teachable.com talk-your-way-to-effective-communication.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
harmonyhorsemanshipacademy.org harmonyhorsemanshipacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 1 year, 12 days
healthiveacademy.com healthiveacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
sd4ba.com sd4ba.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 14 days
mysuccessblueprints.com mysuccessblueprints.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
highlevelknowledge.com highlevelknowledge.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
holistichealthblueprint.com holistichealthblueprint.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 142 days
giorgiateodori.it academy.giorgiateodori.it
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
homeofsound.co.uk homeofsound.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
houseofyogavirtual.com houseofyogavirtual.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 88 days
human-insight-academy.com human-insight-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
hypnosis-institute-mariani.com hypnosis-institute-mariani.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2024 1 year, 13 days
makemoneybeingfunny.net makemoneybeingfunny.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 1 day
iyengaronline.it iyengaronline.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
jamespang-tutorial.com jamespang-tutorial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 27 days
jmguitarlessons.com jmguitarlessons.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
jorgemochon.academy jorgemochon.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 262 days
jptnailacademy.com jptnailacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
makeupbynimoh.com makeupbynimoh.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 1 day
juniorycarolina.com juniorycarolina.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 266 days
inspiredwordteaching.org inspiredwordteaching.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Mar 2024 40 days
kidzygo.com kidzygo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 86 days
greenatelier.art greenatelier.art
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
insiderlessons.com insiderlessons.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Feb 2024 148 days
knxacademy.com knxacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
kodikaitradescourse.com kodikaitradescourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 263 days
kyle.care kyle.care
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
ladyesha.com ladyesha.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 350 days
theecontutor.com theecontutor.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
koreanwithhannah.com koreanwithhannah.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lauraandscott.com lauraandscott.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
lawofattractionaccelerator.com lawofattractionaccelerator.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
leadingedgedogshowacademy.com leadingedgedogshowacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 1 year, 8 days
leadingedgegroomingacademy.com leadingedgegroomingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
learningritual.com learningritual.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 320 days
learnthemagicofpaper.com learnthemagicofpaper.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 327 days
jpusgifted.com jpusgifted.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lizscullytraining.com lizscullytraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Feb 2024 333 days
arteriacademy.com arteriacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 8 days
effectiveelearningpractice.com effectiveelearningpractice.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
loonextrading.com loonextrading.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
loveyourbusinessschool.com loveyourbusinessschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
loyallactation.com loyallactation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
explaineracademy.com explaineracademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
markethustleacademy.com markethustleacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 22 days
mastersinlife.com mastersinlife.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
mentefeliz.org mentefeliz.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 84 days
mentorship.one mentorship.one
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
metodofourstartup.com metodofourstartup.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
eflcurriculum.com eflcurriculum.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
mindrenewalschool.com mindrenewalschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Oct 2023 117 days
mitchellandstones.academy mitchellandstones.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 95 days
mongymenligne.com mongymenligne.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
cib.team cib.team
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
fac.tokyo fac.tokyo
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
luminousheroes.com luminousheroes.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
maaaxterenglish.com maaaxterenglish.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
myfoodsafetytutor.com myfoodsafetytutor.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2023 One Off
myquitguide.com myquitguide.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
managementdose.com managementdose.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
managingqs.com managingqs.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 1 day
netecdigital.com netecdigital.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 16 days
clti.ca clti.ca
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
dancedoctoronline.com dancedoctoronline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 7 days
kevinwallacejrschool.com kevinwallacejrschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
digital-trails.academy digital-trails.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
longtermcompliance.info longtermcompliance.info
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
guitarinvadersacademy.net guitarinvadersacademy.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 12 days
teachable.com great-gut-guide.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
jdconsultingau.com jdconsultingau.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
java-mastery.com java-mastery.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ahido.co.uk ahido.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
earningyourownincome.com earningyourownincome.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 6 days
confidencecurrency.co confidencecurrency.co
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
eg-tv.com eg-tv.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
peakhd.net peakhd.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
thefmc.ie thefmc.ie
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
eduvietkieu.com eduvietkieu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
balticnetworkstraining.com balticnetworkstraining.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
oonee.net oonee.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
eskills.academy eskills.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
2-days.website 2-days.website
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
allaprimaacademy.com allaprimaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
anatma.com.mx anatma.com.mx
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
interventionacademy.com interventionacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
hazlotu.work hazlotu.work
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
synchroshaktiacademy.com synchroshaktiacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
embodiedwoman.com embodiedwoman.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mayinedevelopmentcourses.com mayinedevelopmentcourses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
canine.school.nz canine.school.nz
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
guitarist-al.com guitarist-al.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
cpaweb.co.uk cpaweb.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
hub-amitsoni.com hub-amitsoni.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
johnsconnect.com johnsconnect.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
guidedglow.com guidedglow.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
3arabica.com 3arabica.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
opx360.com opx360.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bigdataenergycourses.com bigdataenergycourses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
datawithjack.com datawithjack.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
gfcourse.com gfcourse.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
makeappsacademy.com makeappsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
soilpd.com soilpd.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
doitpaperschool.com doitpaperschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mindfulstudio.com.tr mindfulstudio.com.tr
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
planancial.com planancial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
simplelearn.tw online.simplelearn.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
internationalwellbeingacademy.com internationalwellbeingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
easynursingcourses.com easynursingcourses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
prop.academy prop.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
itsgoodmaterial.com classes.itsgoodmaterial.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
usaiif.com usaiif.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
ecomcopycrashcourse.com ecomcopycrashcourse.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
fuerteaerialfitness.com fuerteaerialfitness.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
fretsfordays.com fretsfordays.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
alchemycodeu.com alchemycodeu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
design-your-future.de academy.design-your-future.de
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 8 days
ahmed-fitness.com ahmed-fitness.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 21 days
formationcryptoquebec.com formationcryptoquebec.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
formerinsider.com formerinsider.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
forstehjelpbarn.no forstehjelpbarn.no
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
investishare.com investishare.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
developmentisland.com developmentisland.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
itm-online.com itm-online.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chiforce.com learn.chiforce.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
childocd.net childocd.net
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
learnfluentenglish.academy learnfluentenglish.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
chinasyohoujp.com edu.chinasyohoujp.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
giraffemoves.com giraffemoves.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
