Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

THB.ACADEMY

THB.ACADEMY
Shared Attributes
Domain
learnballetonline.com learnballetonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 357 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
marksmanacademy.org marksmanacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Dec 2024 Jan 2025 23 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 23 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 23 days
HP HP-318805607 Dec 2024 Jan 2025 23 days
michelleleeartsstudio.com michelleleeartsstudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Jan 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
miraclewordu.com miraclewordu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
psal.ms psal.ms
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
angelchatteracademy.com angelchatteracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 155 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
stackskills.com stackskills.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 25 days
HP HP-318805607 Jan 2025 Jan 2025 25 days
IC IC-318805607 Jan 2025 Jan 2025 25 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 25 days
codingfaculty.com codingfaculty.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
latindanceonline.com latindanceonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
leadgenacademy.courses leadgenacademy.courses
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
letslearnthistogether.com letslearnthistogether.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
levelupmvmt.com levelupmvmt.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
liveyourheartout.academy liveyourheartout.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
IC IC-318805607 Dec 2024 Jan 2025 6 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 6 days
HP HP-318805607 Dec 2024 Jan 2025 6 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
martinbrossmaninstitute.com martinbrossmaninstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
IC IC-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
moteefe.school moteefe.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
accurateenglishacademy.com accurateenglishacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 155 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
IC IC-318805607 Jan 2025 Jan 2025 11 days
HP HP-318805607 Jan 2025 Jan 2025 11 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
arlansacademy.com arlansacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 34 days
HP HP-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
alchemyu.org alchemyu.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 29 days
IC IC-318805607 Dec 2024 Jan 2025 29 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 29 days
HP HP-318805607 Dec 2024 Jan 2025 29 days
FS FS-318805607 Feb 2024 Feb 2024 One Off
anneorteleecourses.com anneorteleecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Feb 2024 258 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
acadianxu.com acadianxu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 3 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 5 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 5 days
IC IC-318805607 Jan 2025 Jan 2025 5 days
HP HP-318805607 Jan 2025 Jan 2025 5 days
certifiedondemand.com certifiedondemand.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
frenchwithvincent.com frenchwithvincent.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 341 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 14 days
IC IC-318805607 Dec 2024 Jan 2025 14 days
darbukaschool.com darbukaschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
getstartedplayingukulele.com getstartedplayingukulele.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 54 days
HP HP-318805607 Jan 2025 Jan 2025 9 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 9 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
guitarmy.net guitarmy.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
jobbsokerkoden.no jobbsokerkoden.no
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
acknowlink.com acknowlink.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
HP HP-318805607 Dec 2024 Jan 2025 29 days
IC IC-318805607 Dec 2024 Jan 2025 29 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 29 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
evolvefitnessofficial.com evolvefitnessofficial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
guitarpass.com guitarpass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 57 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
inspiredwordteaching.org inspiredwordteaching.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Mar 2024 42 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
lovemywombacademyonline.com lovemywombacademyonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Feb 2024 342 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
lowerlaptime.com lowerlaptime.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jan 2024 178 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 10 days
HP HP-318805607 Dec 2024 Jan 2025 10 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 10 days
IC IC-318805607 Dec 2024 Jan 2025 10 days
masteringlinting.com masteringlinting.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 20 days
HP HP-318805607 Jan 2025 Jan 2025 20 days
IC IC-318805607 Jan 2025 Jan 2025 20 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
mastinkippcoaching.com mastinkippcoaching.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 25 days
HP HP-318805607 Jan 2025 Jan 2025 25 days
IC IC-318805607 Jan 2025 Jan 2025 25 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
mikebauermusic.com mikebauermusic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
mitchellandstones.academy mitchellandstones.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 97 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
muttsandmischiefacademy.com muttsandmischiefacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
myacademyofsuccess.com myacademyofsuccess.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
myquitguide.com myquitguide.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
IC IC-318805607 Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 30 days
acromastermind.com acromastermind.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Jan 2025 Jan 2025 24 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 24 days
HP HP-318805607 Jan 2025 Jan 2025 24 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
amazoninterviewwhizzacademy.com amazoninterviewwhizzacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 302 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
staer.is staer.is
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
dalilkcourse.com dalilkcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
journeyintofascia.com journeyintofascia.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Jan 2024 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
lotphilanthropyu.com lotphilanthropyu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
mantelandtableacademy.com mantelandtableacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
markperrenjones.com markperrenjones.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
musicbycandl.com musicbycandl.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Jan 2024 308 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
mymodernagentu.com mymodernagentu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 314 days
HP HP-318805607 Jan 2025 Jan 2025 6 days
IC IC-318805607 Jan 2025 Jan 2025 6 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 6 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
learninggodstruth.com learninggodstruth.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
legionassistedlivingacademy.com legionassistedlivingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
menocourse.com menocourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 84 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
millermanschool.com millermanschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 38 days
IC IC-318805607 Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
mjsi.org mjsi.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
muaythaisecretonline.com muaythaisecretonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Jan 2025 Jan 2025 19 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 19 days
IC IC-318805607 Jan 2025 Jan 2025 19 days
beginblacksmithing.com beginblacksmithing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
FS FS-318805607 Jan 2023 Jan 2023 One Off
alstocktrades.com alstocktrades.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
a2etraining.com a2etraining.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 11 days
IC IC-318805607 Jan 2025 Jan 2025 11 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
haccptrainingonline.ie haccptrainingonline.ie
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
academievoorabstractefotografie.nl academievoorabstractefotografie.nl
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
HP HP-318805607 Dec 2024 Jan 2025 29 days
IC IC-318805607 Dec 2024 Jan 2025 29 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 29 days
fcaacademy.org fcaacademy.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 14 days
IC IC-318805607 Dec 2024 Jan 2025 14 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 14 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
academiademodas.com academiademodas.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
HP HP-318805607 Jan 2025 Jan 2025 18 days
IC IC-318805607 Jan 2025 Jan 2025 18 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
autismforteachers.com autismforteachers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
arabicyou.com arabicyou.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Jan 2025 25 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 25 days
HP HP-318805607 Dec 2024 Jan 2025 25 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
aiportalen.com aiportalen.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 18 days
HP HP-318805607 Jan 2025 Jan 2025 18 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 18 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
allshapefitness.com allshapefitness.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 12 days
IC IC-318805607 Jan 2025 Jan 2025 12 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 12 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
muslimfamilyacademy.com muslimfamilyacademy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 18 days
HP HP-318805607 Dec 2024 Jan 2025 18 days
IC IC-318805607 Dec 2024 Jan 2025 18 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
hayashi-shunsuke.com hayashi-shunsuke.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
FS FS-318805607 Mar 2023 Mar 2023 One Off
islamabuauf.com islamabuauf.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 5 days
HP HP-318805607 Dec 2024 Jan 2025 5 days
IC IC-318805607 Dec 2024 Jan 2025 5 days
teachable.com aditi-goyal-s-school.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
academiaesenciales.com academiaesenciales.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 11 days
HP HP-318805607 Jan 2025 Jan 2025 11 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
humbletheology.com humbletheology.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 22 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 22 days
IC IC-318805607 Dec 2024 Jan 2025 22 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 22 days
melodypalace.com melodypalace.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 25 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 25 days
HP HP-318805607 Jan 2025 Jan 2025 25 days
IC IC-318805607 Jan 2025 Jan 2025 25 days
elevatewithgisel.com elevatewithgisel.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
digestingwellnesscourses.com digestingwellnesscourses.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 5 days
IC IC-318805607 Dec 2024 Jan 2025 5 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 5 days
HP HP-318805607 Dec 2024 Jan 2025 5 days
ioncapacitacion.com ioncapacitacion.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
fatherhoodafterdivorce.com fatherhoodafterdivorce.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
elevarecodingcamp.com elevarecodingcamp.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
awakenintuition.us awakenintuition.us
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
sc.edu.ge sc.edu.ge
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
hunchocoaching.com hunchocoaching.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Jan 2025 19 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 19 days
HP HP-318805607 Dec 2024 Jan 2025 19 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
innerselfteachings.com innerselfteachings.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
florida-dealer-school.com florida-dealer-school.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
dad-academie.ca dad-academie.ca
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
latindanceshop.com latindanceshop.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Feb 2024 149 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
learndataengineering.com learndataengineering.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 299 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
learnfinearts.com learnfinearts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
lvbbi.com lvbbi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
moolmaninstitute.com moolmaninstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
mrquakersteaches.com mrquakersteaches.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Dec 2024 Jan 2025 18 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 18 days
HP HP-318805607 Dec 2024 Jan 2025 18 days
oxfordlearninglab.com oxfordlearninglab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Dec 2024 Jan 2025 30 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
homebuildersuniversity.com homebuildersuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
IC IC-318805607 Jan 2025 Jan 2025 21 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 21 days
HP HP-318805607 Jan 2025 Jan 2025 21 days
alignyourselftosuccessacademy.com alignyourselftosuccessacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
hackersacademy.ca hackersacademy.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 302 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
hustlebuddiesofficial.com hustlebuddiesofficial.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
FS FS-318805607 Nov 2023 Nov 2023 One Off
excelspeedwork.com excelspeedwork.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 19 days
HP HP-318805607 Jan 2025 Jan 2025 19 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 13 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
shibariclasses.com shibariclasses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 35 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
mingxin.one mingxin.one
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 6 days
IC IC-318805607 Jan 2025 Jan 2025 6 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 6 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
aiguruacademy.com aiguruacademy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 18 days
HP HP-318805607 Jan 2025 Jan 2025 18 days
IC IC-318805607 Jan 2025 Jan 2025 18 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
gut-ed.com gut-ed.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 18 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 18 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 18 days
HP HP-318805607 Jan 2025 Jan 2025 18 days
voip.school voip.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 72 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
fflamericabootcamp.com fflamericabootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Jan 2025 8 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 8 days
HP HP-318805607 Dec 2024 Jan 2025 8 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 2 days
hiyakucoaching.com hiyakucoaching.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
moutoncoach.com moutoncoach.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
sklab.io sklab.io
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 18 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 18 days
HP HP-318805607 Jan 2025 Jan 2025 18 days
IC IC-318805607 Jan 2025 Jan 2025 18 days
guitareality.com guitareality.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
impacflp.com impacflp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
mpe4prep.com mpe4prep.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
eyesopenacademy.com eyesopenacademy.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
mokalemaacademy.com mokalemaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
mbxax.school mbxax.school
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
animeresto.com animeresto.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
joyfulmatchingforyou.com joyfulmatchingforyou.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
detectordog.co.uk detectordog.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
moterusaviugdosmokykla.com moterusaviugdosmokykla.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
hostandcoach.com hostandcoach.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
asemsecuritymultiservice.com asemsecuritymultiservice.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
justbeachystudio.club justbeachystudio.club
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
warp-9.com warp-9.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 360 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 29 days
HP HP-318805607 Dec 2024 Jan 2025 29 days
IC IC-318805607 Dec 2024 Jan 2025 29 days
anjayamajiart.com anjayamajiart.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 34 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
foxland.ro foxland.ro
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 3 days
HP HP-318805607 Jan 2025 Jan 2025 3 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
bear.academy bear.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Jan 2025 Jan 2025 6 days
HP HP-318805607 Jan 2025 Jan 2025 6 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
aspireinstitute.tv aspireinstitute.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 347 days
IC IC-318805607 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
healthyuonline.org healthyuonline.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
heahealthhub.com heahealthhub.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
mrphysio.net mrphysio.net
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 5 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 5 days
IC IC-318805607 Dec 2024 Jan 2025 5 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
academiadeangeles.com academiadeangeles.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
HP HP-318805607 Jan 2025 Jan 2025 11 days
IC IC-318805607 Jan 2025 Jan 2025 11 days
sifcpd.com sifcpd.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
HP HP-318805607 Jan 2025 Jan 2025 24 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 24 days
IC IC-318805607 Jan 2025 Jan 2025 24 days
guitaros.com guitaros.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
appbrewery.com appbrewery.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 23 days
HP HP-318805607 Jan 2025 Jan 2025 23 days
IC IC-318805607 Jan 2025 Jan 2025 23 days
abdulacademy.com abdulacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
graphicinteriordesignschool.com graphicinteriordesignschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 76 days
HP HP-318805607 Jan 2025 Jan 2025 9 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 9 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
lawofattractionaccelerator.com lawofattractionaccelerator.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
IC IC-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
mentorship.one mentorship.one
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
IC IC-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
mayinedevelopmentcourses.com mayinedevelopmentcourses.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 1 day
IC IC-318805607 Jan 2025 Jan 2025 1 day
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 1 day
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
mecacfoacademy.com mecacfoacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 1 day
HP HP-318805607 Jan 2025 Jan 2025 1 day
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 1 day
IC IC-318805607 Jan 2025 Jan 2025 1 day
interventionacademy.com interventionacademy.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
executivepath.net executivepath.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
mazequest.org mazequest.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
groundedbyyoga.org groundedbyyoga.org
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
eivindfx.com eivindfx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
infosecschool.net infosecschool.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
fuerteaerialfitness.com fuerteaerialfitness.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 22 days
HP HP-318805607 Jan 2025 Jan 2025 22 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
internationalwellbeingacademy.com internationalwellbeingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
mbuzz.fr mbuzz.fr
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
fretsfordays.com fretsfordays.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 16 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 16 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
discoverasl.com discoverasl.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
diy-natural-livingwithshelly.com diy-natural-livingwithshelly.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
fbamasteryprogram.com fbamasteryprogram.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 14 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 14 days
IC IC-318805607 Dec 2024 Jan 2025 14 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
diligentdialers.com diligentdialers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
entrepreneurtraining.education entrepreneurtraining.education
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
hsbnschool.com hsbnschool.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
americandentalsedation.com americandentalsedation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
lescreateurs.video lescreateurs.video
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
mnairacademy.com mnairacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 92 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
growthschool.com growthschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 88 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 18 days
HP HP-318805607 Jan 2025 Jan 2025 18 days
IC IC-318805607 Jan 2025 Jan 2025 18 days
americanenglishuniversity.com americanenglishuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
getorganizedgal.com getorganizedgal.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 5 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
UA UA-44397410 Aug 2020 Aug 2020 One Off
globalsmallbusinessschool.com globalsmallbusinessschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 3 days
HP HP-318805607 Jan 2025 Jan 2025 3 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
academiaenergiasolar.com academiaenergiasolar.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Jan 2025 Jan 2025 11 days
IC IC-318805607 Jan 2025 Jan 2025 11 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
abawizard.net abawizard.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
HP HP-318805607 Jan 2025 Jan 2025 11 days
IC IC-318805607 Jan 2025 Jan 2025 11 days
FS FS-318805607 Jul 2023 Jul 2023 One Off
mybiomi.com mybiomi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 85 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
akademiagrowings.com akademiagrowings.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Jan 2025 Jan 2025 11 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
HP HP-318805607 Jan 2025 Jan 2025 11 days
adrianyanitaonline.com adrianyanitaonline.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 24 days
HP HP-318805607 Jan 2025 Jan 2025 24 days
IC IC-318805607 Jan 2025 Jan 2025 24 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
mindandbusiness.net mindandbusiness.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Jan 2024 29 days
IC IC-318805607 Jan 2025 Jan 2025 19 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 19 days
HP HP-318805607 Jan 2025 Jan 2025 19 days
interculturalireland.com interculturalireland.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
mentoriaprofetica.org mentoriaprofetica.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 76 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
learnwitheo.com learnwitheo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 301 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
deallawyerhq.com deallawyerhq.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 17 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 17 days
HP HP-318805607 Jan 2025 Jan 2025 17 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
moderncreativemoney.com moderncreativemoney.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
IC IC-318805607 Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
fbaunlocked.com fbaunlocked.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
jaymaasrecording.com jaymaasrecording.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 7 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 7 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 7 days
HP HP-318805607 Jan 2025 Jan 2025 7 days
hinemoanadance.com hinemoanadance.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
mvclogisticsacademy.com mvclogisticsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
drgreenhouseacademy.com drgreenhouseacademy.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
fitbosstribeschool.com fitbosstribeschool.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
intothechariot.com intothechariot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
designingwithchris.com designingwithchris.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
goup-online.com goup-online.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 27 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 27 days
IC IC-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
hashkueh.com hashkueh.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
dontimitateunderstand.com dontimitateunderstand.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
infiniterealmofdance.com infiniterealmofdance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 16 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 16 days
IC IC-318805607 Dec 2024 Jan 2025 16 days
HP HP-318805607 Dec 2024 Jan 2025 16 days
actrxtraining.com actrxtraining.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
HP HP-318805607 Jan 2025 Jan 2025 11 days
IC IC-318805607 Jan 2025 Jan 2025 11 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
examfacts.net examfacts.net
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
jameskool.com jameskool.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
flowersandassociates.courses flowersandassociates.courses
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
mohammedaldebi.com mohammedaldebi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
focuspreneuracademy.com focuspreneuracademy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 21 days
IC IC-318805607 Dec 2024 Jan 2025 21 days
HP HP-318805607 Dec 2024 Jan 2025 21 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
lifestylemedicinesolutions.org lifestylemedicinesolutions.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
egindicators.org egindicators.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
learn-martialarts.com learn-martialarts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
IC IC-318805607 Dec 2024 Jan 2025 23 days
HP HP-318805607 Dec 2024 Jan 2025 23 days
dementiabydayschool.com dementiabydayschool.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Dec 2024 2 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 2 days
HP HP-318805607 Dec 2024 Dec 2024 2 days
fbmusicacademy.com fbmusicacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
academianexoyoga.com academianexoyoga.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
escuelademagia.org escuelademagia.org
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
formazioneintegrata.com formazioneintegrata.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 9 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 9 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
girlgonecity.com girlgonecity.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 9 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 9 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
awakeinthedreamschool.com awakeinthedreamschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 95 days
HP HP-318805607 Jan 2025 Jan 2025 10 days
IC IC-318805607 Jan 2025 Jan 2025 10 days
learnhowtotrades.com learnhowtotrades.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
academyinnerknowing.com academyinnerknowing.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 11 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
IC IC-318805607 Jan 2025 Jan 2025 11 days
accountabilitycoachuniversity.com accountabilitycoachuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 5 days
HP HP-318805607 Jan 2025 Jan 2025 5 days
IC IC-318805607 Jan 2025 Jan 2025 5 days
acupuncturescholar.com acupuncturescholar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 24 days
HP HP-318805607 Jan 2025 Jan 2025 24 days
IC IC-318805607 Jan 2025 Jan 2025 24 days
incognito.dance incognito.dance
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
freightbroker911.training freightbroker911.training
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
IC IC-318805607 Dec 2024 Jan 2025 8 days
entsurgeryschool.com entsurgeryschool.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
encorecarestudentportal.com encorecarestudentportal.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
handeyeacademy.com handeyeacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
axethrowingempire.com axethrowingempire.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
floridacramslam.com floridacramslam.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
homebakingcroissant.com homebakingcroissant.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
modality.academy modality.academy
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 11 days
HP HP-318805607 Dec 2024 Jan 2025 11 days
IC IC-318805607 Dec 2024 Jan 2025 11 days
dougtempleton.com dougtempleton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
accountingwithindy.com accountingwithindy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 24 days
IC IC-318805607 Jan 2025 Jan 2025 24 days
HP HP-318805607 Jan 2025 Jan 2025 24 days
jamiezoegivens.com jamiezoegivens.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
ilmonlineclasses.com ilmonlineclasses.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
lapharmacie-coaching.com lapharmacie-coaching.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
feltonmusicschool.com feltonmusicschool.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
functionalfreediving.com functionalfreediving.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 63 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
daretolivecoaching.com daretolivecoaching.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
hackingmaang.com hackingmaang.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
jostai.com jostai.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 13 days
HP HP-318805607 Jan 2025 Jan 2025 13 days
IC IC-318805607 Jan 2025 Jan 2025 13 days
lifewealthcourses.com lifewealthcourses.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
lets3dsmax.com lets3dsmax.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
joynyabongo.com joynyabongo.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
atmavida.com atmavida.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
joskeadconsulting.com joskeadconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
escapewith.us escapewith.us
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
fitsitclasses.com fitsitclasses.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
atparentingsurvivalschool.com atparentingsurvivalschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
fireacademylive.com fireacademylive.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
darrenenglish.com darrenenglish.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
johncrickett.me johncrickett.me
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
faucettemedia.com faucettemedia.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
6minutespay.com 6minutespay.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
IC IC-318805607 Dec 2024 Jan 2025 30 days
mbacoachph.com mbacoachph.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 19 days
IC IC-318805607 Jan 2025 Jan 2025 19 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 19 days
elmetodo513.com elmetodo513.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
malikrezzoug.com codeveloppement.malikrezzoug.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 6 days
IC IC-318805607 Jan 2025 Jan 2025 6 days
HP HP-318805607 Jan 2025 Jan 2025 6 days
cib.team cib.team
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
harmonyhorsemanshipacademy.org harmonyhorsemanshipacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 49 days
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
masteringyourjobsearch.com masteringyourjobsearch.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 13 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 13 days
IC IC-318805607 Jan 2025 Jan 2025 13 days
fluentmedic.co fluentmedic.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
eden-smart.academy eden-smart.academy
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
earningyourownincome.com earningyourownincome.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
qtlab.it qtlab.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 26 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
mathkrumacosk128.com mathkrumacosk128.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 1 day
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 1 day
IC IC-318805607 Jan 2025 Jan 2025 1 day
frittsacademy.com frittsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 3 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 3 days
IC IC-318805607 Jan 2025 Jan 2025 One Off
anatma.com.mx anatma.com.mx
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
eflcurriculum.com eflcurriculum.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 8 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 8 days
IC IC-318805607 Dec 2024 Jan 2025 8 days
fflhnwbootcamp.com fflhnwbootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
icoach4kids.com icoach4kids.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
dkschoolofhypnosis.com dkschoolofhypnosis.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 4 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 4 days
IC IC-318805607 Jan 2025 Jan 2025 4 days
institutocietsi.com institutocietsi.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
digiocean.co.kr digiocean.co.kr
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
30daystosuccess.academy 30daystosuccess.academy
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 24 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 24 days
HP HP-318805607 Jan 2025 Jan 2025 24 days
mrphysio.com.au mrphysio.com.au
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
ddssuccess.com ddssuccess.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
emprenderimporta.com emprenderimporta.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
embodiedwoman.com embodiedwoman.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
dfo-training.com dfo-training.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
investishare.com investishare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
genuinesolutions.org genuinesolutions.org
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
itm-online.com itm-online.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Jan 2025 22 days