esadsaglamakademi.com esadsaglamakademi.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
chriscapehart.co school.chriscapehart.co
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
indemandspeaking.com indemandspeaking.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 7 days
christinechengacademy.com course.christinechengacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
freelancemastery.dev freelancemastery.dev
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
christophertodd.com pets.christophertodd.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
familysuccessacademy.com familysuccessacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
emedstudy.com emedstudy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
infinitemusician.com infinitemusician.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 10 days
droneadventurermasterclass.com droneadventurermasterclass.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 8 days
academyofpurpose.org academyofpurpose.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
financialelevationcourses.com financialelevationcourses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ciberconscientes.com mision.ciberconscientes.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
flowersandassociates.courses flowersandassociates.courses
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
academiadeamorpropio.com academiadeamorpropio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 89 days
actorsspark.com actorsspark.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
findhopeingod.org findhopeingod.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
embakeify.com embakeify.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
churchosonline.com experience.churchosonline.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
advanced-plc.com advanced-plc.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
cierralaventaa.com cierralaventaa.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
metodotamash.com metodotamash.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
muzo.id muzo.id
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
allen-bradley-plc-training.com allen-bradley-plc-training.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
ashleymethodedu.com ashleymethodedu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
alflow.net alflow.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
integratedmeditationacademy.com integratedmeditationacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
erdensclub.com erdensclub.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
amazoninterviewwhizzacademy.com amazoninterviewwhizzacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 265 days
ecole-du-web.net ecole-du-web.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 14 days
egindicators.org egindicators.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
mastersoftheplayground.com mastersoftheplayground.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
masterxclass.com masterxclass.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 17 days
futureeducationacademy.co.uk futureeducationacademy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
circusanatomy.com circusanatomy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
maximatics.com.au maximatics.com.au
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
drivesafewi.com drivesafewi.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
aurethia.com aurethia.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
friosmarketing.com friosmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
howtowingrants.com howtowingrants.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
meditorium.in meditorium.in
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
escueladirecta.com escueladirecta.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
accademiamassaggioanimale.com accademiamassaggioanimale.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 8 days
citychanger.org coaching.citychanger.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
jonyquiroz.net jonyquiroz.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
businesseducationelearning.com businesseducationelearning.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
alardaacademy.com alardaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
amigoscode.com amigoscode.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 264 days
aquestacademy.com aquestacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
archerymasterclass.com archerymasterclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
dfpworkshops.com dfpworkshops.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
audiencegrowers.com audiencegrowers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
aviatorcloud.com aviatorcloud.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
avidbeer.com avidbeer.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
mindsetmasteryschool.com.au mindsetmasteryschool.com.au
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
ayam-es.education ayam-es.education
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 19 days
ayam.education ayam.education
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 22 days
ayunizate.com ayunizate.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
badassbusinessownerlearningcenter.com badassbusinessownerlearningcenter.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Apr 2023 79 days
energybreathmovement.com energybreathmovement.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
beabettercommunicator.com beabettercommunicator.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
bedrockuniversity.com bedrockuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
benchmarkingpluscourse.com benchmarkingpluscourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
beyondthefringecourses.com beyondthefringecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bharatvidya.in bharatvidya.in
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
bigplansacademy.com bigplansacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 45 days
bigtechmentor.com bigtechmentor.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
biobaliainstituteschool.org biobaliainstituteschool.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
biologycarol.co.uk biologycarol.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 89 days
bitcoininsider.io bitcoininsider.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 328 days
blockyfi.org blockyfi.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 84 days
bluespire.com bluespire.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 106 days
boardingschoolbasics.com boardingschoolbasics.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
boldfuture.me boldfuture.me
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
boldstep.fr boldstep.fr
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Mar 2024 270 days
focuspreneuracademy.com focuspreneuracademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
braindeadsimplecopy.com braindeadsimplecopy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
brainiate.academy brainiate.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
brainpilot.com.au brainpilot.com.au
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
brandster.com.br brandster.com.br
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
breakfreefromskinpicking.com breakfreefromskinpicking.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
buildingchildcareprofessionals.com buildingchildcareprofessionals.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 329 days
bunniespro.com bunniespro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
butchercraft.com butchercraft.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
calvarydiscipleshiponline.org calvarydiscipleshiponline.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
camillamichettiyoga.com camillamichettiyoga.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 331 days
campusdocente.net campusdocente.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
caninescience.online caninescience.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
cardmakingschool.com cardmakingschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
casamaestraonline.com casamaestraonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
cathrinmanningevents.com cathrinmanningevents.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 92 days
cdb-university.com cdb-university.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 337 days
ceevirtual.com ceevirtual.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
diyschoolofmusic.com diyschoolofmusic.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 13 days
center4dignity.com center4dignity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
champcademy.com champcademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Jan 2024 One Off
edgecate.com edgecate.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 332 days
ecomadsassault.com ecomadsassault.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 14 days
coffeebreakacademy.com coffeebreakacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
lifestylemedicinesolutions.org lifestylemedicinesolutions.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
momentummxonline.com momentummxonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
fcsoftballschool.com fcsoftballschool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
marcozanoniacademy.it marcozanoniacademy.it
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
deallawyerhq.com deallawyerhq.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 21 days
litprog.net litprog.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 19 days
armataraechandran.com armataraechandran.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 19 days
emotionalhelpcr.com emotionalhelpcr.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 9 days
modernshiatsu.com modernshiatsu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 12 days
douus.com douus.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
ecomsecretsacademy.com ecomsecretsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
eedu.online eedu.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 262 days
traego.com.mx academy.traego.com.mx
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 9 days
7natee.com 7natee.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 27 days
faber.academy faber.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
femalemusicianacademy.com femalemusicianacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
escuelacoyotipi.com escuelacoyotipi.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 2 days
fullyfundedmissionary.org fullyfundedmissionary.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 32 days
furniturecourse.com furniturecourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 17 days
futureofpeople.academy futureofpeople.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
geography-lounge.com geography-lounge.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
gettingtotheprofits.com gettingtotheprofits.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 333 days
ghirasalaqeeda.com ghirasalaqeeda.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mvclogisticsacademy.com mvclogisticsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
mdxelearning.com mdxelearning.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
globalsisterhoodschool.org globalsisterhoodschool.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