HP HP-318805607 Dec 2024 Jan 2025 22 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 22 days
developmentisland.com developmentisland.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
itim-online.com itim-online.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
abreuuniversityonline.com abreuuniversityonline.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 24 days
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 24 days
IC IC-318805607 Jan 2025 Jan 2025 24 days
learn-ikigai.com learn-ikigai.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
esadsaglamakademi.com esadsaglamakademi.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
momentummxonline.com momentummxonline.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
indemandspeaking.com indemandspeaking.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 2 days
IC IC-318805607 Jan 2025 Jan 2025 2 days
HP HP-318805607 Jan 2025 Jan 2025 2 days
familysuccessacademy.com familysuccessacademy.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
lvrgacademy.com lvrgacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
IC IC-318805607 Jan 2025 Jan 2025 25 days
HP HP-318805607 Jan 2025 Jan 2025 25 days
escuelacoyotipi.com escuelacoyotipi.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
integratedmeditationacademy.com integratedmeditationacademy.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
higherperformanceschools.com higherperformanceschools.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Dec 2024 One Off
IC IC-318805607 Dec 2024 Dec 2024 One Off
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
jonyquiroz.net jonyquiroz.net
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
familyfirstlifenewagentbootcamp.com familyfirstlifenewagentbootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
escueladirecta.com escueladirecta.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
coffeebreakacademy.com coffeebreakacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025 30 days
globalquality.academy globalquality.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
masterklassesonline.com masterklassesonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
HP HP-318805607 Jan 2025 Jan 2025 1 day
IC IC-318805607 Jan 2025 Jan 2025 1 day
gembaclub.com gembaclub.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
expertsecretsacademy.com expertsecretsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
fisherdrumming.com fisherdrumming.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
evolvedministry.org evolvedministry.org
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Dec 2024 One Off
HP HP-318805607 Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
dropshipmastery.com.au dropshipmastery.com.au
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
ametski.com ametski.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
febreuniversity.com febreuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com teachable.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Dec 2024 Jan 2025 5 days
HP HP-318805607 Dec 2024 Jan 2025 5 days
mtnsense.com mtnsense.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 33 days
UA UA-44397410 Aug 2020 Aug 2020 One Off
itherapist-seitai.com itherapist-seitai.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Jan 2025 Jan 2025 One Off
IC IC-318805607 Jan 2025 Jan 2025 One Off
fpmasterclass.com fpmasterclass.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
dogsconnectmentorship.com dogsconnectmentorship.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 24 days
IC IC-318805607 Dec 2024 Jan 2025 24 days
greverbalcourse.com greverbalcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
UA UA-44397410 Aug 2020 Aug 2020 One Off
lumierevirtual.com lumierevirtual.com
Attribute Value First Detected Last Detected Overlap Duration
IC IC-318805607 Jan 2025 Jan 2025 One Off
HP HP-318805607 Jan 2025 Jan 2025 One Off
freelstep.com freelstep.com
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 30 days
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
eskills.academy eskills.academy
Attribute Value First Detected Last Detected Overlap Duration
HP HP-318805607 Dec 2024 Jan 2025 30 days
IC IC-318805607 Dec 2024 Jan 2025 30 days
frenchdialogues.com frenchdialogues.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
betterbakingschool.com betterbakingschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
UA UA-44397410 Aug 2020 Aug 2020 One Off
peakhd.net peakhd.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Dec 2024 One Off
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Dec 2024 One Off
mosaicartsonline.com mosaicartsonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
agileprojectmanagementacademy.com agileprojectmanagementacademy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
NR NR-NRBR-08E3A2ADA38DC55A529 Jan 2025 Jan 2025 One Off
giraffemoves.com giraffemoves.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025 30 days
HP HP-318805607 Dec 2024 Jan 2025 30 days
itacademytraining.com itacademytraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
UA UA-44397410 Aug 2020 Aug 2020 One Off
kurdzone.org kurdzone.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
lashguyproacademy.com lashguyproacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
leafwingforprofessionals.org leafwingforprofessionals.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
leanover40formen.store leanover40formen.store
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2022 1 day
learnabee.com learnabee.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
learncredit.com learncredit.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
learningtheartlife.com learningtheartlife.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 79 days
learnjam.academy learnjam.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
learnmcas.com learnmcas.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 358 days
learnwithus.ca learnwithus.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 359 days
letterartacademy.com letterartacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
lidemy.com lidemy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
linguisticator.com linguisticator.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
linuxhint.biz linuxhint.biz
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
literaryadventuresforkids.com literaryadventuresforkids.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
lonecrowstudio.com lonecrowstudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 41 days
longevity.degree longevity.degree
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
lookerstudiobible.com lookerstudiobible.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Feb 2024 147 days
lotetreeacademy.com lotetreeacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Oct 2023 189 days
luminouslivingacademy.com luminouslivingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 51 days
lyndajanespiritschool.com lyndajanespiritschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
mabusinessuniversity.com mabusinessuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
machongate.net machongate.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Nov 2023 331 days
maconstyles.academy maconstyles.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2024 1 year, 18 days
maestroportillo.com maestroportillo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
magiclab.cl magiclab.cl
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
makemusicmoves.com makemusicmoves.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
makingsenseofsponsoredposts.com makingsenseofsponsoredposts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 19 days
mariaraczynska.com mariaraczynska.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 301 days
mastersandharris.com mastersandharris.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 1 day
mbcourses.org mbcourses.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 88 days
mdlive.net mdlive.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 52 days
medical-german.eu medical-german.eu
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
meehanhealthline.com meehanhealthline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 76 days
mentalwellbeingacademy.com mentalwellbeingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
metafutureschool.org metafutureschool.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
middleclassmusician.com middleclassmusician.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
millionairetraderssociety.com millionairetraderssociety.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
mindmuscles.academy mindmuscles.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 358 days
mintplusplus.ch mintplusplus.ch
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 64 days
mohab-tech.com mohab-tech.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
moreyouniversity.com moreyouniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 227 days
mountainfitnessschool.com mountainfitnessschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
moversup.org moversup.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
mpact.online mpact.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
mtpeducation.com mtpeducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Apr 2023 Feb 2024 328 days
muakk.tv muakk.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 28 days
multiplicationschool.com multiplicationschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
musclay.com musclay.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
musichabit.com musichabit.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
musicmasterclasses.be musicmasterclasses.be
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
musictherapyonline.org musictherapyonline.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
myarkview.org myarkview.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
mybodymycelebration.com mybodymycelebration.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
myccuonline.com myccuonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Mar 2024 274 days
myfoodmarketing.com myfoodmarketing.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
mynetworktraining.com mynetworktraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
myrecoveryportal.com myrecoveryportal.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
ncta.online ncta.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 357 days
newqi.live newqi.live
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ogc2go.com ogc2go.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 64 days
picaca.jp picaca.jp
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
preservethis.org preservethis.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
rhythm.academy rhythm.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
apprendr.com apprendr.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
abundanceacademy.online abundanceacademy.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
abyssimoartschool.com abyssimoartschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
aboutlittlehumans.com aboutlittlehumans.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
academiadesupervivencia.com academiadesupervivencia.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
aquariumclass.com aquariumclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Sep 2023 One Off
academiamaquisport.com academiamaquisport.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
actorsactacademy.com actorsactacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
ghionis.com ghionis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 15 days
arabicoders.com arabicoders.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 362 days
acepresentationschool.com acepresentationschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
adobe-educa.com adobe-educa.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
advanced-academy.com advanced-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 May 2023 One Off
agustinaalgorta.com agustinaalgorta.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
fashionlawstudio.com courses.fashionlawstudio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
airbrushonlineschool.com airbrushonlineschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ajmonics.com ajmonics.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 May 2023 One Off
altdeep.ai altdeep.ai
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
appliedgo.com appliedgo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
alphatutor.online alphatutor.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
algolab.so algolab.so
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 70 days
allthingsmathematics.com allthingsmathematics.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 31 days
amyscircle.com amyscircle.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
americancrochetassociation.com americancrochetassociation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 44 days
arminharris.com arminharris.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
animeartacademy.com animeartacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
andrewclarkeguitar.com andrewclarkeguitar.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
speakenglishwithtiffaniacademy.com speakenglishwithtiffaniacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
artcloud.com.mx artcloud.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
artmarketacademy.com artmarketacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Nov 2023 296 days
128academy.com 128academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 79 days
academiacosmetica.com academiacosmetica.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 358 days
academyhacker.com academyhacker.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
accountingcodingcamp.com accountingcodingcamp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
asiaforexmentoracademy.com asiaforexmentoracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
asvabsuccess.net asvabsuccess.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ats-hybrid.com ats-hybrid.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
audacitybootcamp.com audacitybootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
teplu.in teplu.in
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
awelivet.se awelivet.se
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 75 days
awsdevops.io awsdevops.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
ayoubbellabes.com ayoubbellabes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Apr 2023 Oct 2023 191 days
thewat.com thewat.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
barnstoneondemand.com barnstoneondemand.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
tmrise.com tmrise.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
basicfilmmakeruniversity.com basicfilmmakeruniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bassemschool.com bassemschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Mar 2024 303 days
beabeacon.lgbt beabeacon.lgbt
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 2 days
behavioranalytics.academy behavioranalytics.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
beingman.life beingman.life
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
bellabusinessschool.com bellabusinessschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 227 days
benbacal-academy.com benbacal-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 302 days
bennett-movement.com bennett-movement.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
bensguitarclub.com bensguitarclub.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Mar 2024 301 days
bestpossibleselfinstitute.com bestpossibleselfinstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bitcademy.org bitcademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 344 days
blackbeltbrokerage.com blackbeltbrokerage.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
blackonboardonline.org blackonboardonline.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 3 days
blendertoprinter.com blendertoprinter.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 358 days
vnysa.school vnysa.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bnb.university bnb.university
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
bosschicks247.com bosschicks247.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
bibleandworship.com bibleandworship.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
boxcollider.io boxcollider.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
brainacademy.com brainacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
wecnqr.com wecnqr.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
breadcourses.com breadcourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
breadlessons.com breadlessons.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
breemelanson-shop.com breemelanson-shop.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Mar 2024 45 days
brevitycoaching.com brevitycoaching.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
brigadeacademy.com brigadeacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
broadwaytowallstreet.com broadwaytowallstreet.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
buildlivable.com buildlivable.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bulletproofrunners.com bulletproofrunners.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
bushidouniversity.com bushidouniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
businessprotraining.es businessprotraining.es
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 302 days
cadmantraining.com cadmantraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
caid.org caid.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Feb 2024 145 days
capitariacursostrading.com capitariacursostrading.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
carriemillerpilates.com carriemillerpilates.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
carrytn.com carrytn.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ccelearn.org ccelearn.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 87 days
ccstarseeds.me ccstarseeds.me
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Aug 2023 Mar 2024 196 days