gnyanasangha.com gnyanasangha.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 265 days
mycampusvirtual.com mycampusvirtual.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 26 days
goldtraining.it goldtraining.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 86 days
gonefreeflying.com gonefreeflying.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 32 days
ibjja-online.com ibjja-online.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
grammar.cool grammar.cool
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 45 days
graphologyonline.com graphologyonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 341 days
gregorylandsmancourses.com gregorylandsmancourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
gregorylandsmantreatments.com gregorylandsmantreatments.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
gwctlearning.com gwctlearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
habits.ae habits.ae
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
godglamgoalsglobal.academy godglamgoalsglobal.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
hairretailersacademy.com hairretailersacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
fsboman.com fsboman.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
cursosclara.com cursosclara.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
healthphysics.academy healthphysics.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
heartmaps.com heartmaps.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 333 days
hedacademy.fr hedacademy.fr
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 1 year, 9 days
heylegal.co.uk heylegal.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
hiddengemconsulting.com hiddengemconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 320 days
lylsecrets.com lylsecrets.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
houseofanthonyelle.com houseofanthonyelle.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
houseofwhite.net houseofwhite.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
hrwebsource.com hrwebsource.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
impactfreepreview.com impactfreepreview.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
itacademytraining.com itacademytraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
jaynespencerwatercolor.com jaynespencerwatercolor.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
jettrades.net jettrades.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
jobvise.net jobvise.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
avaniparenting.com avaniparenting.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 13 days
journeyintofascia.com journeyintofascia.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Jan 2024 One Off
juliaacademy.com juliaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
jumpstartitacademy.com jumpstartitacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 42 days
disruptionu.com disruptionu.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
aptechjourneymanprep.com aptechjourneymanprep.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
kaariprehab.com kaariprehab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
kabbalahbyheart.com kabbalahbyheart.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
kalendoleman.com kalendoleman.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2023 One Off
kalicurriculum.com kalicurriculum.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
kazoneonline.com kazoneonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 330 days
ken-rea.com ken-rea.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 151 days
kimkatglass.com kimkatglass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 40 days
kindlestartup.academy kindlestartup.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
knowledgette.com knowledgette.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 48 days
learn-ikigai.com learn-ikigai.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 4 days
kodigitalstudio.com kodigitalstudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 43 days
kodlama.io kodlama.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 46 days
kundalinibodywork.online kundalinibodywork.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
ec4allacademy.com ec4allacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 8 days
learncatgrooming.com.au learncatgrooming.com.au
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2023 29 days
learningwithervin.com learningwithervin.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 47 days
learntheventure.com learntheventure.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 44 days
learnwithnesha.com learnwithnesha.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2024 361 days
learnworkwin.com learnworkwin.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 32 days
letsdrawtodayclub.com letsdrawtodayclub.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 264 days
jugglingcare.com jugglingcare.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 87 days
masterofdeals.io masterofdeals.io
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 3 days
magicka.academy magicka.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Mar 2024 162 days
marketingschool.hk marketingschool.hk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
fbafreedomcourse.com fbafreedomcourse.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 7 days
masstercursos.com masstercursos.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 18 days
medispeakonline.com medispeakonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
meiofrancesa.com meiofrancesa.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
mentorify.com mentorify.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 49 days
meurecall.com meurecall.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 302 days
moderncreativemoney.com moderncreativemoney.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
moneyzg.academy moneyzg.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 41 days
morethancertified.com morethancertified.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
bernardogrillo.com bernardogrillo.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
familyfirstlifenewagentbootcamp.com familyfirstlifenewagentbootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 15 days
muslim-teachers.com muslim-teachers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mytoxtraining.com mytoxtraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 223 days
mamalucy.tw mamalucy.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 1 day
mamiversity.com mamiversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
fmbs.biz fmbs.biz
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 14 days
hdsm.net hdsm.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
babylionhotshot.com babylionhotshot.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
embracingwoman.com embracingwoman.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 8 days
focustrainingcenter.es focustrainingcenter.es
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 22 days
millionairepoolman.com millionairepoolman.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
mudpuddlementalhealth.com mudpuddlementalhealth.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 25 days
matejaque.com matejaque.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 28 days
ffha.co.uk ffha.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
ashokwellnessacademy.online ashokwellnessacademy.online
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
exploringeo.co exploringeo.co
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 2 days
english.cool courses.english.cool
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 23 days
icm.training icm.training
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
jameskool.com jameskool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
araby.academy araby.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
mtponline.com.au mtponline.com.au
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
calimove.com calimove.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
dental-edx.com dental-edx.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
itim-online.com itim-online.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 10 days
diehlfineartacademy.com diehlfineartacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
dailycontentideas.com dailycontentideas.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 21 days
teachable.com paul-caicedo-s-school.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 18 days
digitalethos.academy courses.digitalethos.academy
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 20 days
teachable.com coleman-gerhart-s-school.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
resinistasacademy.com resinistasacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
fisherdrumming.com fisherdrumming.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
happineering.co happineering.co
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 10 days
1yofit.com 1yofit.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
dentalsims.com dentalsims.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
hastterapionline.com hastterapionline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
milaneyebrow.tw course.milaneyebrow.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
microblading.tw course.microblading.tw
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
menntunin.is menntunin.is
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 20 days
jianmingche.com jianmingche.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 16 days
givingnaamwellness.com givingnaamwellness.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
floauniversity.com floauniversity.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
learnmusicnomics.com learnmusicnomics.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
hker.dev hker.dev
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
learnersoftomorrow.com learnersoftomorrow.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
lerren.com lerren.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
lonely.kitchen learn.lonely.kitchen
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025 8 days
paypercallmasterclass.com paypercallmasterclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 39 days
phdsec.com phdsec.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
munmun.org munmun.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Feb 2025 Feb 2025 One Off
growingwithjennifer.com growingwithjennifer.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
greatfuldad.com greatfuldad.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
teachable.com global-classroom1.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
aswaqalmalacademy.com aswaqalmalacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Jan 2025 One Off
gingerbreadarts.com gingerbreadarts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 96 days
glidefastplus.com glidefastplus.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 319 days
goup-online.com goup-online.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Feb 2025 Feb 2025 One Off
ACADEMIATRADUCTORES.COM
Non IP Attributes
Attribute First Last
GTM GTM-AW-11034374986 Jan 2023 Feb 2025
FB FB-516876720316418 Jan 2023 Mar 2024
FS FS-318805607 Jan 2023 Mar 2024
NR NR-NRBR-08e3a2ada38dc55a529 Jan 2025 Feb 2025
IC IC-318805607 Feb 2025 Feb 2025