cdlpermit.study cdlpermit.study
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
centroestudioshebraicos.com centroestudioshebraicos.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
chalkright.com chalkright.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
chansam.online chansam.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
charlesandelinacademy.com charlesandelinacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
christianlearning.com christianlearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 363 days
cogni.school cogni.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
dojang.org dojang.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ead.tv ead.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 362 days
ealim.org ealim.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Feb 2024 146 days
greenfirstacademy.com greenfirstacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 316 days
fullstacklibrary.com fullstacklibrary.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
funatsumari-beautyacademy-onlineschool.com funatsumari-beautyacademy-onlineschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 153 days
gageacademy.net gageacademy.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
gaivna.com gaivna.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
gamejamschool.com gamejamschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
gamethinkingacademy.com gamethinkingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
gbdcollege.com gbdcollege.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
geigerandspence.com geigerandspence.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
genco.school genco.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
gestationaldiabetescourse.com gestationaldiabetescourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
getthespike.com getthespike.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 363 days
gigrocket.com gigrocket.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 334 days
glamaway.ca glamaway.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
googleadwordstutorial.com googleadwordstutorial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 358 days
govkidmethod.com govkidmethod.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
graphneuralnets.com graphneuralnets.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
groove2day.com groove2day.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 299 days
gsk-edu.com gsk-edu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 88 days
gymcademy.com gymcademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
hackyourbrainwithnlp.com hackyourbrainwithnlp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 62 days
halabellydance.com halabellydance.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 79 days
highticketelites.com highticketelites.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
hijamanationacademy.com hijamanationacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
hiswordhealstoday.net hiswordhealstoday.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
howtofreedive.com howtofreedive.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 30 days
hsbnschool.org hsbnschool.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Mar 2024 277 days
htdezignschool.com htdezignschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
hypnopower.us hypnopower.us
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 30 days
iceju.org iceju.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2024 1 year, 26 days
iso-gps.com iso-gps.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
istudyjapanese.com istudyjapanese.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
itakelessons.com itakelessons.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 76 days
ithahu.com ithahu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
jfbcodes.com jfbcodes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 35 days
jfdeducation.com jfdeducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
justudy.co.il justudy.co.il
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
kamalaleslie.com kamalaleslie.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
keyconceptsinstitute.com keyconceptsinstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
khasang.io khasang.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
kimmunity.com.au kimmunity.com.au
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
kitdaletraining.com kitdaletraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 309 days
kkcreditacademy.org kkcreditacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
kkxuniversity.com kkxuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 56 days
knackcourses.com knackcourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
knowmore.university knowmore.university
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
korzat.net korzat.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Aug 2023 Mar 2024 216 days
ojolly.net workshop.ojolly.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com youga.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
emilymadillcourses.com emilymadillcourses.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com zakaria.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com assetpro.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
companion.university companion.university
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
themusicolormethod.com classroom.themusicolormethod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com purpose31.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
donaldrobertson.name learn.donaldrobertson.name
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
sharpertrades.com learn.sharpertrades.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
imageinnovators.com academy.imageinnovators.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
jordancanova.com jordancanova.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 225 days
kafx.org kafx.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 55 days
karaz.academy karaz.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Dec 2023 188 days
katiesisk.com katiesisk.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Nov 2023 One Off
kevinfoong.co kevinfoong.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2023 111 days
khadijaacademy.com khadijaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
kinbaku-academy.com kinbaku-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 28 days
kitsapstrongconsulting.com kitsapstrongconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 May 2023 161 days
knittinginenglish.com knittinginenglish.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
koimartialart.com koimartialart.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
krvalues.com krvalues.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
kyleeanneducation.com kyleeanneducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
laboratoriodemovimiento.com laboratoriodemovimiento.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
laescueladepealpan.com laescueladepealpan.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Nov 2023 182 days
landlordcert.org landlordcert.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 361 days
launch-well.com launch-well.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
laviniabrowncourses.com laviniabrowncourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 1 day
lead2flow.nl lead2flow.nl
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
leadinforce-academy.com leadinforce-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 362 days
league-of-elites.com league-of-elites.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 41 days
learnfengshui.co.uk learnfengshui.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
learning-bytes.com learning-bytes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 25 days
learnthecut.com learnthecut.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
learnzonemedia.co.uk learnzonemedia.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
letityoga.it letityoga.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
letspaintflowers.com letspaintflowers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 356 days
letsrecover.co.uk letsrecover.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
lifedesignsociety.com lifedesignsociety.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
linglongchinese.com linglongchinese.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 364 days
literacytolife.com literacytolife.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
loogguitarschool.com loogguitarschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
loripalmquist.com loripalmquist.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 302 days
luxebrowngirltravels.com luxebrowngirltravels.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
luxuryfilmmaker.com luxuryfilmmaker.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
lydiafernandes.com lydiafernandes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Mar 2024 161 days
lymcapacitacion.com lymcapacitacion.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
mac-seminar.online mac-seminar.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
marcelacabrejos.com marcelacabrejos.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
markzguitar.com markzguitar.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Nov 2023 One Off
masterfulpainting.com masterfulpainting.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
mazentaichi.com mazentaichi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
mazori.com mazori.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 82 days
mcclanahanacademy.com mcclanahanacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
medix.education medix.education
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
mentality.work mentality.work
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
mervacademy.com mervacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
michelemavi.com michelemavi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
michelleraesobi.com michelleraesobi.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
middlemanagermagic.com middlemanagermagic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
mildorviolon.com mildorviolon.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 96 days
misiononline.com misiononline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
missionfx.us missionfx.us
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
mmcourses.co.uk mmcourses.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
mocktrialky.com mocktrialky.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
mojoversity.com mojoversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
momsquest.org momsquest.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
morimotostudio.com morimotostudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Jan 2024 114 days
mrotterstudio.com mrotterstudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 359 days
mteacademy.ca mteacademy.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 350 days
myautomationclass.com myautomationclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 30 days
mymusicalvoice.com mymusicalvoice.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
makeupfromscratchacademy.com makeupfromscratchacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 310 days
cei-ph.com cei-ph.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
pitec.la pitec.la
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 53 days
pornrebootprogram.com pornrebootprogram.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ppcs.nu ppcs.nu
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
ptype.academy ptype.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2024 1 year, 25 days
qifit.pl qifit.pl
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
focus5online.com focus5online.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
abbevilleacademy.org abbevilleacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
robertbakerguitar.com robertbakerguitar.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 60 days
classicalguitar-pro.com classicalguitar-pro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
abraham-education.com abraham-education.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
academiasemagro.com academiasemagro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 364 days
actualiseacademy.com actualiseacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
saguto.golf saguto.golf
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 57 days
afrolatinfunk.dance afrolatinfunk.dance
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
akasun.co.uk akasun.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
alselectronicclassroom.com alselectronicclassroom.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
shezer.org shezer.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
alexhitt.com alexhitt.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 64 days
alivewithyogaonline.com alivewithyogaonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
amzbusinesssociety.com amzbusinesssociety.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
americancraftsmanshopclass.com americancraftsmanshopclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
ametsuchi-dojo.org ametsuchi-dojo.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
skaled.academy skaled.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
animalcentrededucation.com animalcentrededucation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 85 days
aprendicesvisuales.com aprendicesvisuales.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
aptly.co aptly.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Feb 2024 143 days
artisanbakingcenter.com artisanbakingcenter.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
101value.net 101value.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
stoneriverelearning.com stoneriverelearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 61 days
aashishacademy.com aashishacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 65 days
academiadeimpacto.com academiadeimpacto.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
academyofcomposition.com academyofcomposition.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 360 days
academyrichcopy.com academyrichcopy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
teachable.com jadeoak.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
talmid.me talmid.me
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
authorgrow.com authorgrow.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
autoimmunetribecourses.com autoimmunetribecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 60 days
avatarenergymastery.com avatarenergymastery.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
aviationgroundschoolsonline.com aviationgroundschoolsonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
awesomepeopleleaders.com awesomepeopleleaders.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
theacl.club theacl.club
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
babilanka.com babilanka.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
banzenkanacademy.com banzenkanacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
beautymarketingacademy.com beautymarketingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
tpd15.com tpd15.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 360 days
beginnertomastery.com beginnertomastery.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2023 112 days
behaviorcompassacademy.com behaviorcompassacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 2 days
benshorts.com benshorts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bestme.today bestme.today
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
bettertradingportal.com bettertradingportal.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
bewusstes-golf.academy bewusstes-golf.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 224 days
bgcacademy.com bgcacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
uog.training uog.training
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
billionplg.com billionplg.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
bizimkimyamiz.com bizimkimyamiz.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
bkeiei.com bkeiei.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
blackbusinessu.com blackbusinessu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
blessedtosell.com blessedtosell.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 62 days
vidyapitha.in vidyapitha.in
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bluelight.academy bluelight.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
vmat.edu.vn vmat.edu.vn
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
bodyart.training bodyart.training
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
vulf.co vulf.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Feb 2024 87 days
brailleskateuniversity.com brailleskateuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
bscholarshipclass.com bscholarshipclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Jan 2024 One Off
buddytutorial.com buddytutorial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 360 days
wndx.school wndx.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 301 days
bumpintoosteo.com.au bumpintoosteo.com.au
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Feb 2024 336 days
bvotaekwondo.com bvotaekwondo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 May 2023 Mar 2024 307 days
cactus-school.online cactus-school.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
campusdigitaldeespecialistas.com campusdigitaldeespecialistas.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
canadianlaserinstitute.ca canadianlaserinstitute.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
capacitypluscourse.com capacitypluscourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
cardandcraftacademy.com cardandcraftacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 56 days
carlottacastangiayoga.com carlottacastangiayoga.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
catalystartlab.com catalystartlab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
caveofprogramming.com caveofprogramming.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 62 days
celldreameracademy.com celldreameracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
cempschool.com cempschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
certv.org certv.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 360 days
ceusforteachers.com ceusforteachers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
chabakatarab.com chabakatarab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
championsofinfluence.com championsofinfluence.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
chartslogic.com chartslogic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
collaboration.coach collaboration.coach
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
cherishartzcreative.com cherishartzcreative.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 30 days
codebh.fr codebh.fr
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Mar 2024 251 days
shopline.tw course.shopline.tw
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
cpaweb.org.uk cpaweb.org.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
criticalthinkeracademy.com criticalthinkeracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 61 days
developedbyed.com developedbyed.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
digitalabcd.com digitalabcd.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 36 days
easyt.online easyt.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 33 days
eltjam.academy eltjam.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
goldeneggsfertility.com goldeneggsfertility.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
fbcti.org fbcti.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 4 days
filmsimplified.com filmsimplified.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Sep 2023 298 days
gadha.ae gadha.ae
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
garyscourse.com garyscourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 59 days
getpublishedcourse.com getpublishedcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
glowforgeforbeginners.com glowforgeforbeginners.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
gmalasereducation.com gmalasereducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 37 days
godpreneuracademy.com godpreneuracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
gothink.tv gothink.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 358 days
graebert.academy graebert.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Mar 2024 7 days
greatgutguide.com greatgutguide.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
gsaacademy.com gsaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
guitarinstitute.it guitarinstitute.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
gytocourses.com gytocourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
haleyramsey.com haleyramsey.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2023 One Off
happybackyoga.com happybackyoga.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 67 days
harmony-life-academy.com harmony-life-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 1 day
homeschool-university.com homeschool-university.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year
homeschoolbuyer.com homeschoolbuyer.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
horsebosses.com horsebosses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
howsongsaremade.com howsongsaremade.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 302 days
hrponlinelearning.com hrponlinelearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
humain360.com humain360.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
huntingcamp.live huntingcamp.live
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
idlab.school idlab.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 96 days
idsei.com idsei.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
istitutolavoro.net istitutolavoro.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
iteachone.org iteachone.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 5 days
jessicacere.com jessicacere.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
jgaitpro.com jgaitpro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
jlglobaltech.com jlglobaltech.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Nov 2023 247 days
joinmeetkevin.com joinmeetkevin.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
tribulationsdemarie.com cours.tribulationsdemarie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
instabossclub.com instabossclub.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 1 day
theominstitute.com members.theominstitute.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
rachelvonsturmer.com courses.rachelvonsturmer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com rickpaddock.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
usingvisualisation.com usingvisualisation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
creativekina.com learn.creativekina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
usefedora.com speakerslab.usefedora.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
mcleayworkshops.co.nz mcleayworkshops.co.nz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
acadegenius.co.uk acadegenius.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2023 One Off
activcaretraining.com activcaretraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 93 days
activehope.training activehope.training
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
accordarelabatteria.it accordarelabatteria.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
sagelogica.com sagelogica.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
advancedalignertraining.com advancedalignertraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
agaartstudioclasses.com agaartstudioclasses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
aikiuniversity.com aikiuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 301 days
aircraftprofit.com aircraftprofit.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 76 days
teachable.com annaakbari.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
alqamiedu.com alqamiedu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 54 days
alexandrian.academy alexandrian.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
algoaddict.com algoaddict.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 303 days
algopro.ai algopro.ai
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 31 days
allthingsendo.ca allthingsendo.ca
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
teachable.com gokp.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
amazonmokymai.lt amazonmokymai.lt
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
skilly.co.il skilly.co.il
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
artoflivingwell.org.uk artoflivingwell.org.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 360 days
artofyoubellydance.com artofyoubellydance.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 45 days
anywherestartup.com anywherestartup.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 59 days
edityourlandscapes.com edityourlandscapes.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 58 days
guitarinvadersacademy.net guitarinvadersacademy.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 One Off
enjoyrealenglish.com enjoyrealenglish.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Apr 2023 Mar 2024 329 days
apegcommunity.com apegcommunity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
stages.academy stages.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
1600.io 1600.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
aammlearning.com aammlearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
academiaimperial.com academiaimperial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
academiatrencadis.com academiatrencadis.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
academiehsa.com academiehsa.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
academy-chiekoegged.com academy-chiekoegged.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
aliboucoding.com aliboucoding.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 92 days
apprendre-java.com apprendre-java.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
aprendecontabella.com aprendecontabella.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
assessport-academy.com assessport-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
tetmo.com tetmo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
feldenkrais-akademie.com feldenkrais-akademie.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
autotrading.vip autotrading.vip
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
avotek-online.com avotek-online.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 361 days
axtonliu.ai axtonliu.ai
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
azlansensei-e-learning.com azlansensei-e-learning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
baileylineroadlearning.com baileylineroadlearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
baytalmosawer.online baytalmosawer.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
befit4akhirah.com befit4akhirah.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
bellpianopopcourseonline.com bellpianopopcourseonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
benatural.com.sg benatural.com.sg
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
benjajap.com benjajap.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
benlevinmusicschool.com benlevinmusicschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
turnkeyrentals101.com turnkeyrentals101.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2023 108 days
beyondtheboxacademy.com beyondtheboxacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 345 days
billhelmtuina.com billhelmtuina.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
billyphillips.com billyphillips.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
teachable.com topdogs.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
bitwisecourses.com bitwisecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
blackexpertsempire.com blackexpertsempire.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
blendeducation.org blendeducation.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
blockchainbloom.com blockchainbloom.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 63 days
bloggingbootcamp.com bloggingbootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
boarddirectortraining.com boarddirectortraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bobbielyonscaninecampus.com bobbielyonscaninecampus.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
boldexpressivepaintingworkshops.com boldexpressivepaintingworkshops.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
borderstatesecuritytraining.com borderstatesecuritytraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
brainery.io brainery.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bravobellabras.com bravobellabras.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 86 days
breakthroughfreelancing.com breakthroughfreelancing.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
brokentobalanced.com brokentobalanced.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 89 days
budeducation.com budeducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
businessprofitimprovementplan.com businessprofitimprovementplan.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 27 days
bynadiablanco.com bynadiablanco.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
cafezinhobrasileiro.com cafezinhobrasileiro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
cameducation.co.uk cameducation.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 46 days
campus-ateneojazz.com campus-ateneojazz.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 27 days
campus-ribas.com campus-ribas.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
campusparentesis.com campusparentesis.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 90 days
canopy.games canopy.games
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
caramiller.com caramiller.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2022 One Off
casasdeoracion.online casasdeoracion.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
catherineedwardsacademy.com catherineedwardsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
centering.life centering.life
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
cfoo-education.com cfoo-education.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
changewithcolleen.com changewithcolleen.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Mar 2024 7 days
childhoodtraumainstitute.com childhoodtraumainstitute.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
codewithmosh.com codewithmosh.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 31 days
creator.school creator.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
devs.online devs.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 350 days
doe1.org doe1.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2022 One Off
dropshippingtitans.com dropshippingtitans.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 53 days
globalriskacademy.com globalriskacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
encafe.org encafe.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
fscourses.com fscourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 358 days
gaeilgelejane.com gaeilgelejane.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
gateway.university gateway.university
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 63 days
gavinlund.co.za gavinlund.co.za
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 78 days
getoffyouracidacademy.com getoffyouracidacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2023 108 days
gettingguru.com gettingguru.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
mographmentor.com mographmentor.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Oct 2023 One Off
globalcte.com globalcte.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
globalneurosurgicalalliance.com globalneurosurgicalalliance.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Aug 2023 Mar 2024 216 days
gonego.co gonego.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 62 days
grazeu.com grazeu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
greenzebra.online greenzebra.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
gregoryblumberg-bootcamp.com gregoryblumberg-bootcamp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2023 114 days
griffinandbellvision.com griffinandbellvision.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
growonthreads.com growonthreads.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 229 days
guitarensemblemethod.com guitarensemblemethod.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
guitarlessons.nyc guitarlessons.nyc
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
haircamphomeedition.com haircamphomeedition.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 311 days
healthiveacademy.com healthiveacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
highlevelknowledge.com highlevelknowledge.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
holistichealthblueprint.com holistichealthblueprint.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 144 days
homeofsound.co.uk homeofsound.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
houseofyogavirtual.com houseofyogavirtual.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 88 days
human-insight-academy.com human-insight-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
hypnosis-institute-mariani.com hypnosis-institute-mariani.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2024 1 year, 13 days
iltdp.com iltdp.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
iyengaronline.it iyengaronline.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
jamespang-tutorial.com jamespang-tutorial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 29 days
janechippsart.school janechippsart.school
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
jennicrowther.co.uk jennicrowther.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 92 days
jmguitarlessons.com jmguitarlessons.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 75 days
jorgemochon.academy jorgemochon.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 298 days
jptnailacademy.com jptnailacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
juniorycarolina.com juniorycarolina.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 303 days
kidzygo.com kidzygo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 86 days
insiderlessons.com insiderlessons.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Feb 2024 148 days
kizentraining.com kizentraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
jenniferrayecourses.com jenniferrayecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
knxacademy.com knxacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
kodikaitradescourse.com kodikaitradescourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
kurser-for-par.dk kurser-for-par.dk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
kyle.care kyle.care
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ladyesha.com ladyesha.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 352 days
lauraandscott.com lauraandscott.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
leadingedgedogshowacademy.com leadingedgedogshowacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 45 days
leadingedgegroomingacademy.com leadingedgegroomingacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
learn.physio learn.physio
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
learningritual.com learningritual.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 357 days
learnitanytime.com learnitanytime.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Oct 2023 237 days
learnthemagicofpaper.com learnthemagicofpaper.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 364 days
linglongchinois.com linglongchinois.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Oct 2023 244 days
livingarchitectureacademy.com livingarchitectureacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 310 days