HP HP-318805607 Feb 2025 Feb 2025
ACADEMIATRADUCTORES.COM
Overlap Attribute Domains
academiatraductores.com academiatraductores.com
wecnqr.com wecnqr.com
aboutlittlehumans.com aboutlittlehumans.com
abundanceacademy.online abundanceacademy.online
abyssimoartschool.com abyssimoartschool.com
academievoorabstractefotografie.nl academievoorabstractefotografie.nl
academiacosmetica.com academiacosmetica.com
acepresentationschool.com acepresentationschool.com
agustinaalgorta.com agustinaalgorta.com
academiademodas.com academiademodas.com
bosschicks247.com bosschicks247.com
martinbrossmaninstitute.com martinbrossmaninstitute.com
academyofcomposition.com academyofcomposition.com
abbevilleacademy.org abbevilleacademy.org
accurateenglishacademy.com accurateenglishacademy.com
warp-9.com warp-9.com
academiadeangeles.com academiadeangeles.com
aammlearning.com aammlearning.com
maskilim.org maskilim.org
academiehsa.com academiehsa.com
acknowlink.com acknowlink.com
activehope.training activehope.training
aikiuniversity.com aikiuniversity.com
mecacfoacademy.com mecacfoacademy.com
masteringlinting.com masteringlinting.com
martialartscenter.de martialartscenter.de
yoohoo.academy yoohoo.academy
youtap.education youtap.education
martingureasko.com martingureasko.com
academiaenergiasolar.com academiaenergiasolar.com
aartoday.com aartoday.com
abawizard.net abawizard.net
acromastermind.com acromastermind.com
agencyacceleratorcourse.com agencyacceleratorcourse.com
ailymphatic.com ailymphatic.com
akademiagrowings.com akademiagrowings.com
adobetechacademy.com adobetechacademy.com
masterklassesonline.com masterklassesonline.com
acupuncturescholar.com acupuncturescholar.com
720trades.com 720trades.com
aaronga97.com aaronga97.com
accountabilitycoachuniversity.com accountabilitycoachuniversity.com
martial-arts-online.teachable.com martial-arts-online.teachable.com
33growth.net 33growth.net
9-1-1academy.com 9-1-1academy.com
a2etraining.com a2etraining.com
academyinnerknowing.com academyinnerknowing.com
academiaesenciales.com academiaesenciales.com
academybizcreators.com academybizcreators.com
academyofuniversallawsandprinciples.com academyofuniversallawsandprinciples.com
academy-of-success.com academy-of-success.com
4goodacademy.it 4goodacademy.it
acnehealingacademy.com acnehealingacademy.com
adolescentdogsacademy.co.uk adolescentdogsacademy.co.uk
aiportalen.com aiportalen.com
aisha777.com aisha777.com
ajinkyakolhe.com ajinkyakolhe.com
aiguruacademy.com aiguruacademy.com
academyubora-ltd.com academyubora-ltd.com
adibusinesssuccess.com adibusinesssuccess.com
abuzeidacademy.online abuzeidacademy.online
achoacademy.com achoacademy.com
academiaonlinelatorre.com academiaonlinelatorre.com
xpat-u.com xpat-u.com
yafham.com yafham.com
12foundationstonescourse.com 12foundationstonescourse.com
martist-bodywork.com martist-bodywork.com
3deerender.com 3deerender.com
a1assetshq.com a1assetshq.com
academiadehacking.ro academiadehacking.ro
academuscr.com academuscr.com
academycopyriches.com academycopyriches.com
academiafarmasiespana.com academiafarmasiespana.com
academyserenity.com academyserenity.com
accelerations.org accelerations.org
accountingwithindy.com accountingwithindy.com
alchemyu.org alchemyu.org
acadianxu.com acadianxu.com
masteringimovie.teachable.com masteringimovie.teachable.com
ai-camp.codinglab.tw ai-camp.codinglab.tw
adenaacademy.com adenaacademy.com
12miglia.it 12miglia.it
6toolathlete.com 6toolathlete.com
6minutespay.com 6minutespay.com
mbacoachph.com mbacoachph.com
4jibaro.com 4jibaro.com
abundantlife.courses abundantlife.courses
academiafarmasiportugal.com academiafarmasiportugal.com
academy-of-unlimited-mind.com academy-of-unlimited-mind.com
masteringyourjobsearch.com masteringyourjobsearch.com
activistacademy.eu activistacademy.eu
agentaffiliatelink.com agentaffiliatelink.com
adventures-n-things.com adventures-n-things.com
master-investor-academy.teachable.com master-investor-academy.teachable.com
masteringnewbornphotography.com masteringnewbornphotography.com
mathkrumacosk128.com mathkrumacosk128.com
agilecommunities.com.au agilecommunities.com.au
aiproductmanager.org aiproductmanager.org
airdeskr.net airdeskr.net
akmaonline.com akmaonline.com
1eureka.com 1eureka.com
2morrowskill.com 2morrowskill.com
abreuuniversityonline.com abreuuniversityonline.com
globalsmallbusinessschool.com globalsmallbusinessschool.com
abstractingthelandscape.com abstractingthelandscape.com
accountingforschools.com accountingforschools.com
actrxtraining.com actrxtraining.com
adrianyanitaonline.com adrianyanitaonline.com
biamonline.com biamonline.com
akicikonus.com akicikonus.com
bradwhisnant.com bradwhisnant.com
globalquality.academy globalquality.academy
learn-martialarts.com learn-martialarts.com
learnballetonline.com learnballetonline.com
learninggodstruth.com learninggodstruth.com
learningtheartlife.com learningtheartlife.com
legionassistedlivingacademy.com legionassistedlivingacademy.com
lidemy.com lidemy.com
arabicoders.com arabicoders.com
linguisticator.com linguisticator.com
literaryadventuresforkids.com literaryadventuresforkids.com
lonecrowstudio.com lonecrowstudio.com
longevity.degree longevity.degree
lyndajanespiritschool.com lyndajanespiritschool.com
machongate.net machongate.net
makemusicmoves.com makemusicmoves.com
makingsenseofsponsoredposts.com makingsenseofsponsoredposts.com
marksmanacademy.org marksmanacademy.org
mastersandharris.com mastersandharris.com
benbacal-academy.com benbacal-academy.com
mbcourses.org mbcourses.org
medical-german.eu medical-german.eu
menocourse.com menocourse.com
michelleleeartsstudio.com michelleleeartsstudio.com
millermanschool.com millermanschool.com
millionairetraderssociety.com millionairetraderssociety.com
mintplusplus.ch mintplusplus.ch
miraclewordu.com miraclewordu.com
mjsi.org mjsi.org
moreyouniversity.com moreyouniversity.com
mountainfitnessschool.com mountainfitnessschool.com
mtpeducation.com mtpeducation.com
muaythaisecretonline.com muaythaisecretonline.com
multiplicationschool.com multiplicationschool.com
musictherapyonline.org musictherapyonline.org
myarkview.org myarkview.org
mybodymycelebration.com mybodymycelebration.com
myccuonline.com myccuonline.com
mynetworktraining.com mynetworktraining.com
myrecoveryportal.com myrecoveryportal.com
psal.ms psal.ms
halabellydance.com halabellydance.com
teplu.in teplu.in
iceju.org iceju.org
girlgonecity.com girlgonecity.com
knackcourses.com knackcourses.com
dojang.org dojang.org
gaivna.com gaivna.com
academianexoyoga.com academianexoyoga.com
speakenglishwithtiffaniacademy.com speakenglishwithtiffaniacademy.com
picaca.jp picaca.jp
bnb.university bnb.university
asvabsuccess.net asvabsuccess.net
rhythm.academy rhythm.academy
bassemschool.com bassemschool.com
thewat.com thewat.com
audacitybootcamp.com audacitybootcamp.com
cphttrainingcenter.com cphttrainingcenter.com
alstocktrades.com alstocktrades.com
formazioneintegrata.com formazioneintegrata.com
awakeinthedreamschool.com awakeinthedreamschool.com
haccptrainingonline.ie haccptrainingonline.ie
ccstarseeds.me ccstarseeds.me
chrystele-pitzalis.com chrystele-pitzalis.com
algolab.so algolab.so
altdeep.ai altdeep.ai
getthespike.com getthespike.com
freightbroker911.training freightbroker911.training
asiaforexmentoracademy.com asiaforexmentoracademy.com
accountingcodingcamp.com accountingcodingcamp.com
autismforteachers.com autismforteachers.com
awsdevops.io awsdevops.io
beginblacksmithing.com beginblacksmithing.com
hayashi-shunsuke.com hayashi-shunsuke.com
coursesbycaroline.com coursesbycaroline.com
couragemolinauniversity.com couragemolinauniversity.com
brigadeacademy.com brigadeacademy.com
codingfaculty.com codingfaculty.com
cogni.school cogni.school
iso-gps.com iso-gps.com
knowmore.university knowmore.university
hypnopower.us hypnopower.us
forteachersbyteachers.net forteachersbyteachers.net
bee-friendly-family.teachable.com bee-friendly-family.teachable.com
karaz.academy karaz.academy
shibariclasses.com shibariclasses.com
learnfinearts.com learnfinearts.com
certifiedondemand.com certifiedondemand.com
kyleeanneducation.com kyleeanneducation.com
laviniabrowncourses.com laviniabrowncourses.com
lifedesignsociety.com lifedesignsociety.com
gytocourses.com gytocourses.com
campusdigitaldeespecialistas.com campusdigitaldeespecialistas.com
digitalabcd.com digitalabcd.com
horsebosses.com horsebosses.com
luxebrowngirltravels.com luxebrowngirltravels.com
luxuryfilmmaker.com luxuryfilmmaker.com
lvbbi.com lvbbi.com
lymcapacitacion.com lymcapacitacion.com
mac-seminar.online mac-seminar.online
markzguitar.com markzguitar.com
darbukaschool.com darbukaschool.com
mazentaichi.com mazentaichi.com
mcclanahanacademy.com mcclanahanacademy.com
myautomationclass.com myautomationclass.com
mentality.work mentality.work
mervacademy.com mervacademy.com
michelemavi.com michelemavi.com
michelleraesobi.com michelleraesobi.com
middlemanagermagic.com middlemanagermagic.com
mildorviolon.com mildorviolon.com
misiononline.com misiononline.com
mmcourses.co.uk mmcourses.co.uk
moolmaninstitute.com moolmaninstitute.com
morimotostudio.com morimotostudio.com
moteefe.school moteefe.school
mrquakersteaches.com mrquakersteaches.com
mteacademy.ca mteacademy.ca
mymusicalvoice.com mymusicalvoice.com
uog.training uog.training
freedomnation.online freedomnation.online
ppcs.nu ppcs.nu
voip.school voip.school
certv.org certv.org
fbcti.org fbcti.org
qifit.pl qifit.pl
tpd15.com tpd15.com
bestme.today bestme.today
bkeiei.com bkeiei.com
homeschool-university.com homeschool-university.com
course.shopline.tw course.shopline.tw
cpaweb.org.uk cpaweb.org.uk
homebuildersuniversity.com homebuildersuniversity.com
oxfordlearninglab.com oxfordlearninglab.com
pornrebootprogram.com pornrebootprogram.com
hustlebuddiesofficial.com hustlebuddiesofficial.com
skaled.academy skaled.academy
shezer.org shezer.org
cherishartzcreative.com cherishartzcreative.com
cphttraining.com cphttraining.com
functionalfreediving.com functionalfreediving.com
afrolatinfunk.dance afrolatinfunk.dance
wndx.school wndx.school
fpmasterclass.com fpmasterclass.com
vulf.co vulf.co
atparentingsurvivalschool.com atparentingsurvivalschool.com
authorgrow.com authorgrow.com
avatarenergymastery.com avatarenergymastery.com
brailleskateuniversity.com brailleskateuniversity.com
idlab.school idlab.school
frenchwithvincent.com frenchwithvincent.com
developedbyed.com developedbyed.com
getstartedplayingukulele.com getstartedplayingukulele.com
sifcpd.com sifcpd.com
stages.academy stages.academy
healthyuonline.org healthyuonline.org
heahealthhub.com heahealthhub.com
childhoodtraumainstitute.com childhoodtraumainstitute.com
iltdp.com iltdp.com
frenchdialogues.com frenchdialogues.com
haircamphomeedition.com haircamphomeedition.com
accordarelabatteria.it accordarelabatteria.it
lovemywombacademyonline.com lovemywombacademyonline.com
mastinkippcoaching.com mastinkippcoaching.com
kurser-for-par.dk kurser-for-par.dk
michaelandrewlawdojo.com michaelandrewlawdojo.com
manosfilippou.com manosfilippou.com
alexandrian.academy alexandrian.academy
allthingsendo.ca allthingsendo.ca
lowerlaptime.com lowerlaptime.com
mastery.business mastery.business
apprendre-java.com apprendre-java.com
1600.io 1600.io
aspireinstitute.tv aspireinstitute.tv
mikebauermusic.com mikebauermusic.com
autotrading.vip autotrading.vip
avotek-online.com avotek-online.com
minervaeducacionfinanciera.mx minervaeducacionfinanciera.mx
frittsacademy.com frittsacademy.com
bear.academy bear.academy
turnkeyrentals101.com turnkeyrentals101.com
mmi-members.com mmi-members.com
guitaros.com guitaros.com
mom-sports.com mom-sports.com
moteefearabic.com moteefearabic.com
moystudio.online moystudio.online
evolvefitnessofficial.com evolvefitnessofficial.com
mrflynnib.com mrflynnib.com
muttsandmischiefacademy.com muttsandmischiefacademy.com
mwgcourses.com mwgcourses.com
myteachinghero.com myteachinghero.com
graphicinteriordesignschool.com graphicinteriordesignschool.com
grazeu.com grazeu.com
janechippsart.school janechippsart.school
makemoneywithcredit.com makemoneywithcredit.com
jennicrowther.co.uk jennicrowther.co.uk
makingsenseofaffiliatemarketing.com makingsenseofaffiliatemarketing.com
kizentraining.com kizentraining.com
jenniferrayecourses.com jenniferrayecourses.com
learnitanytime.com learnitanytime.com
learn.physio learn.physio
moneyintelligenceacademy.com moneyintelligenceacademy.com
livingarchitectureacademy.com livingarchitectureacademy.com
linglongchinois.com linglongchinois.com
polygonrunway.com polygonrunway.com
master-jpcuisine.com master-jpcuisine.com
miiedu.com miiedu.com
mindbaracademy.com mindbaracademy.com
moderncalligraphy101.com moderncalligraphy101.com
mountaindulcimeratoz.com mountaindulcimeratoz.com
myacademyofsuccess.com myacademyofsuccess.com
qtlab.it qtlab.it
beckythompsonstudies.com beckythompsonstudies.com
30daystosuccess.academy 30daystosuccess.academy
americandentalsedation.com americandentalsedation.com
cheekyschool.com cheekyschool.com
americanenglishuniversity.com americanenglishuniversity.com
cphtacademy.com cphtacademy.com
christinekmillercourses.com christinekmillercourses.com
lilibarbery.tv lilibarbery.tv
lvrgacademy.com lvrgacademy.com
lionahottaschool.com lionahottaschool.com
lissarankinmd.com lissarankinmd.com
littlelighthouseacademy.org littlelighthouseacademy.org
lotphilanthropyu.com lotphilanthropyu.com
lovedaphnemaecourses.com lovedaphnemaecourses.com
lovelybylindsey-bridalhaireducation.com lovelybylindsey-bridalhaireducation.com
lovingright.co lovingright.co
lucysartlab.com lucysartlab.com
cidn-edu.com cidn-edu.com
sandia.co.za sandia.co.za
school.doordata.tw school.doordata.tw
agenyz.tv agenyz.tv
getorganizedgal.com getorganizedgal.com
amazonsellerpros.com amazonsellerpros.com
myonlinecnaplatform.com myonlinecnaplatform.com
matusnursingreviewacademy.com matusnursingreviewacademy.com
mindandbusiness.net mindandbusiness.net
lisapowers.courses lisapowers.courses
media101.org media101.org
staer.is staer.is
kpi.academy kpi.academy
mentoriaprofetica.org mentoriaprofetica.org
awesomeartschool.com awesomeartschool.com
mindsetclasses.com mindsetclasses.com
azizbashaacademy.com azizbashaacademy.com
balkanarchitect.com balkanarchitect.com
benja.hk benja.hk
mnairacademy.com mnairacademy.com
lescreateurs.video lescreateurs.video
dalilkcourse.com dalilkcourse.com
edrone.academy edrone.academy
growthschool.com growthschool.com
jfdplus.com jfdplus.com
giftedsocietyacademy.org giftedsocietyacademy.org
lorenzofiorentino-corsi.it lorenzofiorentino-corsi.it
multisensorymath.online multisensorymath.online
garyclarke.tech garyclarke.tech
loftylearning.com loftylearning.com
mybiomi.com mybiomi.com
graceincolorclassroom.com graceincolorclassroom.com
groomadogcourse.com groomadogcourse.com
growinginchrist.com growinginchrist.com
mymodernagentu.com mymodernagentu.com
learnwitheo.com learnwitheo.com
iuda.dance iuda.dance
interculturalireland.com interculturalireland.com
kisss.academy kisss.academy
myyogatime.com myyogatime.com
praxiscenterforaestheticstudies.com praxiscenterforaestheticstudies.com
lilium.academy lilium.academy
livetantraacademy.com livetantraacademy.com
mantelandtableacademy.com mantelandtableacademy.com
marketinginblack.com marketinginblack.com
markperrenjones.com markperrenjones.com
musicbycandl.com musicbycandl.com
mxgraphics-academy.com mxgraphics-academy.com
marcotafelli.com marcotafelli.com
imgroadmap.com imgroadmap.com
kurdzone.org kurdzone.org
emubaonline.com emubaonline.com
encorecarestudentportal.com encorecarestudentportal.com
lashguyproacademy.com lashguyproacademy.com
leafwingforprofessionals.org leafwingforprofessionals.org
learnabee.com learnabee.com
learncredit.com learncredit.com
learnjam.academy learnjam.academy
learnmcas.com learnmcas.com
learnwithus.ca learnwithus.ca
letterartacademy.com letterartacademy.com
linuxhint.biz linuxhint.biz
lookerstudiobible.com lookerstudiobible.com
lotetreeacademy.com lotetreeacademy.com
luminouslivingacademy.com luminouslivingacademy.com
mabusinessuniversity.com mabusinessuniversity.com
maconstyles.academy maconstyles.academy
maestroportillo.com maestroportillo.com
magiclab.cl magiclab.cl
ddtdetox.com ddtdetox.com
mariaraczynska.com mariaraczynska.com
mdlive.net mdlive.net
meehanhealthline.com meehanhealthline.com
dreamstudiocourse.com dreamstudiocourse.com
mentalwellbeingacademy.com mentalwellbeingacademy.com
metafutureschool.org metafutureschool.org
middleclassmusician.com middleclassmusician.com
mindmuscles.academy mindmuscles.academy
herjabb.com herjabb.com
hish.co hish.co
mohab-tech.com mohab-tech.com
moversup.org moversup.org
mpact.online mpact.online
muakk.tv muakk.tv
musclay.com musclay.com
musichabit.com musichabit.com
musicmasterclasses.be musicmasterclasses.be
myfoodmarketing.com myfoodmarketing.com
gma.is gma.is
ncta.online ncta.online
vin.drip.vet vin.drip.vet
newqi.live newqi.live
40wob.com 40wob.com
altenaeducation.com altenaeducation.com
manifestitfinesseit.teachable.com manifestitfinesseit.teachable.com
vgos.online vgos.online
mentesmaestras.org mentesmaestras.org
21day.microblading.tw 21day.microblading.tw
expertviz.com expertviz.com
emotionaledu.com emotionaledu.com
ignitoracademy.com ignitoracademy.com
cybertrainingpro.com cybertrainingpro.com
itcert2005-online.com itcert2005-online.com
learn.standattuned.au learn.standattuned.au
medsy.tr medsy.tr
xss0r.store xss0r.store
marladelong.com marladelong.com
0cardmastery.com 0cardmastery.com
cadomu.com cadomu.com
cgpoly.fr cgpoly.fr
ogc2go.com ogc2go.com
course.risfastcut.tw course.risfastcut.tw
everlastingloveacademy.com everlastingloveacademy.com
incognito.dance incognito.dance
givingnaamwellness.org givingnaamwellness.org
equipu.me equipu.me
getreadyforgreatness.com getreadyforgreatness.com
academy-mind-tree-coaching.lu academy-mind-tree-coaching.lu
marketingcraftbrews.teachable.com marketingcraftbrews.teachable.com
kleoly.co.za kleoly.co.za
marketpronto.com marketpronto.com
sc.edu.ge sc.edu.ge
langchain.site langchain.site
chaostocalm.co chaostocalm.co
eoslearningcollective.com eoslearningcollective.com
preservethis.org preservethis.org
australian-sports-massage.com australian-sports-massage.com
flippingwheels.com flippingwheels.com
florida-dealer-school.com florida-dealer-school.com
thewco.com.au thewco.com.au
ariasprocess.com ariasprocess.com
blab.academy blab.academy
hub.chatarpalarora.com hub.chatarpalarora.com
febreuniversity.com febreuniversity.com
fbmusicacademy.com fbmusicacademy.com
lilynabil.com lilynabil.com
courses.chefallisonolivia.com courses.chefallisonolivia.com
leadership.chefxpertise.com leadership.chefxpertise.com
chefmcqueenyacademy.com chefmcqueenyacademy.com
courses.chau-time.com courses.chau-time.com
courses.chemicalengineeringguy.com courses.chemicalengineeringguy.com
courses.chesswi.com courses.chesswi.com
apprendr.com apprendr.com
workshops.childpsychologyworkshops.com.au workshops.childpsychologyworkshops.com.au
fpalaunchpad.com fpalaunchpad.com
francescselvaacademy.com francescselvaacademy.com
chiron-k9.online chiron-k9.online
gcdftraining.com gcdftraining.com
class.churchpianist-traning.com class.churchpianist-traning.com
freelancingfreedom.com freelancingfreedom.com
courses.chromasia.com courses.chromasia.com
freemaxpictures.com freemaxpictures.com
hunchocoaching.com hunchocoaching.com
chuckgohncoaching.com chuckgohncoaching.com
classroom.chrismatakas.com classroom.chrismatakas.com
frenchwithkids.com frenchwithkids.com
academiadesupervivencia.com academiadesupervivencia.com
aquariumclass.com aquariumclass.com
academiamaquisport.com academiamaquisport.com
luminousheroes.me luminousheroes.me
actorsactacademy.com actorsactacademy.com
ghionis.com ghionis.com
luismiranda.com.mx luismiranda.com.mx
dementiabydayschool.com dementiabydayschool.com
adobe-educa.com adobe-educa.com
m2benterprises.com m2benterprises.com
advanced-academy.com advanced-academy.com
magicalaudios.com magicalaudios.com
fivelensacademy.com fivelensacademy.com
airbrushonlineschool.com airbrushonlineschool.com
ajmonics.com ajmonics.com
alphatutor.online alphatutor.online
3mranmath.com 3mranmath.com
mariaswatercoloracademy.com mariaswatercoloracademy.com
marioroberto.tv marioroberto.tv
allthingsmathematics.com allthingsmathematics.com
everythingeboniacademy.com everythingeboniacademy.com
amyscircle.com amyscircle.com
americancrochetassociation.com americancrochetassociation.com
arminharris.com arminharris.com
fatherhoodafterdivorce.com fatherhoodafterdivorce.com
maddywestbrook.com maddywestbrook.com
mathmanacademy.com mathmanacademy.com
angelchatteracademy.com angelchatteracademy.com
animeartacademy.com animeartacademy.com
andrewclarkeguitar.com andrewclarkeguitar.com
macrolab.ai macrolab.ai
melodieuse.fr melodieuse.fr
melodypalace.com melodypalace.com
artcloud.com.mx artcloud.com.mx
stackskills.com stackskills.com
artmarketacademy.com artmarketacademy.com
aditi-goyal-s-school.teachable.com aditi-goyal-s-school.teachable.com
128academy.com 128academy.com
mhtacademy.net mhtacademy.net
figtree.international figtree.international
academyhacker.com academyhacker.com
app.chiropracticmarketinguniversity.com app.chiropracticmarketinguniversity.com
ecomupriseuniversity.com ecomupriseuniversity.com
ats-hybrid.com ats-hybrid.com
mindacademy.me mindacademy.me
awelivet.se awelivet.se
ayoubbellabes.com ayoubbellabes.com
elevatepractices.training elevatepractices.training
barnstoneondemand.com barnstoneondemand.com
tmrise.com tmrise.com
basicfilmmakeruniversity.com basicfilmmakeruniversity.com
beabeacon.lgbt beabeacon.lgbt
behavioranalytics.academy behavioranalytics.academy
beingman.life beingman.life
bellabusinessschool.com bellabusinessschool.com
bennett-movement.com bennett-movement.com
bensguitarclub.com bensguitarclub.com
bestpossibleselfinstitute.com bestpossibleselfinstitute.com
bitcademy.org bitcademy.org
blackbeltbrokerage.com blackbeltbrokerage.com
blackonboardonline.org blackonboardonline.org
blendertoprinter.com blendertoprinter.com
handeyeacademy.com handeyeacademy.com
vnysa.school vnysa.school
bibleandworship.com bibleandworship.com
boxcollider.io boxcollider.io
brainacademy.com brainacademy.com
breadcourses.com breadcourses.com
breadlessons.com breadlessons.com
breemelanson-shop.com breemelanson-shop.com
brevitycoaching.com brevitycoaching.com
broadwaytowallstreet.com broadwaytowallstreet.com
eteacademy.com eteacademy.com
buildlivable.com buildlivable.com
bulletproofrunners.com bulletproofrunners.com
bushidouniversity.com bushidouniversity.com
businessprotraining.es businessprotraining.es
knxonline.gr knxonline.gr
cadmantraining.com cadmantraining.com
caid.org caid.org
capitariacursostrading.com capitariacursostrading.com
intellectualpoint-staging.com intellectualpoint-staging.com
carriemillerpilates.com carriemillerpilates.com
carrytn.com carrytn.com
ccelearn.org ccelearn.org
cdlpermit.study cdlpermit.study
centroestudioshebraicos.com centroestudioshebraicos.com
emilymadillcourses.com emilymadillcourses.com
chalkright.com chalkright.com
chansam.online chansam.online
charlesandelinacademy.com charlesandelinacademy.com
christianlearning.com christianlearning.com
korecekocun.com korecekocun.com
montessori4moms.com montessori4moms.com
ecodehacker.com ecodehacker.com
ead.tv ead.tv
ealim.org ealim.org