lizscullytraining.com lizscullytraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Feb 2024 333 days
loonextrading.com loonextrading.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
loveyourbusinessschool.com loveyourbusinessschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
loyallactation.com loyallactation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
makemoneywithcredit.com makemoneywithcredit.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
makingsenseofaffiliatemarketing.com makingsenseofaffiliatemarketing.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 26 days
manosfilippou.com manosfilippou.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Dec 2023 300 days
markethustleacademy.com markethustleacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 22 days
maskilim.org maskilim.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
master-jpcuisine.com master-jpcuisine.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
mastersinlife.com mastersinlife.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
mastery.business mastery.business
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
mentefeliz.org mentefeliz.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 84 days
metodofourstartup.com metodofourstartup.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
michaelandrewlawdojo.com michaelandrewlawdojo.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
miiedu.com miiedu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
mindbaracademy.com mindbaracademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 363 days
mindrenewalschool.com mindrenewalschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Oct 2023 117 days
minervaeducacionfinanciera.mx minervaeducacionfinanciera.mx
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Oct 2023 239 days
mmi-members.com mmi-members.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 360 days
moderncalligraphy101.com moderncalligraphy101.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
mom-sports.com mom-sports.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 364 days
moneyintelligenceacademy.com moneyintelligenceacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Oct 2023 240 days
mongymenligne.com mongymenligne.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
moteefearabic.com moteefearabic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
mountaindulcimeratoz.com mountaindulcimeratoz.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
moystudio.online moystudio.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
mrflynnib.com mrflynnib.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Feb 2024 1 year, 25 days
mwgcourses.com mwgcourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 31 days
myfoodsafetytutor.com myfoodsafetytutor.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2023 One Off
myteachinghero.com myteachinghero.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
netecdigital.com netecdigital.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 53 days
synchroshaktiacademy.com synchroshaktiacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
opx360.com opx360.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
planancial.com planancial.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
polygonrunway.com polygonrunway.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
prop.academy prop.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
thehairextensionacademy.com thehairextensionacademy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
annathea.org learn.annathea.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
moneycoachuniversity.com moneycoachuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
primateacademy.com primateacademy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com skillvillefi.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com explorare.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
teachable.com godandgoals.teachable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
responsibilitytoday.com responsibilitytoday.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
ahmed-fitness.com ahmed-fitness.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-SL8LSCXHSV Jan 2025 Jan 2025 11 days
terrickahardy.com terrickahardy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
academyofpurpose.org academyofpurpose.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
academiadeamorpropio.com academiadeamorpropio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 89 days
actorsspark.com actorsspark.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
sandia.co.za sandia.co.za
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
advanced-plc.com advanced-plc.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
doordata.tw school.doordata.tw
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
agencyacceleratorcourse.com agencyacceleratorcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 350 days
agenyz.tv agenyz.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ailymphatic.com ailymphatic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Feb 2024 219 days
allen-bradley-plc-training.com allen-bradley-plc-training.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
ashleymethodedu.com ashleymethodedu.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
alflow.net alflow.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
amazonsellerpros.com amazonsellerpros.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
aartoday.com aartoday.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
academiatraductores.com academiatraductores.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 50 days
adobetechacademy.com adobetechacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
alardaacademy.com alardaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
amigoscode.com amigoscode.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 301 days
aquestacademy.com aquestacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
archerymasterclass.com archerymasterclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
audiencegrowers.com audiencegrowers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
aviatorcloud.com aviatorcloud.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
avidbeer.com avidbeer.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
awesomeartschool.com awesomeartschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 310 days
ayam-es.education ayam-es.education
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 56 days
ayam.education ayam.education
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 59 days
ayunizate.com ayunizate.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
azizbashaacademy.com azizbashaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 359 days
badassbusinessownerlearningcenter.com badassbusinessownerlearningcenter.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Apr 2023 116 days
balkanarchitect.com balkanarchitect.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Dec 2023 334 days
beabettercommunicator.com beabettercommunicator.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
bedrockuniversity.com bedrockuniversity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
benchmarkingpluscourse.com benchmarkingpluscourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
benja.hk benja.hk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 93 days
beyondthefringecourses.com beyondthefringecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
bharatvidya.in bharatvidya.in
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
bigplansacademy.com bigplansacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 80 days
bigtechmentor.com bigtechmentor.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
biobaliainstituteschool.org biobaliainstituteschool.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
biologycarol.co.uk biologycarol.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 91 days
bitcoininsider.io bitcoininsider.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year
blockyfi.org blockyfi.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Feb 2024 84 days
bluespire.com bluespire.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 108 days
boardingschoolbasics.com boardingschoolbasics.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
boldfuture.me boldfuture.me
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
boldstep.fr boldstep.fr
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Mar 2024 271 days
bradwhisnant.com bradwhisnant.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
braindeadsimplecopy.com braindeadsimplecopy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
brainiate.academy brainiate.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
brainpilot.com.au brainpilot.com.au
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
brandster.com.br brandster.com.br
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
breakfreefromskinpicking.com breakfreefromskinpicking.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
buildingchildcareprofessionals.com buildingchildcareprofessionals.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 1 day
bunniespro.com bunniespro.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
butchercraft.com butchercraft.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
calvarydiscipleshiponline.org calvarydiscipleshiponline.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
camillamichettiyoga.com camillamichettiyoga.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 3 days
campusdocente.net campusdocente.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
caninescience.online caninescience.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
cardmakingschool.com cardmakingschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
yoohoo.academy yoohoo.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
youtap.education youtap.education
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
casamaestraonline.com casamaestraonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
cathrinmanningevents.com cathrinmanningevents.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 94 days
cdb-university.com cdb-university.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 339 days
ceevirtual.com ceevirtual.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
center4dignity.com center4dignity.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
champcademy.com champcademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2024 Jan 2024 One Off
edgecate.com edgecate.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 3 days
cheekyschool.com cheekyschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 59 days
douus.com douus.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
ecomsecretsacademy.com ecomsecretsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
edrone.academy edrone.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
eedu.online eedu.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 299 days
faber.academy faber.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
femalemusicianacademy.com femalemusicianacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
fullyfundedmissionary.org fullyfundedmissionary.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 34 days
furniturecourse.com furniturecourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 54 days
futureofpeople.academy futureofpeople.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
garyclarke.tech garyclarke.tech
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 362 days
geography-lounge.com geography-lounge.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
gettingtotheprofits.com gettingtotheprofits.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 4 days
ghirasalaqeeda.com ghirasalaqeeda.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
giftedsocietyacademy.org giftedsocietyacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
globalsisterhoodschool.org globalsisterhoodschool.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
gnyanasangha.com gnyanasangha.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 302 days
goldtraining.it goldtraining.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 86 days
gonefreeflying.com gonefreeflying.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 34 days
graceincolorclassroom.com graceincolorclassroom.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
grammar.cool grammar.cool
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
graphologyonline.com graphologyonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2023 Mar 2024 341 days
gregorylandsmancourses.com gregorylandsmancourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 85 days
gregorylandsmantreatments.com gregorylandsmantreatments.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
groomadogcourse.com groomadogcourse.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
growinginchrist.com growinginchrist.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 301 days
gwctlearning.com gwctlearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
habits.ae habits.ae
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
hairretailersacademy.com hairretailersacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 226 days
healthphysics.academy healthphysics.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 1 day
heartmaps.com heartmaps.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 5 days
hedacademy.fr hedacademy.fr
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 46 days
heylegal.co.uk heylegal.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
hiddengemconsulting.com hiddengemconsulting.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 357 days
houseofanthonyelle.com houseofanthonyelle.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
houseofwhite.net houseofwhite.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 80 days
hrwebsource.com hrwebsource.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
impactfreepreview.com impactfreepreview.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
iuda.dance iuda.dance
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
jaynespencerwatercolor.com jaynespencerwatercolor.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
jettrades.net jettrades.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 83 days
jfdplus.com jfdplus.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
jobvise.net jobvise.net
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Jul 2023 One Off
juliaacademy.com juliaacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
jumpstartitacademy.com jumpstartitacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 79 days
kaariprehab.com kaariprehab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
kabbalahbyheart.com kabbalahbyheart.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
kalendoleman.com kalendoleman.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Feb 2023 One Off
kalicurriculum.com kalicurriculum.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
kazoneonline.com kazoneonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Dec 2023 1 year, 2 days
ken-rea.com ken-rea.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 151 days
kimkatglass.com kimkatglass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
kindlestartup.academy kindlestartup.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
kisss.academy kisss.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jun 2023 Dec 2023 188 days
knowledgette.com knowledgette.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
kodigitalstudio.com kodigitalstudio.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
kodlama.io kodlama.io
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 83 days
kpi.academy kpi.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
kundalinibodywork.online kundalinibodywork.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 85 days
learncatgrooming.com.au learncatgrooming.com.au
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 66 days
learningcrypto.co.uk learningcrypto.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Jan 2023 1 day
learningwithervin.com learningwithervin.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
learnmagic.com learnmagic.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Mar 2024 Mar 2024 One Off
learntheventure.com learntheventure.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
learnwithnesha.com learnwithnesha.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2024 1 year, 33 days
learnworkwin.com learnworkwin.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 34 days
letsdrawtodayclub.com letsdrawtodayclub.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 301 days
lilibarbery.tv lilibarbery.tv
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 86 days
lilium.academy lilium.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 77 days
lionahottaschool.com lionahottaschool.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 35 days
lisapowers.courses lisapowers.courses
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 85 days
lissarankinmd.com lissarankinmd.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
littlelighthouseacademy.org littlelighthouseacademy.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Oct 2023 Mar 2024 152 days
livetantraacademy.com livetantraacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
loftylearning.com loftylearning.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 87 days
lorenzofiorentino-corsi.it lorenzofiorentino-corsi.it
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
lovedaphnemaecourses.com lovedaphnemaecourses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 54 days
lovelybylindsey-bridalhaireducation.com lovelybylindsey-bridalhaireducation.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
lovingright.co lovingright.co
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 84 days
lucysartlab.com lucysartlab.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
jugglingcare.com jugglingcare.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Mar 2024 89 days
magicka.academy magicka.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Sep 2023 Mar 2024 162 days
marketinginblack.com marketinginblack.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 82 days