greenfirstacademy.com greenfirstacademy.com
fullstacklibrary.com fullstacklibrary.com
funatsumari-beautyacademy-onlineschool.com funatsumari-beautyacademy-onlineschool.com
gageacademy.net gageacademy.net
gamejamschool.com gamejamschool.com
gamethinkingacademy.com gamethinkingacademy.com
gbdcollege.com gbdcollege.com
geigerandspence.com geigerandspence.com
genco.school genco.school
muslimfamilyacademy.com muslimfamilyacademy.com
muskyacademy.com muskyacademy.com
gestationaldiabetescourse.com gestationaldiabetescourse.com
gigrocket.com gigrocket.com
glamaway.ca glamaway.ca
googleadwordstutorial.com googleadwordstutorial.com
govkidmethod.com govkidmethod.com
graphneuralnets.com graphneuralnets.com
groove2day.com groove2day.com
gsk-edu.com gsk-edu.com
gymcademy.com gymcademy.com
hackyourbrainwithnlp.com hackyourbrainwithnlp.com
derekbiggs.com derekbiggs.com
highticketelites.com highticketelites.com
hijamanationacademy.com hijamanationacademy.com
hiswordhealstoday.net hiswordhealstoday.net
plataformaescuelasvisuales.com plataformaescuelasvisuales.com
itmasterkey.com itmasterkey.com
howtofreedive.com howtofreedive.com
hsbnschool.org hsbnschool.org
htdezignschool.com htdezignschool.com
azstocktrade.com azstocktrade.com
makeitlabacademy.com makeitlabacademy.com
islamabuauf.com islamabuauf.com
istudyjapanese.com istudyjapanese.com
itakelessons.com itakelessons.com
ithahu.com ithahu.com
jfdeducation.com jfdeducation.com
learnhowtotrades.com learnhowtotrades.com
deeperbiblecollege.com deeperbiblecollege.com
microempresarial.com microempresarial.com
justudy.co.il justudy.co.il
learnyourdrink.com learnyourdrink.com
kamalaleslie.com kamalaleslie.com
keyconceptsinstitute.com keyconceptsinstitute.com
khasang.io khasang.io
bookkeepingfortheentrepreneur.com bookkeepingfortheentrepreneur.com
kimmunity.com.au kimmunity.com.au
kitdaletraining.com kitdaletraining.com
kkcreditacademy.org kkcreditacademy.org
kkxuniversity.com kkxuniversity.com
korzat.net korzat.net
creativeshandbook.io creativeshandbook.io
french4me.net french4me.net
jordancanova.com jordancanova.com
lapharmacie-coaching.com lapharmacie-coaching.com
kafx.org kafx.org
justbeachystudio.club justbeachystudio.club
katiesisk.com katiesisk.com
kevinfoong.co kevinfoong.co
khadijaacademy.com khadijaacademy.com
kinbaku-academy.com kinbaku-academy.com
kitsapstrongconsulting.com kitsapstrongconsulting.com
knittinginenglish.com knittinginenglish.com
koimartialart.com koimartialart.com
krvalues.com krvalues.com
laboratoriodemovimiento.com laboratoriodemovimiento.com
laescueladepealpan.com laescueladepealpan.com
episcopal.education episcopal.education
futurioncollege.com futurioncollege.com
espabilaeinvierte.com espabilaeinvierte.com
landlordcert.org landlordcert.org
latindanceonline.com latindanceonline.com
latindanceshop.com latindanceshop.com
launch-well.com launch-well.com
mpe4prep.com mpe4prep.com
lead2flow.nl lead2flow.nl
leadgenacademy.courses leadgenacademy.courses
leadinforce-academy.com leadinforce-academy.com
league-of-elites.com league-of-elites.com
learndataengineering.com learndataengineering.com
learnfengshui.co.uk learnfengshui.co.uk
learning-bytes.com learning-bytes.com
learnthecut.com learnthecut.com
letityoga.it letityoga.it
letslearnthistogether.com letslearnthistogether.com
letspaintflowers.com letspaintflowers.com
letsrecover.co.uk letsrecover.co.uk
levelupmvmt.com levelupmvmt.com
linglongchinese.com linglongchinese.com
literacytolife.com literacytolife.com
liveyourheartout.academy liveyourheartout.academy
loogguitarschool.com loogguitarschool.com
loripalmquist.com loripalmquist.com
lydiafernandes.com lydiafernandes.com
firstresponderacademy.ca firstresponderacademy.ca
marcelacabrejos.com marcelacabrejos.com
masterfulpainting.com masterfulpainting.com
mazori.com mazori.com
medix.education medix.education
andreiikim.ro andreiikim.ro
missionfx.us missionfx.us
mocktrialky.com mocktrialky.com
mojoversity.com mojoversity.com
momsquest.org momsquest.org
alist.com.hk alist.com.hk
mrotterstudio.com mrotterstudio.com
alyshajamesacademy.com alyshajamesacademy.com
makeupfromscratchacademy.com makeupfromscratchacademy.com
bdsl.courses bdsl.courses
learnzonemedia.co.uk learnzonemedia.co.uk
exploreai.org exploreai.org
heroicfm.com heroicfm.com
dronecoach.asia dronecoach.asia
feltonmusicschool.com feltonmusicschool.com
capitellefinance.com capitellefinance.com
class.kidsyoga.tw class.kidsyoga.tw
frenchdialogs.com frenchdialogs.com
ehati.education ehati.education
isydk.com isydk.com
enjoyingenglish.ca enjoyingenglish.ca
joyfulmatchingforyou.com joyfulmatchingforyou.com
novel.academy novel.academy
eda-study.com eda-study.com
keolafit.teachable.com keolafit.teachable.com
mackpo.com mackpo.com
mncourses.com mncourses.com
fit-for-life-toneathomefitness.com fit-for-life-toneathomefitness.com
asemsecuritymultiservice.com asemsecuritymultiservice.com
effectiveelearningpractices.com effectiveelearningpractices.com
dangerousgoodstrainingonline.com dangerousgoodstrainingonline.com
dhejobusinesscoach.com dhejobusinesscoach.com
jostai.com jostai.com
courses.tina.tw courses.tina.tw
lsreei.com lsreei.com
marketmakersny.com marketmakersny.com
cei-ph.com cei-ph.com
dounia-s-school.xyz dounia-s-school.xyz
pitec.la pitec.la
informationinyiddish.com informationinyiddish.com
forestrock.com forestrock.com
3chrz.com 3chrz.com
ptype.academy ptype.academy
escapewith.us escapewith.us
damiancejas.com damiancejas.com
mbxax.school mbxax.school
thecmu.com thecmu.com
eyesopenacademy.com eyesopenacademy.com
dogsconnectmentorship.com dogsconnectmentorship.com
wsc22.com wsc22.com
modernherbalacademy.com modernherbalacademy.com
kirkeneshundesenter.no kirkeneshundesenter.no
alliance.changethebrief.org alliance.changethebrief.org
homebakingcroissant.com homebakingcroissant.com
courses.chattypenguin.com courses.chattypenguin.com
escuelaaudiovisual.com escuelaaudiovisual.com
ziptraderu.com ziptraderu.com
dougtempleton.com dougtempleton.com
masterclass.chau-time.com masterclass.chau-time.com
courses.cheministry.online courses.cheministry.online
course.cherylportermethod.com course.cherylportermethod.com
ilmonlineclasses.com ilmonlineclasses.com
courses.chessuniversity.com courses.chessuniversity.com
focus5online.com focus5online.com
courses.chineseheritage.co.uk courses.chineseheritage.co.uk
masterclass.chisaxonlinecourse.com masterclass.chisaxonlinecourse.com
daretolivecoaching.com daretolivecoaching.com
chocolatesommelierschool.org chocolatesommelierschool.org
chilleracademy.com chilleracademy.com
fpp-academy.com fpp-academy.com
course.chinableacademy.com course.chinableacademy.com
excelspeedwork.com excelspeedwork.com
learn.christianwritersinstitute.com learn.christianwritersinstitute.com
courses.christinabrown.com courses.christinabrown.com
chronichope.us chronichope.us
lets3dsmax.com lets3dsmax.com
christiancompliancetraining.com christiancompliancetraining.com
chutzpah101.com chutzpah101.com
robertbakerguitar.com robertbakerguitar.com
classicalguitar-pro.com classicalguitar-pro.com
abraham-education.com abraham-education.com
lloydpestuniversity.com lloydpestuniversity.com
academiasemagro.com academiasemagro.com
joynyabongo.com joynyabongo.com
actualiseacademy.com actualiseacademy.com
saguto.golf saguto.golf
click-and-learn.fr click-and-learn.fr
courses.freetobewell.com courses.freetobewell.com
cielacademy.com cielacademy.com
atmavida.com atmavida.com
dynamiclanguages.org dynamiclanguages.org
arlansacademy.com arlansacademy.com
courses.onethirtyseven.org courses.onethirtyseven.org
manaterapija.lv manaterapija.lv
alselectronicclassroom.com alselectronicclassroom.com
manifestationsacademy.com manifestationsacademy.com
alignyourselftosuccessacademy.com alignyourselftosuccessacademy.com
alexhitt.com alexhitt.com
alivewithyogaonline.com alivewithyogaonline.com
embedded-coaching.com embedded-coaching.com
elearningfrei.ch elearningfrei.ch
joskeadconsulting.com joskeadconsulting.com
amzbusinesssociety.com amzbusinesssociety.com
db-musicacademy.com db-musicacademy.com
americancraftsmanshopclass.com americancraftsmanshopclass.com
ametsuchi-dojo.org ametsuchi-dojo.org
drcalinpop-online.com drcalinpop-online.com
digitalecommentor.com digitalecommentor.com
animalcentrededucation.com animalcentrededucation.com
anneorteleecourses.com anneorteleecourses.com
delightcareer.pl delightcareer.pl
aprendicesvisuales.com aprendicesvisuales.com
aptly.co aptly.co
medicinemusicschool.com medicinemusicschool.com
imsourceacademy.com imsourceacademy.com
artisanbakingcenter.com artisanbakingcenter.com
melissakellettart.com.au melissakellettart.com.au
master.superstar.tw master.superstar.tw
botoxbootcamp.com botoxbootcamp.com
learn.citrixhero.com learn.citrixhero.com
101value.net 101value.net
stoneriverelearning.com stoneriverelearning.com
mhutradingacademy.com mhutradingacademy.com
aashishacademy.com aashishacademy.com
academiadeimpacto.com academiadeimpacto.com
academyrichcopy.com academyrichcopy.com
mikemillertechguide.com mikemillertechguide.com
talmid.me talmid.me
autoimmunetribecourses.com autoimmunetribecourses.com
mindpowersports.com mindpowersports.com
aviationgroundschoolsonline.com aviationgroundschoolsonline.com
awesomepeopleleaders.com awesomepeopleleaders.com
theacl.club theacl.club
babilanka.com babilanka.com
mingxin.one mingxin.one
banzenkanacademy.com banzenkanacademy.com
atomicmauniversity.com atomicmauniversity.com
ministrytrainingnow.com ministrytrainingnow.com
beautymarketingacademy.com beautymarketingacademy.com
beginnertomastery.com beginnertomastery.com
behaviorcompassacademy.com behaviorcompassacademy.com
benshorts.com benshorts.com
bettertradingportal.com bettertradingportal.com
bewusstes-golf.academy bewusstes-golf.academy
bgcacademy.com bgcacademy.com
billionplg.com billionplg.com
bizimkimyamiz.com bizimkimyamiz.com
darrenenglish.com darrenenglish.com
blackbusinessu.com blackbusinessu.com
blessedtosell.com blessedtosell.com
gut-ed.com gut-ed.com
vidyapitha.in vidyapitha.in
bluelight.academy bluelight.academy
vmat.edu.vn vmat.edu.vn
bodyart.training bodyart.training
codervox.com codervox.com
viciu.com viciu.com
bscholarshipclass.com bscholarshipclass.com
buddytutorial.com buddytutorial.com
learn.mi-courses.com learn.mi-courses.com
bumpintoosteo.com.au bumpintoosteo.com.au
globalmarketingcollege.com globalmarketingcollege.com
bvotaekwondo.com bvotaekwondo.com
cactus-school.online cactus-school.online
canadianlaserinstitute.ca canadianlaserinstitute.ca
capacitypluscourse.com capacitypluscourse.com
cardandcraftacademy.com cardandcraftacademy.com
carlottacastangiayoga.com carlottacastangiayoga.com
catalystartlab.com catalystartlab.com
caveofprogramming.com caveofprogramming.com
celldreameracademy.com celldreameracademy.com
drbgroupltd.com drbgroupltd.com
cempschool.com cempschool.com
ceusforteachers.com ceusforteachers.com
chabakatarab.com chabakatarab.com
championsofinfluence.com championsofinfluence.com
chartslogic.com chartslogic.com
modality.academy modality.academy
theblackbusinessschool.com theblackbusinessschool.com
moirasdeschool.com moirasdeschool.com
codebh.fr codebh.fr
mokalemaacademy.com mokalemaacademy.com
digitalzaa.shop digitalzaa.shop
akasun.co.uk akasun.co.uk
criticalthinkeracademy.com criticalthinkeracademy.com
moneythingacademy.com moneythingacademy.com
moonbodytemple.com moonbodytemple.com
edu-vietkieu.com edu-vietkieu.com
easyt.online easyt.online
eltjam.academy eltjam.academy
essentielsduconseillerenvoyages.ca essentielsduconseillerenvoyages.ca
moveshapesschool.com moveshapesschool.com
fitsitclasses.com fitsitclasses.com
goldeneggsfertility.com goldeneggsfertility.com
lifewealthcourses.com lifewealthcourses.com
filmsimplified.com filmsimplified.com
gadha.ae gadha.ae
garyscourse.com garyscourse.com
getpublishedcourse.com getpublishedcourse.com
hackingmaang.com hackingmaang.com
academy.artisanfounder.com academy.artisanfounder.com
levelupwarrior.com levelupwarrior.com
mwwinstitute.org mwwinstitute.org
glowforgeforbeginners.com glowforgeforbeginners.com
gmalasereducation.com gmalasereducation.com
godpreneuracademy.com godpreneuracademy.com
gothink.tv gothink.tv
mydigitalagencyonlineacademy.com mydigitalagencyonlineacademy.com
graebert.academy graebert.academy
importadoresconectados.com importadoresconectados.com
greatgutguide.com greatgutguide.com
greverbalcourse.com greverbalcourse.com
gsaacademy.com gsaacademy.com
guitarinstitute.it guitarinstitute.it
guitarmy.net guitarmy.net
hackersacademy.ca hackersacademy.ca
haleyramsey.com haleyramsey.com
happybackyoga.com happybackyoga.com
mynlptraining.com mynlptraining.com
myoliftce.com myoliftce.com
harmony-life-academy.com harmony-life-academy.com
homeschoolbuyer.com homeschoolbuyer.com
educoatti.com educoatti.com
laeruniversity.com laeruniversity.com
howsongsaremade.com howsongsaremade.com
hrponlinelearning.com hrponlinelearning.com
humain360.com humain360.com
huntingcamp.live huntingcamp.live
idsei.com idsei.com
itherapist-seitai.com itherapist-seitai.com
corrozone.co.uk corrozone.co.uk
istitutolavoro.net istitutolavoro.net
iteachone.org iteachone.org
jessicacere.com jessicacere.com
jgaitpro.com jgaitpro.com
jlglobaltech.com jlglobaltech.com
jobbsokerkoden.no jobbsokerkoden.no
joinmeetkevin.com joinmeetkevin.com
formadoresexpertos.com formadoresexpertos.com
online-offerings.cheerfulstrength.net online-offerings.cheerfulstrength.net
johncrickett.me johncrickett.me
faucettemedia.com faucettemedia.com
chesterton.online chesterton.online
foxland.ro foxland.ro
school.chicreatives.com.tw school.chicreatives.com.tw
frankieflanagan.com frankieflanagan.com
elmetodo513.com elmetodo513.com
francaisavecfred.com francaisavecfred.com
freelstep.com freelstep.com
courses.chriswright.photography courses.chriswright.photography
churchillcourses.com churchillcourses.com
freelancetax.de freelancetax.de
freedomtraders.in freedomtraders.in
fluentmedic.co fluentmedic.co
courses.livecopilot.com courses.livecopilot.com
discoverasl.com discoverasl.com
acadegenius.co.uk acadegenius.co.uk
activcaretraining.com activcaretraining.com
infosecschool.net infosecschool.net
mbuzz.fr mbuzz.fr
lrnaudio.sk lrnaudio.sk
sagelogica.com sagelogica.com
lumierevirtual.com lumierevirtual.com
eden-smart.academy eden-smart.academy
embakify.com embakify.com
advancedalignertraining.com advancedalignertraining.com
enhancedignite.com enhancedignite.com
agaartstudioclasses.com agaartstudioclasses.com
aircraftprofit.com aircraftprofit.com
makingsocialwaves.com makingsocialwaves.com
alqamiedu.com alqamiedu.com
fretcraftmusic.com fretcraftmusic.com
algoaddict.com algoaddict.com
machicuradigital.com machicuradigital.com
algopro.ai algopro.ai
marketingmastery.jp marketingmastery.jp
marriagefunshop.com marriagefunshop.com
fbamasteryprogram.com fbamasteryprogram.com
cipskills.com cipskills.com
amazonmokymai.lt amazonmokymai.lt
dukeweb3.com dukeweb3.com
icanlearnnow.com icanlearnnow.com
lamat.fi lamat.fi
skilly.co.il skilly.co.il
artoflivingwell.org.uk artoflivingwell.org.uk
artofyoubellydance.com artofyoubellydance.com
courses.cipraniconsulting.com courses.cipraniconsulting.com
anywherestartup.com anywherestartup.com
edityourlandscapes.com edityourlandscapes.com
maxamedcabdullaahi.com maxamedcabdullaahi.com
anjayamajiart.com anjayamajiart.com
maypiano.me maypiano.me
mazequest.org mazequest.org
enjoyrealenglish.com enjoyrealenglish.com
apegcommunity.com apegcommunity.com
ivyleagueprofitsacademy.com ivyleagueprofitsacademy.com
mekademien.se mekademien.se
appbrewery.com appbrewery.com
entrepreneurtraining.education entrepreneurtraining.education
mgeteam.training mgeteam.training
abdulacademy.com abdulacademy.com
academiaimperial.com academiaimperial.com
academiatrencadis.com academiatrencadis.com
courses.citychanger.org courses.citychanger.org
academy-chiekoegged.com academy-chiekoegged.com
courses.cityhallessentials.com courses.cityhallessentials.com
inkaeticaret.com inkaeticaret.com
aliboucoding.com aliboucoding.com
aprendecontabella.com aprendecontabella.com
assessport-academy.com assessport-academy.com
luzinterior.com.mx luzinterior.com.mx
frome2p.com frome2p.com
tetmo.com tetmo.com
dkschoolofhypnosis.com dkschoolofhypnosis.com
feldenkrais-akademie.com feldenkrais-akademie.com
thb.academy thb.academy
axtonliu.ai axtonliu.ai
azlansensei-e-learning.com azlansensei-e-learning.com
baileylineroadlearning.com baileylineroadlearning.com
agileprojectmanagementacademy.com agileprojectmanagementacademy.com
baytalmosawer.online baytalmosawer.online
befit4akhirah.com befit4akhirah.com
bellpianopopcourseonline.com bellpianopopcourseonline.com
benatural.com.sg benatural.com.sg
benjajap.com benjajap.com
benlevinmusicschool.com benlevinmusicschool.com
algo-academy.com algo-academy.com
beyondtheboxacademy.com beyondtheboxacademy.com
billhelmtuina.com billhelmtuina.com
billyphillips.com billyphillips.com
fflhnwbootcamp.com fflhnwbootcamp.com
bitwisecourses.com bitwisecourses.com
blackexpertsempire.com blackexpertsempire.com
blendeducation.org blendeducation.org
blockchainbloom.com blockchainbloom.com
betterbakingschool.com betterbakingschool.com
bloggingbootcamp.com bloggingbootcamp.com
boarddirectortraining.com boarddirectortraining.com
bobbielyonscaninecampus.com bobbielyonscaninecampus.com
boldexpressivepaintingworkshops.com boldexpressivepaintingworkshops.com
borderstatesecuritytraining.com borderstatesecuritytraining.com
brainery.io brainery.io
bravobellabras.com bravobellabras.com
breakthroughfreelancing.com breakthroughfreelancing.com
edu-server.com edu-server.com
brokentobalanced.com brokentobalanced.com
budeducation.com budeducation.com
businessprofitimprovementplan.com businessprofitimprovementplan.com
bynadiablanco.com bynadiablanco.com
cafezinhobrasileiro.com cafezinhobrasileiro.com
mlacases.com mlacases.com
cameducation.co.uk cameducation.co.uk
campus-ateneojazz.com campus-ateneojazz.com
campus-ribas.com campus-ribas.com
campusparentesis.com campusparentesis.com
canopy.games canopy.games
cuddlefishacademy.com cuddlefishacademy.com
casasdeoracion.online casasdeoracion.online
catherineedwardsacademy.com catherineedwardsacademy.com
centering.life centering.life
codeveloppement.malikrezzoug.com codeveloppement.malikrezzoug.com
cfoo-education.com cfoo-education.com
changewithcolleen.com changewithcolleen.com
everybodyplayguitar.com everybodyplayguitar.com
millenniumfinancialuniversity.com millenniumfinancialuniversity.com
creator.school creator.school
empoweredplayconnections.com empoweredplayconnections.com
drpi.hr drpi.hr
gulfvatacademy.com gulfvatacademy.com
devs.online devs.online
eddieoneillsonlineschool.com eddieoneillsonlineschool.com
dropshippingtitans.com dropshippingtitans.com
mosaicartsonline.com mosaicartsonline.com
globalriskacademy.com globalriskacademy.com
encafe.org encafe.org
fotograevepro.teachable.com fotograevepro.teachable.com
movesmade4me.teachable.com movesmade4me.teachable.com
mrphysio.net mrphysio.net
mrphysio.com.au mrphysio.com.au
dapinstitute.com dapinstitute.com
fscourses.com fscourses.com
gaeilgelejane.com gaeilgelejane.com
educatedbye.com educatedbye.com
gateway.university gateway.university
gavinlund.co.za gavinlund.co.za
getoffyouracidacademy.com getoffyouracidacademy.com
gettingguru.com gettingguru.com
mographmentor.com mographmentor.com
globalcte.com globalcte.com
globalneurosurgicalalliance.com globalneurosurgicalalliance.com
mavericktradingacademy.io mavericktradingacademy.io
gonego.co gonego.co
greenzebra.online greenzebra.online
gregoryblumberg-bootcamp.com gregoryblumberg-bootcamp.com
griffinandbellvision.com griffinandbellvision.com
growonthreads.com growonthreads.com
guitarensemblemethod.com guitarensemblemethod.com
guitarlessons.nyc guitarlessons.nyc
guitarpass.com guitarpass.com
croblastoff.com croblastoff.com
talk-your-way-to-effective-communication.teachable.com talk-your-way-to-effective-communication.teachable.com
harmonyhorsemanshipacademy.org harmonyhorsemanshipacademy.org
healthiveacademy.com healthiveacademy.com
sd4ba.com sd4ba.com
mysuccessblueprints.com mysuccessblueprints.com
highlevelknowledge.com highlevelknowledge.com
holistichealthblueprint.com holistichealthblueprint.com
academy.giorgiateodori.it academy.giorgiateodori.it
homeofsound.co.uk homeofsound.co.uk
houseofyogavirtual.com houseofyogavirtual.com
human-insight-academy.com human-insight-academy.com
hypnosis-institute-mariani.com hypnosis-institute-mariani.com
makemoneybeingfunny.net makemoneybeingfunny.net
iyengaronline.it iyengaronline.it
jamespang-tutorial.com jamespang-tutorial.com
jmguitarlessons.com jmguitarlessons.com
jorgemochon.academy jorgemochon.academy
jptnailacademy.com jptnailacademy.com
makeupbynimoh.com makeupbynimoh.com
juniorycarolina.com juniorycarolina.com
inspiredwordteaching.org inspiredwordteaching.org
kidzygo.com kidzygo.com
greenatelier.art greenatelier.art
insiderlessons.com insiderlessons.com
knxacademy.com knxacademy.com
kodikaitradescourse.com kodikaitradescourse.com
kyle.care kyle.care
ladyesha.com ladyesha.com
theecontutor.com theecontutor.com
koreanwithhannah.com koreanwithhannah.com
lauraandscott.com lauraandscott.com
lawofattractionaccelerator.com lawofattractionaccelerator.com
leadingedgedogshowacademy.com leadingedgedogshowacademy.com
leadingedgegroomingacademy.com leadingedgegroomingacademy.com
learningritual.com learningritual.com
learnthemagicofpaper.com learnthemagicofpaper.com
jpusgifted.com jpusgifted.com
lizscullytraining.com lizscullytraining.com
arteriacademy.com arteriacademy.com
effectiveelearningpractice.com effectiveelearningpractice.com
loonextrading.com loonextrading.com
loveyourbusinessschool.com loveyourbusinessschool.com
loyallactation.com loyallactation.com
explaineracademy.com explaineracademy.com
markethustleacademy.com markethustleacademy.com
mastersinlife.com mastersinlife.com
mentefeliz.org mentefeliz.org
mentorship.one mentorship.one
metodofourstartup.com metodofourstartup.com
eflcurriculum.com eflcurriculum.com
mindrenewalschool.com mindrenewalschool.com
mitchellandstones.academy mitchellandstones.academy
mongymenligne.com mongymenligne.com
cib.team cib.team
fac.tokyo fac.tokyo
luminousheroes.com luminousheroes.com
maaaxterenglish.com maaaxterenglish.com
myfoodsafetytutor.com myfoodsafetytutor.com
myquitguide.com myquitguide.com
managementdose.com managementdose.com
managingqs.com managingqs.com
netecdigital.com netecdigital.com
clti.ca clti.ca
dancedoctoronline.com dancedoctoronline.com
kevinwallacejrschool.com kevinwallacejrschool.com
digital-trails.academy digital-trails.academy
longtermcompliance.info longtermcompliance.info
guitarinvadersacademy.net guitarinvadersacademy.net
great-gut-guide.teachable.com great-gut-guide.teachable.com
jdconsultingau.com jdconsultingau.com
java-mastery.com java-mastery.com
ahido.co.uk ahido.co.uk
earningyourownincome.com earningyourownincome.com
confidencecurrency.co confidencecurrency.co
eg-tv.com eg-tv.com
peakhd.net peakhd.net
thefmc.ie thefmc.ie
eduvietkieu.com eduvietkieu.com
balticnetworkstraining.com balticnetworkstraining.com
oonee.net oonee.net
eskills.academy eskills.academy
2-days.website 2-days.website
allaprimaacademy.com allaprimaacademy.com
anatma.com.mx anatma.com.mx
interventionacademy.com interventionacademy.com
hazlotu.work hazlotu.work