marketingschool.hk marketingschool.hk
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
martialartscenter.de martialartscenter.de
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 81 days
martingureasko.com martingureasko.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
masstercursos.com masstercursos.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Jan 2023 55 days
matusnursingreviewacademy.com matusnursingreviewacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2023 Mar 2024 1 year, 29 days
media101.org media101.org
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
medispeakonline.com medispeakonline.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
meiofrancesa.com meiofrancesa.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Feb 2024 Feb 2024 One Off
mentorify.com mentorify.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 84 days
meurecall.com meurecall.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 339 days
mindsetclasses.com mindsetclasses.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
moneyzg.academy moneyzg.academy
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 78 days
morethancertified.com morethancertified.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2023 Dec 2023 One Off
multisensorymath.online multisensorymath.online
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2023 56 days
muslim-teachers.com muslim-teachers.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
mxgraphics-academy.com mxgraphics-academy.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 299 days
myonlinecnaplatform.com myonlinecnaplatform.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 300 days
mytoxtraining.com mytoxtraining.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jul 2023 Mar 2024 225 days
myyogatime.com myyogatime.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 85 days
marcotafelli.com marcotafelli.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 88 days
millionairepoolman.com millionairepoolman.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
paypercallmasterclass.com paypercallmasterclass.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Feb 2024 1 year, 76 days
phdsec.com phdsec.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Mar 2024 1 year, 89 days
praxiscenterforaestheticstudies.com praxiscenterforaestheticstudies.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Jan 2023 Mar 2024 1 year, 58 days
gingerbreadarts.com gingerbreadarts.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Nov 2023 Mar 2024 98 days
glidefastplus.com glidefastplus.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Nov 2023 356 days
imgroadmap.com imgroadmap.com
Attribute Value First Detected Last Detected Overlap Duration
FS FS-318805607 Dec 2022 Oct 2023 299 days
thesimpletarot.com learn.thesimpletarot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
proemcees.com proemcees.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
nassfit.com nassfit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
ryansmethod.com ryansmethod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-44397410 Aug 2020 Aug 2020 One Off
THB.ACADEMY
Non IP Attributes
Attribute First Last
FS FS-318805607 Dec 2022 Mar 2024
HP HP-318805607 Dec 2024 Jan 2025
NR NR-NRBR-08E3A2ADA38DC55A529 Dec 2024 Jan 2025
GTM GTM-G-SL8LSCXHSV Dec 2024 Jan 2025
IC IC-318805607 Dec 2024 Jan 2025
UA UA-44397410 Aug 2020 Aug 2020
THB.ACADEMY
Overlap Attribute Domains
thb.academy thb.academy
learnballetonline.com learnballetonline.com
marksmanacademy.org marksmanacademy.org
michelleleeartsstudio.com michelleleeartsstudio.com
miraclewordu.com miraclewordu.com
psal.ms psal.ms
angelchatteracademy.com angelchatteracademy.com
stackskills.com stackskills.com
codingfaculty.com codingfaculty.com
latindanceonline.com latindanceonline.com
leadgenacademy.courses leadgenacademy.courses
letslearnthistogether.com letslearnthistogether.com
levelupmvmt.com levelupmvmt.com
liveyourheartout.academy liveyourheartout.academy
martinbrossmaninstitute.com martinbrossmaninstitute.com
moteefe.school moteefe.school
accurateenglishacademy.com accurateenglishacademy.com
arlansacademy.com arlansacademy.com
alchemyu.org alchemyu.org
anneorteleecourses.com anneorteleecourses.com
acadianxu.com acadianxu.com
certifiedondemand.com certifiedondemand.com
frenchwithvincent.com frenchwithvincent.com
darbukaschool.com darbukaschool.com
getstartedplayingukulele.com getstartedplayingukulele.com
guitarmy.net guitarmy.net
jobbsokerkoden.no jobbsokerkoden.no
acknowlink.com acknowlink.com
evolvefitnessofficial.com evolvefitnessofficial.com
guitarpass.com guitarpass.com
inspiredwordteaching.org inspiredwordteaching.org
lovemywombacademyonline.com lovemywombacademyonline.com
lowerlaptime.com lowerlaptime.com
masteringlinting.com masteringlinting.com
mastinkippcoaching.com mastinkippcoaching.com
mikebauermusic.com mikebauermusic.com
mitchellandstones.academy mitchellandstones.academy
muttsandmischiefacademy.com muttsandmischiefacademy.com
myacademyofsuccess.com myacademyofsuccess.com
myquitguide.com myquitguide.com
acromastermind.com acromastermind.com
amazoninterviewwhizzacademy.com amazoninterviewwhizzacademy.com
staer.is staer.is
dalilkcourse.com dalilkcourse.com
journeyintofascia.com journeyintofascia.com
lotphilanthropyu.com lotphilanthropyu.com
mantelandtableacademy.com mantelandtableacademy.com
markperrenjones.com markperrenjones.com
musicbycandl.com musicbycandl.com
mymodernagentu.com mymodernagentu.com
learninggodstruth.com learninggodstruth.com
legionassistedlivingacademy.com legionassistedlivingacademy.com
menocourse.com menocourse.com
millermanschool.com millermanschool.com
mjsi.org mjsi.org
muaythaisecretonline.com muaythaisecretonline.com
beginblacksmithing.com beginblacksmithing.com
alstocktrades.com alstocktrades.com
a2etraining.com a2etraining.com
haccptrainingonline.ie haccptrainingonline.ie
academievoorabstractefotografie.nl academievoorabstractefotografie.nl
fcaacademy.org fcaacademy.org
academiademodas.com academiademodas.com
autismforteachers.com autismforteachers.com
arabicyou.com arabicyou.com
aiportalen.com aiportalen.com
allshapefitness.com allshapefitness.com
muslimfamilyacademy.com muslimfamilyacademy.com
hayashi-shunsuke.com hayashi-shunsuke.com
islamabuauf.com islamabuauf.com
aditi-goyal-s-school.teachable.com aditi-goyal-s-school.teachable.com
academiaesenciales.com academiaesenciales.com
humbletheology.com humbletheology.com
melodypalace.com melodypalace.com
elevatewithgisel.com elevatewithgisel.com
digestingwellnesscourses.com digestingwellnesscourses.com
ioncapacitacion.com ioncapacitacion.com
fatherhoodafterdivorce.com fatherhoodafterdivorce.com
elevarecodingcamp.com elevarecodingcamp.com
awakenintuition.us awakenintuition.us
sc.edu.ge sc.edu.ge
hunchocoaching.com hunchocoaching.com
innerselfteachings.com innerselfteachings.com
florida-dealer-school.com florida-dealer-school.com
dad-academie.ca dad-academie.ca
latindanceshop.com latindanceshop.com
learndataengineering.com learndataengineering.com
learnfinearts.com learnfinearts.com
lvbbi.com lvbbi.com
moolmaninstitute.com moolmaninstitute.com
mrquakersteaches.com mrquakersteaches.com
oxfordlearninglab.com oxfordlearninglab.com
homebuildersuniversity.com homebuildersuniversity.com
alignyourselftosuccessacademy.com alignyourselftosuccessacademy.com
hackersacademy.ca hackersacademy.ca
hustlebuddiesofficial.com hustlebuddiesofficial.com
excelspeedwork.com excelspeedwork.com
shibariclasses.com shibariclasses.com
mingxin.one mingxin.one
aiguruacademy.com aiguruacademy.com
gut-ed.com gut-ed.com
voip.school voip.school
fflamericabootcamp.com fflamericabootcamp.com
hiyakucoaching.com hiyakucoaching.com
moutoncoach.com moutoncoach.com
sklab.io sklab.io
guitareality.com guitareality.com
impacflp.com impacflp.com
mpe4prep.com mpe4prep.com
eyesopenacademy.com eyesopenacademy.com
mokalemaacademy.com mokalemaacademy.com
mbxax.school mbxax.school
animeresto.com animeresto.com
joyfulmatchingforyou.com joyfulmatchingforyou.com
detectordog.co.uk detectordog.co.uk
moterusaviugdosmokykla.com moterusaviugdosmokykla.com
hostandcoach.com hostandcoach.com
asemsecuritymultiservice.com asemsecuritymultiservice.com
justbeachystudio.club justbeachystudio.club
warp-9.com warp-9.com
anjayamajiart.com anjayamajiart.com
foxland.ro foxland.ro
bear.academy bear.academy
aspireinstitute.tv aspireinstitute.tv
healthyuonline.org healthyuonline.org
heahealthhub.com heahealthhub.com
mrphysio.net mrphysio.net
academiadeangeles.com academiadeangeles.com
sifcpd.com sifcpd.com
guitaros.com guitaros.com
appbrewery.com appbrewery.com
abdulacademy.com abdulacademy.com
graphicinteriordesignschool.com graphicinteriordesignschool.com
lawofattractionaccelerator.com lawofattractionaccelerator.com
mentorship.one mentorship.one
mayinedevelopmentcourses.com mayinedevelopmentcourses.com
mecacfoacademy.com mecacfoacademy.com
interventionacademy.com interventionacademy.com
executivepath.net executivepath.net
mazequest.org mazequest.org
groundedbyyoga.org groundedbyyoga.org
eivindfx.com eivindfx.com
infosecschool.net infosecschool.net
fuerteaerialfitness.com fuerteaerialfitness.com
internationalwellbeingacademy.com internationalwellbeingacademy.com
mbuzz.fr mbuzz.fr
fretsfordays.com fretsfordays.com
discoverasl.com discoverasl.com
diy-natural-livingwithshelly.com diy-natural-livingwithshelly.com
fbamasteryprogram.com fbamasteryprogram.com
diligentdialers.com diligentdialers.com
entrepreneurtraining.education entrepreneurtraining.education
hsbnschool.com hsbnschool.com
americandentalsedation.com americandentalsedation.com
lescreateurs.video lescreateurs.video
mnairacademy.com mnairacademy.com
growthschool.com growthschool.com
americanenglishuniversity.com americanenglishuniversity.com
getorganizedgal.com getorganizedgal.com
globalsmallbusinessschool.com globalsmallbusinessschool.com
academiaenergiasolar.com academiaenergiasolar.com
abawizard.net abawizard.net
mybiomi.com mybiomi.com
akademiagrowings.com akademiagrowings.com
adrianyanitaonline.com adrianyanitaonline.com
mindandbusiness.net mindandbusiness.net
interculturalireland.com interculturalireland.com
mentoriaprofetica.org mentoriaprofetica.org
learnwitheo.com learnwitheo.com
deallawyerhq.com deallawyerhq.com
moderncreativemoney.com moderncreativemoney.com
fbaunlocked.com fbaunlocked.com
jaymaasrecording.com jaymaasrecording.com
hinemoanadance.com hinemoanadance.com
mvclogisticsacademy.com mvclogisticsacademy.com
drgreenhouseacademy.com drgreenhouseacademy.com
fitbosstribeschool.com fitbosstribeschool.com
intothechariot.com intothechariot.com
designingwithchris.com designingwithchris.com
goup-online.com goup-online.com
hashkueh.com hashkueh.com
dontimitateunderstand.com dontimitateunderstand.com
infiniterealmofdance.com infiniterealmofdance.com
actrxtraining.com actrxtraining.com
examfacts.net examfacts.net
jameskool.com jameskool.com
flowersandassociates.courses flowersandassociates.courses
mohammedaldebi.com mohammedaldebi.com
focuspreneuracademy.com focuspreneuracademy.com
lifestylemedicinesolutions.org lifestylemedicinesolutions.org
egindicators.org egindicators.org
learn-martialarts.com learn-martialarts.com
dementiabydayschool.com dementiabydayschool.com
fbmusicacademy.com fbmusicacademy.com
academianexoyoga.com academianexoyoga.com
escuelademagia.org escuelademagia.org
formazioneintegrata.com formazioneintegrata.com
girlgonecity.com girlgonecity.com
awakeinthedreamschool.com awakeinthedreamschool.com
learnhowtotrades.com learnhowtotrades.com
academyinnerknowing.com academyinnerknowing.com
accountabilitycoachuniversity.com accountabilitycoachuniversity.com
acupuncturescholar.com acupuncturescholar.com
incognito.dance incognito.dance
freightbroker911.training freightbroker911.training
entsurgeryschool.com entsurgeryschool.com
encorecarestudentportal.com encorecarestudentportal.com
handeyeacademy.com handeyeacademy.com
axethrowingempire.com axethrowingempire.com
floridacramslam.com floridacramslam.com
homebakingcroissant.com homebakingcroissant.com
modality.academy modality.academy
dougtempleton.com dougtempleton.com
accountingwithindy.com accountingwithindy.com
jamiezoegivens.com jamiezoegivens.com
ilmonlineclasses.com ilmonlineclasses.com
lapharmacie-coaching.com lapharmacie-coaching.com
feltonmusicschool.com feltonmusicschool.com
functionalfreediving.com functionalfreediving.com
daretolivecoaching.com daretolivecoaching.com
hackingmaang.com hackingmaang.com
jostai.com jostai.com
lifewealthcourses.com lifewealthcourses.com
lets3dsmax.com lets3dsmax.com
joynyabongo.com joynyabongo.com
atmavida.com atmavida.com
joskeadconsulting.com joskeadconsulting.com
escapewith.us escapewith.us
fitsitclasses.com fitsitclasses.com
atparentingsurvivalschool.com atparentingsurvivalschool.com
fireacademylive.com fireacademylive.com
darrenenglish.com darrenenglish.com
johncrickett.me johncrickett.me
faucettemedia.com faucettemedia.com
6minutespay.com 6minutespay.com
mbacoachph.com mbacoachph.com
elmetodo513.com elmetodo513.com
codeveloppement.malikrezzoug.com codeveloppement.malikrezzoug.com
cib.team cib.team
harmonyhorsemanshipacademy.org harmonyhorsemanshipacademy.org
masteringyourjobsearch.com masteringyourjobsearch.com
fluentmedic.co fluentmedic.co
eden-smart.academy eden-smart.academy
earningyourownincome.com earningyourownincome.com
qtlab.it qtlab.it
mathkrumacosk128.com mathkrumacosk128.com
frittsacademy.com frittsacademy.com
anatma.com.mx anatma.com.mx
eflcurriculum.com eflcurriculum.com
fflhnwbootcamp.com fflhnwbootcamp.com
icoach4kids.com icoach4kids.com
dkschoolofhypnosis.com dkschoolofhypnosis.com
institutocietsi.com institutocietsi.com
digiocean.co.kr digiocean.co.kr
30daystosuccess.academy 30daystosuccess.academy
mrphysio.com.au mrphysio.com.au
ddssuccess.com ddssuccess.com
emprenderimporta.com emprenderimporta.com
embodiedwoman.com embodiedwoman.com
dfo-training.com dfo-training.com
investishare.com investishare.com
genuinesolutions.org genuinesolutions.org
itm-online.com itm-online.com
developmentisland.com developmentisland.com
itim-online.com itim-online.com
abreuuniversityonline.com abreuuniversityonline.com
learn-ikigai.com learn-ikigai.com
esadsaglamakademi.com esadsaglamakademi.com
momentummxonline.com momentummxonline.com
indemandspeaking.com indemandspeaking.com
familysuccessacademy.com familysuccessacademy.com
lvrgacademy.com lvrgacademy.com
escuelacoyotipi.com escuelacoyotipi.com
integratedmeditationacademy.com integratedmeditationacademy.com
higherperformanceschools.com higherperformanceschools.com
jonyquiroz.net jonyquiroz.net
familyfirstlifenewagentbootcamp.com familyfirstlifenewagentbootcamp.com
escueladirecta.com escueladirecta.com
coffeebreakacademy.com coffeebreakacademy.com
globalquality.academy globalquality.academy
masterklassesonline.com masterklassesonline.com
gembaclub.com gembaclub.com
expertsecretsacademy.com expertsecretsacademy.com
fisherdrumming.com fisherdrumming.com
evolvedministry.org evolvedministry.org
dropshipmastery.com.au dropshipmastery.com.au
ametski.com ametski.com
febreuniversity.com febreuniversity.com
teachable.com teachable.com
mtnsense.com mtnsense.com
itherapist-seitai.com itherapist-seitai.com
fpmasterclass.com fpmasterclass.com
dogsconnectmentorship.com dogsconnectmentorship.com
greverbalcourse.com greverbalcourse.com
lumierevirtual.com lumierevirtual.com
freelstep.com freelstep.com
eskills.academy eskills.academy
frenchdialogues.com frenchdialogues.com
betterbakingschool.com betterbakingschool.com
peakhd.net peakhd.net
mosaicartsonline.com mosaicartsonline.com
agileprojectmanagementacademy.com agileprojectmanagementacademy.com
giraffemoves.com giraffemoves.com
itacademytraining.com itacademytraining.com
kurdzone.org kurdzone.org
lashguyproacademy.com lashguyproacademy.com
leafwingforprofessionals.org leafwingforprofessionals.org
leanover40formen.store leanover40formen.store
learnabee.com learnabee.com
learncredit.com learncredit.com
learningtheartlife.com learningtheartlife.com
learnjam.academy learnjam.academy
learnmcas.com learnmcas.com
learnwithus.ca learnwithus.ca
letterartacademy.com letterartacademy.com
lidemy.com lidemy.com
linguisticator.com linguisticator.com
linuxhint.biz linuxhint.biz
literaryadventuresforkids.com literaryadventuresforkids.com
lonecrowstudio.com lonecrowstudio.com
longevity.degree longevity.degree
lookerstudiobible.com lookerstudiobible.com
lotetreeacademy.com lotetreeacademy.com
luminouslivingacademy.com luminouslivingacademy.com
lyndajanespiritschool.com lyndajanespiritschool.com
mabusinessuniversity.com mabusinessuniversity.com
machongate.net machongate.net
maconstyles.academy maconstyles.academy
maestroportillo.com maestroportillo.com
magiclab.cl magiclab.cl
makemusicmoves.com makemusicmoves.com
makingsenseofsponsoredposts.com makingsenseofsponsoredposts.com
mariaraczynska.com mariaraczynska.com
mastersandharris.com mastersandharris.com
mbcourses.org mbcourses.org
mdlive.net mdlive.net
medical-german.eu medical-german.eu
meehanhealthline.com meehanhealthline.com
mentalwellbeingacademy.com mentalwellbeingacademy.com
metafutureschool.org metafutureschool.org
middleclassmusician.com middleclassmusician.com
millionairetraderssociety.com millionairetraderssociety.com
mindmuscles.academy mindmuscles.academy
mintplusplus.ch mintplusplus.ch
mohab-tech.com mohab-tech.com
moreyouniversity.com moreyouniversity.com
mountainfitnessschool.com mountainfitnessschool.com
moversup.org moversup.org
mpact.online mpact.online
mtpeducation.com mtpeducation.com
muakk.tv muakk.tv
multiplicationschool.com multiplicationschool.com
musclay.com musclay.com
musichabit.com musichabit.com
musicmasterclasses.be musicmasterclasses.be
musictherapyonline.org musictherapyonline.org
myarkview.org myarkview.org
mybodymycelebration.com mybodymycelebration.com
myccuonline.com myccuonline.com
myfoodmarketing.com myfoodmarketing.com
mynetworktraining.com mynetworktraining.com
myrecoveryportal.com myrecoveryportal.com
ncta.online ncta.online
newqi.live newqi.live
ogc2go.com ogc2go.com
picaca.jp picaca.jp
preservethis.org preservethis.org
rhythm.academy rhythm.academy
apprendr.com apprendr.com
abundanceacademy.online abundanceacademy.online
abyssimoartschool.com abyssimoartschool.com
aboutlittlehumans.com aboutlittlehumans.com
academiadesupervivencia.com academiadesupervivencia.com
aquariumclass.com aquariumclass.com
academiamaquisport.com academiamaquisport.com
actorsactacademy.com actorsactacademy.com