synchroshaktiacademy.com synchroshaktiacademy.com
embodiedwoman.com embodiedwoman.com
mayinedevelopmentcourses.com mayinedevelopmentcourses.com
canine.school.nz canine.school.nz
guitarist-al.com guitarist-al.com
cpaweb.co.uk cpaweb.co.uk
hub-amitsoni.com hub-amitsoni.com
johnsconnect.com johnsconnect.com
guidedglow.com guidedglow.com
3arabica.com 3arabica.com
opx360.com opx360.com
bigdataenergycourses.com bigdataenergycourses.com
datawithjack.com datawithjack.com
gfcourse.com gfcourse.com
makeappsacademy.com makeappsacademy.com
soilpd.com soilpd.com
doitpaperschool.com doitpaperschool.com
mindfulstudio.com.tr mindfulstudio.com.tr
planancial.com planancial.com
online.simplelearn.tw online.simplelearn.tw
internationalwellbeingacademy.com internationalwellbeingacademy.com
easynursingcourses.com easynursingcourses.com
prop.academy prop.academy
classes.itsgoodmaterial.com classes.itsgoodmaterial.com
usaiif.com usaiif.com
ecomcopycrashcourse.com ecomcopycrashcourse.com
fuerteaerialfitness.com fuerteaerialfitness.com
fretsfordays.com fretsfordays.com
alchemycodeu.com alchemycodeu.com
academy.design-your-future.de academy.design-your-future.de
ahmed-fitness.com ahmed-fitness.com
formationcryptoquebec.com formationcryptoquebec.com
formerinsider.com formerinsider.com
forstehjelpbarn.no forstehjelpbarn.no
investishare.com investishare.com
developmentisland.com developmentisland.com
itm-online.com itm-online.com
learn.chiforce.com learn.chiforce.com
childocd.net childocd.net
learnfluentenglish.academy learnfluentenglish.academy
edu.chinasyohoujp.com edu.chinasyohoujp.com
giraffemoves.com giraffemoves.com
esadsaglamakademi.com esadsaglamakademi.com
school.chriscapehart.co school.chriscapehart.co
indemandspeaking.com indemandspeaking.com
course.christinechengacademy.com course.christinechengacademy.com
freelancemastery.dev freelancemastery.dev
pets.christophertodd.com pets.christophertodd.com
familysuccessacademy.com familysuccessacademy.com
emedstudy.com emedstudy.com
infinitemusician.com infinitemusician.com
droneadventurermasterclass.com droneadventurermasterclass.com
academyofpurpose.org academyofpurpose.org
financialelevationcourses.com financialelevationcourses.com
mision.ciberconscientes.com mision.ciberconscientes.com
flowersandassociates.courses flowersandassociates.courses
academiadeamorpropio.com academiadeamorpropio.com
actorsspark.com actorsspark.com
findhopeingod.org findhopeingod.org
embakeify.com embakeify.com
experience.churchosonline.com experience.churchosonline.com
advanced-plc.com advanced-plc.com
cierralaventaa.com cierralaventaa.com
metodotamash.com metodotamash.com
muzo.id muzo.id
allen-bradley-plc-training.com allen-bradley-plc-training.com
ashleymethodedu.com ashleymethodedu.com
alflow.net alflow.net
integratedmeditationacademy.com integratedmeditationacademy.com
erdensclub.com erdensclub.com
amazoninterviewwhizzacademy.com amazoninterviewwhizzacademy.com
ecole-du-web.net ecole-du-web.net
egindicators.org egindicators.org
mastersoftheplayground.com mastersoftheplayground.com
masterxclass.com masterxclass.com
futureeducationacademy.co.uk futureeducationacademy.co.uk
circusanatomy.com circusanatomy.com
maximatics.com.au maximatics.com.au
drivesafewi.com drivesafewi.com
aurethia.com aurethia.com
friosmarketing.com friosmarketing.com
howtowingrants.com howtowingrants.com
meditorium.in meditorium.in
escueladirecta.com escueladirecta.com
accademiamassaggioanimale.com accademiamassaggioanimale.com
coaching.citychanger.org coaching.citychanger.org
jonyquiroz.net jonyquiroz.net
businesseducationelearning.com businesseducationelearning.com
alardaacademy.com alardaacademy.com
amigoscode.com amigoscode.com
aquestacademy.com aquestacademy.com
archerymasterclass.com archerymasterclass.com
dfpworkshops.com dfpworkshops.com
audiencegrowers.com audiencegrowers.com
aviatorcloud.com aviatorcloud.com
avidbeer.com avidbeer.com
mindsetmasteryschool.com.au mindsetmasteryschool.com.au
ayam-es.education ayam-es.education
ayam.education ayam.education
ayunizate.com ayunizate.com
badassbusinessownerlearningcenter.com badassbusinessownerlearningcenter.com
energybreathmovement.com energybreathmovement.com
beabettercommunicator.com beabettercommunicator.com
bedrockuniversity.com bedrockuniversity.com
benchmarkingpluscourse.com benchmarkingpluscourse.com
beyondthefringecourses.com beyondthefringecourses.com
bharatvidya.in bharatvidya.in
bigplansacademy.com bigplansacademy.com
bigtechmentor.com bigtechmentor.com
biobaliainstituteschool.org biobaliainstituteschool.org
biologycarol.co.uk biologycarol.co.uk
bitcoininsider.io bitcoininsider.io
blockyfi.org blockyfi.org
bluespire.com bluespire.com
boardingschoolbasics.com boardingschoolbasics.com
boldfuture.me boldfuture.me
boldstep.fr boldstep.fr
focuspreneuracademy.com focuspreneuracademy.com
braindeadsimplecopy.com braindeadsimplecopy.com
brainiate.academy brainiate.academy
brainpilot.com.au brainpilot.com.au
brandster.com.br brandster.com.br
breakfreefromskinpicking.com breakfreefromskinpicking.com
buildingchildcareprofessionals.com buildingchildcareprofessionals.com
bunniespro.com bunniespro.com
butchercraft.com butchercraft.com
calvarydiscipleshiponline.org calvarydiscipleshiponline.org
camillamichettiyoga.com camillamichettiyoga.com
campusdocente.net campusdocente.net
caninescience.online caninescience.online
cardmakingschool.com cardmakingschool.com
casamaestraonline.com casamaestraonline.com
cathrinmanningevents.com cathrinmanningevents.com
cdb-university.com cdb-university.com
ceevirtual.com ceevirtual.com
diyschoolofmusic.com diyschoolofmusic.com
center4dignity.com center4dignity.com
champcademy.com champcademy.com
edgecate.com edgecate.com
ecomadsassault.com ecomadsassault.com
coffeebreakacademy.com coffeebreakacademy.com
lifestylemedicinesolutions.org lifestylemedicinesolutions.org
momentummxonline.com momentummxonline.com
fcsoftballschool.com fcsoftballschool.com
marcozanoniacademy.it marcozanoniacademy.it
deallawyerhq.com deallawyerhq.com
litprog.net litprog.net
armataraechandran.com armataraechandran.com
emotionalhelpcr.com emotionalhelpcr.com
modernshiatsu.com modernshiatsu.com
douus.com douus.com
ecomsecretsacademy.com ecomsecretsacademy.com
eedu.online eedu.online
academy.traego.com.mx academy.traego.com.mx
7natee.com 7natee.com
faber.academy faber.academy
femalemusicianacademy.com femalemusicianacademy.com
escuelacoyotipi.com escuelacoyotipi.com
fullyfundedmissionary.org fullyfundedmissionary.org
furniturecourse.com furniturecourse.com
futureofpeople.academy futureofpeople.academy
geography-lounge.com geography-lounge.com
gettingtotheprofits.com gettingtotheprofits.com
ghirasalaqeeda.com ghirasalaqeeda.com
mvclogisticsacademy.com mvclogisticsacademy.com
mdxelearning.com mdxelearning.com
globalsisterhoodschool.org globalsisterhoodschool.org
gnyanasangha.com gnyanasangha.com
mycampusvirtual.com mycampusvirtual.com
goldtraining.it goldtraining.it
gonefreeflying.com gonefreeflying.com
ibjja-online.com ibjja-online.com
grammar.cool grammar.cool
graphologyonline.com graphologyonline.com
gregorylandsmancourses.com gregorylandsmancourses.com
gregorylandsmantreatments.com gregorylandsmantreatments.com
gwctlearning.com gwctlearning.com
habits.ae habits.ae
godglamgoalsglobal.academy godglamgoalsglobal.academy
hairretailersacademy.com hairretailersacademy.com
fsboman.com fsboman.com
cursosclara.com cursosclara.com
healthphysics.academy healthphysics.academy
heartmaps.com heartmaps.com
hedacademy.fr hedacademy.fr
heylegal.co.uk heylegal.co.uk
hiddengemconsulting.com hiddengemconsulting.com
lylsecrets.com lylsecrets.com
houseofanthonyelle.com houseofanthonyelle.com
houseofwhite.net houseofwhite.net
hrwebsource.com hrwebsource.com
impactfreepreview.com impactfreepreview.com
itacademytraining.com itacademytraining.com
jaynespencerwatercolor.com jaynespencerwatercolor.com
jettrades.net jettrades.net
jobvise.net jobvise.net
avaniparenting.com avaniparenting.com
journeyintofascia.com journeyintofascia.com
juliaacademy.com juliaacademy.com
jumpstartitacademy.com jumpstartitacademy.com
disruptionu.com disruptionu.com
aptechjourneymanprep.com aptechjourneymanprep.com
kaariprehab.com kaariprehab.com
kabbalahbyheart.com kabbalahbyheart.com
kalendoleman.com kalendoleman.com
kalicurriculum.com kalicurriculum.com
kazoneonline.com kazoneonline.com
ken-rea.com ken-rea.com
kimkatglass.com kimkatglass.com
kindlestartup.academy kindlestartup.academy
knowledgette.com knowledgette.com
learn-ikigai.com learn-ikigai.com
kodigitalstudio.com kodigitalstudio.com
kodlama.io kodlama.io
kundalinibodywork.online kundalinibodywork.online
ec4allacademy.com ec4allacademy.com
learncatgrooming.com.au learncatgrooming.com.au
learningwithervin.com learningwithervin.com
learntheventure.com learntheventure.com
learnwithnesha.com learnwithnesha.com
learnworkwin.com learnworkwin.com
letsdrawtodayclub.com letsdrawtodayclub.com
jugglingcare.com jugglingcare.com
masterofdeals.io masterofdeals.io
magicka.academy magicka.academy
marketingschool.hk marketingschool.hk
fbafreedomcourse.com fbafreedomcourse.com
masstercursos.com masstercursos.com
medispeakonline.com medispeakonline.com
meiofrancesa.com meiofrancesa.com
mentorify.com mentorify.com
meurecall.com meurecall.com
moderncreativemoney.com moderncreativemoney.com
moneyzg.academy moneyzg.academy
morethancertified.com morethancertified.com
bernardogrillo.com bernardogrillo.com
familyfirstlifenewagentbootcamp.com familyfirstlifenewagentbootcamp.com
muslim-teachers.com muslim-teachers.com
mytoxtraining.com mytoxtraining.com
mamalucy.tw mamalucy.tw
mamiversity.com mamiversity.com
fmbs.biz fmbs.biz
hdsm.net hdsm.net
babylionhotshot.com babylionhotshot.com
embracingwoman.com embracingwoman.com
focustrainingcenter.es focustrainingcenter.es
millionairepoolman.com millionairepoolman.com
mudpuddlementalhealth.com mudpuddlementalhealth.com
matejaque.com matejaque.com
ffha.co.uk ffha.co.uk
ashokwellnessacademy.online ashokwellnessacademy.online
exploringeo.co exploringeo.co
courses.english.cool courses.english.cool
icm.training icm.training
jameskool.com jameskool.com
araby.academy araby.academy
mtponline.com.au mtponline.com.au
calimove.com calimove.com
dental-edx.com dental-edx.com
itim-online.com itim-online.com
diehlfineartacademy.com diehlfineartacademy.com
dailycontentideas.com dailycontentideas.com
paul-caicedo-s-school.teachable.com paul-caicedo-s-school.teachable.com
courses.digitalethos.academy courses.digitalethos.academy
coleman-gerhart-s-school.teachable.com coleman-gerhart-s-school.teachable.com
resinistasacademy.com resinistasacademy.com
fisherdrumming.com fisherdrumming.com
happineering.co happineering.co
1yofit.com 1yofit.com
dentalsims.com dentalsims.com
hastterapionline.com hastterapionline.com
course.milaneyebrow.tw course.milaneyebrow.tw
course.microblading.tw course.microblading.tw
menntunin.is menntunin.is
jianmingche.com jianmingche.com
givingnaamwellness.com givingnaamwellness.com
floauniversity.com floauniversity.com
learnmusicnomics.com learnmusicnomics.com
hker.dev hker.dev
learnersoftomorrow.com learnersoftomorrow.com
lerren.com lerren.com
learn.lonely.kitchen learn.lonely.kitchen
paypercallmasterclass.com paypercallmasterclass.com
phdsec.com phdsec.com
munmun.org munmun.org
growingwithjennifer.com growingwithjennifer.com
greatfuldad.com greatfuldad.com
global-classroom1.teachable.com global-classroom1.teachable.com
aswaqalmalacademy.com aswaqalmalacademy.com
gingerbreadarts.com gingerbreadarts.com
glidefastplus.com glidefastplus.com
goup-online.com goup-online.com
ACADEMIATRADUCTORES.COM
IP History

Click the IP addresses to see over domains using them.