ghionis.com ghionis.com
arabicoders.com arabicoders.com
acepresentationschool.com acepresentationschool.com
adobe-educa.com adobe-educa.com
advanced-academy.com advanced-academy.com
agustinaalgorta.com agustinaalgorta.com
courses.fashionlawstudio.com courses.fashionlawstudio.com
airbrushonlineschool.com airbrushonlineschool.com
ajmonics.com ajmonics.com
altdeep.ai altdeep.ai
appliedgo.com appliedgo.com
alphatutor.online alphatutor.online
algolab.so algolab.so
allthingsmathematics.com allthingsmathematics.com
amyscircle.com amyscircle.com
americancrochetassociation.com americancrochetassociation.com
arminharris.com arminharris.com
animeartacademy.com animeartacademy.com
andrewclarkeguitar.com andrewclarkeguitar.com
speakenglishwithtiffaniacademy.com speakenglishwithtiffaniacademy.com
artcloud.com.mx artcloud.com.mx
artmarketacademy.com artmarketacademy.com
128academy.com 128academy.com
academiacosmetica.com academiacosmetica.com
academyhacker.com academyhacker.com
accountingcodingcamp.com accountingcodingcamp.com
asiaforexmentoracademy.com asiaforexmentoracademy.com
asvabsuccess.net asvabsuccess.net
ats-hybrid.com ats-hybrid.com
audacitybootcamp.com audacitybootcamp.com
teplu.in teplu.in
awelivet.se awelivet.se
awsdevops.io awsdevops.io
ayoubbellabes.com ayoubbellabes.com
thewat.com thewat.com
barnstoneondemand.com barnstoneondemand.com
tmrise.com tmrise.com
basicfilmmakeruniversity.com basicfilmmakeruniversity.com
bassemschool.com bassemschool.com
beabeacon.lgbt beabeacon.lgbt
behavioranalytics.academy behavioranalytics.academy
beingman.life beingman.life
bellabusinessschool.com bellabusinessschool.com
benbacal-academy.com benbacal-academy.com
bennett-movement.com bennett-movement.com
bensguitarclub.com bensguitarclub.com
bestpossibleselfinstitute.com bestpossibleselfinstitute.com
bitcademy.org bitcademy.org
blackbeltbrokerage.com blackbeltbrokerage.com
blackonboardonline.org blackonboardonline.org
blendertoprinter.com blendertoprinter.com
vnysa.school vnysa.school
bnb.university bnb.university
bosschicks247.com bosschicks247.com
bibleandworship.com bibleandworship.com
boxcollider.io boxcollider.io
brainacademy.com brainacademy.com
wecnqr.com wecnqr.com
breadcourses.com breadcourses.com
breadlessons.com breadlessons.com
breemelanson-shop.com breemelanson-shop.com
brevitycoaching.com brevitycoaching.com
brigadeacademy.com brigadeacademy.com
broadwaytowallstreet.com broadwaytowallstreet.com
buildlivable.com buildlivable.com
bulletproofrunners.com bulletproofrunners.com
bushidouniversity.com bushidouniversity.com
businessprotraining.es businessprotraining.es
cadmantraining.com cadmantraining.com
caid.org caid.org
capitariacursostrading.com capitariacursostrading.com
carriemillerpilates.com carriemillerpilates.com
carrytn.com carrytn.com
ccelearn.org ccelearn.org
ccstarseeds.me ccstarseeds.me
cdlpermit.study cdlpermit.study
centroestudioshebraicos.com centroestudioshebraicos.com
chalkright.com chalkright.com
chansam.online chansam.online
charlesandelinacademy.com charlesandelinacademy.com
christianlearning.com christianlearning.com
cogni.school cogni.school
dojang.org dojang.org
ead.tv ead.tv
ealim.org ealim.org
greenfirstacademy.com greenfirstacademy.com
fullstacklibrary.com fullstacklibrary.com
funatsumari-beautyacademy-onlineschool.com funatsumari-beautyacademy-onlineschool.com
gageacademy.net gageacademy.net
gaivna.com gaivna.com
gamejamschool.com gamejamschool.com
gamethinkingacademy.com gamethinkingacademy.com
gbdcollege.com gbdcollege.com
geigerandspence.com geigerandspence.com
genco.school genco.school
gestationaldiabetescourse.com gestationaldiabetescourse.com
getthespike.com getthespike.com
gigrocket.com gigrocket.com
glamaway.ca glamaway.ca
googleadwordstutorial.com googleadwordstutorial.com
govkidmethod.com govkidmethod.com
graphneuralnets.com graphneuralnets.com
groove2day.com groove2day.com
gsk-edu.com gsk-edu.com
gymcademy.com gymcademy.com
hackyourbrainwithnlp.com hackyourbrainwithnlp.com
halabellydance.com halabellydance.com
highticketelites.com highticketelites.com
hijamanationacademy.com hijamanationacademy.com
hiswordhealstoday.net hiswordhealstoday.net
howtofreedive.com howtofreedive.com
hsbnschool.org hsbnschool.org
htdezignschool.com htdezignschool.com
hypnopower.us hypnopower.us
iceju.org iceju.org
iso-gps.com iso-gps.com
istudyjapanese.com istudyjapanese.com
itakelessons.com itakelessons.com
ithahu.com ithahu.com
jfbcodes.com jfbcodes.com
jfdeducation.com jfdeducation.com
justudy.co.il justudy.co.il
kamalaleslie.com kamalaleslie.com
keyconceptsinstitute.com keyconceptsinstitute.com
khasang.io khasang.io
kimmunity.com.au kimmunity.com.au
kitdaletraining.com kitdaletraining.com
kkcreditacademy.org kkcreditacademy.org
kkxuniversity.com kkxuniversity.com
knackcourses.com knackcourses.com
knowmore.university knowmore.university
korzat.net korzat.net
workshop.ojolly.net workshop.ojolly.net
youga.teachable.com youga.teachable.com
emilymadillcourses.com emilymadillcourses.com
zakaria.teachable.com zakaria.teachable.com
assetpro.teachable.com assetpro.teachable.com
companion.university companion.university
classroom.themusicolormethod.com classroom.themusicolormethod.com
purpose31.teachable.com purpose31.teachable.com
learn.donaldrobertson.name learn.donaldrobertson.name
learn.sharpertrades.com learn.sharpertrades.com
academy.imageinnovators.com academy.imageinnovators.com
jordancanova.com jordancanova.com
kafx.org kafx.org
karaz.academy karaz.academy
katiesisk.com katiesisk.com
kevinfoong.co kevinfoong.co
khadijaacademy.com khadijaacademy.com
kinbaku-academy.com kinbaku-academy.com
kitsapstrongconsulting.com kitsapstrongconsulting.com
knittinginenglish.com knittinginenglish.com
koimartialart.com koimartialart.com
krvalues.com krvalues.com
kyleeanneducation.com kyleeanneducation.com
laboratoriodemovimiento.com laboratoriodemovimiento.com
laescueladepealpan.com laescueladepealpan.com
landlordcert.org landlordcert.org
launch-well.com launch-well.com
laviniabrowncourses.com laviniabrowncourses.com
lead2flow.nl lead2flow.nl
leadinforce-academy.com leadinforce-academy.com
league-of-elites.com league-of-elites.com
learnfengshui.co.uk learnfengshui.co.uk
learning-bytes.com learning-bytes.com
learnthecut.com learnthecut.com
learnzonemedia.co.uk learnzonemedia.co.uk
letityoga.it letityoga.it
letspaintflowers.com letspaintflowers.com
letsrecover.co.uk letsrecover.co.uk
lifedesignsociety.com lifedesignsociety.com
linglongchinese.com linglongchinese.com
literacytolife.com literacytolife.com
loogguitarschool.com loogguitarschool.com
loripalmquist.com loripalmquist.com
luxebrowngirltravels.com luxebrowngirltravels.com
luxuryfilmmaker.com luxuryfilmmaker.com
lydiafernandes.com lydiafernandes.com
lymcapacitacion.com lymcapacitacion.com
mac-seminar.online mac-seminar.online
marcelacabrejos.com marcelacabrejos.com
markzguitar.com markzguitar.com
masterfulpainting.com masterfulpainting.com
mazentaichi.com mazentaichi.com
mazori.com mazori.com
mcclanahanacademy.com mcclanahanacademy.com
medix.education medix.education
mentality.work mentality.work
mervacademy.com mervacademy.com
michelemavi.com michelemavi.com
michelleraesobi.com michelleraesobi.com
middlemanagermagic.com middlemanagermagic.com
mildorviolon.com mildorviolon.com
misiononline.com misiononline.com
missionfx.us missionfx.us
mmcourses.co.uk mmcourses.co.uk
mocktrialky.com mocktrialky.com
mojoversity.com mojoversity.com
momsquest.org momsquest.org
morimotostudio.com morimotostudio.com
mrotterstudio.com mrotterstudio.com
mteacademy.ca mteacademy.ca
myautomationclass.com myautomationclass.com
mymusicalvoice.com mymusicalvoice.com
makeupfromscratchacademy.com makeupfromscratchacademy.com
cei-ph.com cei-ph.com
pitec.la pitec.la
pornrebootprogram.com pornrebootprogram.com
ppcs.nu ppcs.nu
ptype.academy ptype.academy
qifit.pl qifit.pl
focus5online.com focus5online.com
abbevilleacademy.org abbevilleacademy.org
robertbakerguitar.com robertbakerguitar.com
classicalguitar-pro.com classicalguitar-pro.com
abraham-education.com abraham-education.com
academiasemagro.com academiasemagro.com
actualiseacademy.com actualiseacademy.com
saguto.golf saguto.golf
afrolatinfunk.dance afrolatinfunk.dance
akasun.co.uk akasun.co.uk
alselectronicclassroom.com alselectronicclassroom.com
shezer.org shezer.org
alexhitt.com alexhitt.com
alivewithyogaonline.com alivewithyogaonline.com
amzbusinesssociety.com amzbusinesssociety.com
americancraftsmanshopclass.com americancraftsmanshopclass.com
ametsuchi-dojo.org ametsuchi-dojo.org
skaled.academy skaled.academy
animalcentrededucation.com animalcentrededucation.com
aprendicesvisuales.com aprendicesvisuales.com
aptly.co aptly.co
artisanbakingcenter.com artisanbakingcenter.com
101value.net 101value.net
stoneriverelearning.com stoneriverelearning.com
aashishacademy.com aashishacademy.com
academiadeimpacto.com academiadeimpacto.com
academyofcomposition.com academyofcomposition.com
academyrichcopy.com academyrichcopy.com
jadeoak.teachable.com jadeoak.teachable.com
talmid.me talmid.me
authorgrow.com authorgrow.com
autoimmunetribecourses.com autoimmunetribecourses.com
avatarenergymastery.com avatarenergymastery.com
aviationgroundschoolsonline.com aviationgroundschoolsonline.com
awesomepeopleleaders.com awesomepeopleleaders.com
theacl.club theacl.club
babilanka.com babilanka.com
banzenkanacademy.com banzenkanacademy.com
beautymarketingacademy.com beautymarketingacademy.com
tpd15.com tpd15.com
beginnertomastery.com beginnertomastery.com
behaviorcompassacademy.com behaviorcompassacademy.com
benshorts.com benshorts.com
bestme.today bestme.today
bettertradingportal.com bettertradingportal.com
bewusstes-golf.academy bewusstes-golf.academy
bgcacademy.com bgcacademy.com
uog.training uog.training
billionplg.com billionplg.com
bizimkimyamiz.com bizimkimyamiz.com
bkeiei.com bkeiei.com
blackbusinessu.com blackbusinessu.com
blessedtosell.com blessedtosell.com
vidyapitha.in vidyapitha.in
bluelight.academy bluelight.academy
vmat.edu.vn vmat.edu.vn
bodyart.training bodyart.training
vulf.co vulf.co
brailleskateuniversity.com brailleskateuniversity.com
bscholarshipclass.com bscholarshipclass.com
buddytutorial.com buddytutorial.com
wndx.school wndx.school
bumpintoosteo.com.au bumpintoosteo.com.au
bvotaekwondo.com bvotaekwondo.com
cactus-school.online cactus-school.online
campusdigitaldeespecialistas.com campusdigitaldeespecialistas.com
canadianlaserinstitute.ca canadianlaserinstitute.ca
capacitypluscourse.com capacitypluscourse.com
cardandcraftacademy.com cardandcraftacademy.com
carlottacastangiayoga.com carlottacastangiayoga.com
catalystartlab.com catalystartlab.com
caveofprogramming.com caveofprogramming.com
celldreameracademy.com celldreameracademy.com
cempschool.com cempschool.com
certv.org certv.org
ceusforteachers.com ceusforteachers.com
chabakatarab.com chabakatarab.com
championsofinfluence.com championsofinfluence.com
chartslogic.com chartslogic.com
collaboration.coach collaboration.coach
cherishartzcreative.com cherishartzcreative.com
codebh.fr codebh.fr
course.shopline.tw course.shopline.tw
cpaweb.org.uk cpaweb.org.uk
criticalthinkeracademy.com criticalthinkeracademy.com
developedbyed.com developedbyed.com
digitalabcd.com digitalabcd.com
easyt.online easyt.online
eltjam.academy eltjam.academy
goldeneggsfertility.com goldeneggsfertility.com
fbcti.org fbcti.org
filmsimplified.com filmsimplified.com
gadha.ae gadha.ae
garyscourse.com garyscourse.com
getpublishedcourse.com getpublishedcourse.com
glowforgeforbeginners.com glowforgeforbeginners.com
gmalasereducation.com gmalasereducation.com
godpreneuracademy.com godpreneuracademy.com
gothink.tv gothink.tv
graebert.academy graebert.academy
greatgutguide.com greatgutguide.com
gsaacademy.com gsaacademy.com
guitarinstitute.it guitarinstitute.it
gytocourses.com gytocourses.com
haleyramsey.com haleyramsey.com
happybackyoga.com happybackyoga.com
harmony-life-academy.com harmony-life-academy.com
homeschool-university.com homeschool-university.com
homeschoolbuyer.com homeschoolbuyer.com
horsebosses.com horsebosses.com
howsongsaremade.com howsongsaremade.com
hrponlinelearning.com hrponlinelearning.com
humain360.com humain360.com
huntingcamp.live huntingcamp.live
idlab.school idlab.school
idsei.com idsei.com
istitutolavoro.net istitutolavoro.net
iteachone.org iteachone.org
jessicacere.com jessicacere.com
jgaitpro.com jgaitpro.com
jlglobaltech.com jlglobaltech.com
joinmeetkevin.com joinmeetkevin.com
cours.tribulationsdemarie.com cours.tribulationsdemarie.com
instabossclub.com instabossclub.com
members.theominstitute.com members.theominstitute.com
courses.rachelvonsturmer.com courses.rachelvonsturmer.com
rickpaddock.teachable.com rickpaddock.teachable.com
usingvisualisation.com usingvisualisation.com
learn.creativekina.com learn.creativekina.com
speakerslab.usefedora.com speakerslab.usefedora.com
mcleayworkshops.co.nz mcleayworkshops.co.nz
acadegenius.co.uk acadegenius.co.uk
activcaretraining.com activcaretraining.com
activehope.training activehope.training
accordarelabatteria.it accordarelabatteria.it
sagelogica.com sagelogica.com
advancedalignertraining.com advancedalignertraining.com
agaartstudioclasses.com agaartstudioclasses.com
aikiuniversity.com aikiuniversity.com
aircraftprofit.com aircraftprofit.com
annaakbari.teachable.com annaakbari.teachable.com
alqamiedu.com alqamiedu.com
alexandrian.academy alexandrian.academy
algoaddict.com algoaddict.com
algopro.ai algopro.ai
allthingsendo.ca allthingsendo.ca
gokp.teachable.com gokp.teachable.com
amazonmokymai.lt amazonmokymai.lt
skilly.co.il skilly.co.il
artoflivingwell.org.uk artoflivingwell.org.uk
artofyoubellydance.com artofyoubellydance.com
anywherestartup.com anywherestartup.com
edityourlandscapes.com edityourlandscapes.com
guitarinvadersacademy.net guitarinvadersacademy.net
enjoyrealenglish.com enjoyrealenglish.com
apegcommunity.com apegcommunity.com
stages.academy stages.academy
1600.io 1600.io
aammlearning.com aammlearning.com
academiaimperial.com academiaimperial.com
academiatrencadis.com academiatrencadis.com
academiehsa.com academiehsa.com
academy-chiekoegged.com academy-chiekoegged.com
aliboucoding.com aliboucoding.com
apprendre-java.com apprendre-java.com
aprendecontabella.com aprendecontabella.com
assessport-academy.com assessport-academy.com
tetmo.com tetmo.com
feldenkrais-akademie.com feldenkrais-akademie.com
autotrading.vip autotrading.vip
avotek-online.com avotek-online.com
axtonliu.ai axtonliu.ai
azlansensei-e-learning.com azlansensei-e-learning.com
baileylineroadlearning.com baileylineroadlearning.com
baytalmosawer.online baytalmosawer.online
befit4akhirah.com befit4akhirah.com
bellpianopopcourseonline.com bellpianopopcourseonline.com
benatural.com.sg benatural.com.sg
benjajap.com benjajap.com
benlevinmusicschool.com benlevinmusicschool.com
turnkeyrentals101.com turnkeyrentals101.com
beyondtheboxacademy.com beyondtheboxacademy.com
billhelmtuina.com billhelmtuina.com
billyphillips.com billyphillips.com
topdogs.teachable.com topdogs.teachable.com
bitwisecourses.com bitwisecourses.com
blackexpertsempire.com blackexpertsempire.com
blendeducation.org blendeducation.org
blockchainbloom.com blockchainbloom.com
bloggingbootcamp.com bloggingbootcamp.com
boarddirectortraining.com boarddirectortraining.com
bobbielyonscaninecampus.com bobbielyonscaninecampus.com
boldexpressivepaintingworkshops.com boldexpressivepaintingworkshops.com
borderstatesecuritytraining.com borderstatesecuritytraining.com
brainery.io brainery.io
bravobellabras.com bravobellabras.com
breakthroughfreelancing.com breakthroughfreelancing.com
brokentobalanced.com brokentobalanced.com
budeducation.com budeducation.com
businessprofitimprovementplan.com businessprofitimprovementplan.com
bynadiablanco.com bynadiablanco.com
cafezinhobrasileiro.com cafezinhobrasileiro.com
cameducation.co.uk cameducation.co.uk
campus-ateneojazz.com campus-ateneojazz.com
campus-ribas.com campus-ribas.com
campusparentesis.com campusparentesis.com
canopy.games canopy.games
caramiller.com caramiller.com
casasdeoracion.online casasdeoracion.online
catherineedwardsacademy.com catherineedwardsacademy.com
centering.life centering.life
cfoo-education.com cfoo-education.com
changewithcolleen.com changewithcolleen.com
childhoodtraumainstitute.com childhoodtraumainstitute.com
codewithmosh.com codewithmosh.com
creator.school creator.school
devs.online devs.online
doe1.org doe1.org
dropshippingtitans.com dropshippingtitans.com
globalriskacademy.com globalriskacademy.com
encafe.org encafe.org
fscourses.com fscourses.com
gaeilgelejane.com gaeilgelejane.com
gateway.university gateway.university
gavinlund.co.za gavinlund.co.za
getoffyouracidacademy.com getoffyouracidacademy.com
gettingguru.com gettingguru.com
mographmentor.com mographmentor.com
globalcte.com globalcte.com
globalneurosurgicalalliance.com globalneurosurgicalalliance.com
gonego.co gonego.co
grazeu.com grazeu.com
greenzebra.online greenzebra.online
gregoryblumberg-bootcamp.com gregoryblumberg-bootcamp.com
griffinandbellvision.com griffinandbellvision.com
growonthreads.com growonthreads.com
guitarensemblemethod.com guitarensemblemethod.com
guitarlessons.nyc guitarlessons.nyc
haircamphomeedition.com haircamphomeedition.com
healthiveacademy.com healthiveacademy.com
highlevelknowledge.com highlevelknowledge.com
holistichealthblueprint.com holistichealthblueprint.com
homeofsound.co.uk homeofsound.co.uk
houseofyogavirtual.com houseofyogavirtual.com
human-insight-academy.com human-insight-academy.com
hypnosis-institute-mariani.com hypnosis-institute-mariani.com
iltdp.com iltdp.com
iyengaronline.it iyengaronline.it
jamespang-tutorial.com jamespang-tutorial.com
janechippsart.school janechippsart.school
jennicrowther.co.uk jennicrowther.co.uk
jmguitarlessons.com jmguitarlessons.com
jorgemochon.academy jorgemochon.academy
jptnailacademy.com jptnailacademy.com
juniorycarolina.com juniorycarolina.com
kidzygo.com kidzygo.com
insiderlessons.com insiderlessons.com
kizentraining.com kizentraining.com
jenniferrayecourses.com jenniferrayecourses.com
knxacademy.com knxacademy.com
kodikaitradescourse.com kodikaitradescourse.com
kurser-for-par.dk kurser-for-par.dk
kyle.care kyle.care
ladyesha.com ladyesha.com
lauraandscott.com lauraandscott.com
leadingedgedogshowacademy.com leadingedgedogshowacademy.com
leadingedgegroomingacademy.com leadingedgegroomingacademy.com
learn.physio learn.physio
learningritual.com learningritual.com
learnitanytime.com learnitanytime.com
learnthemagicofpaper.com learnthemagicofpaper.com
linglongchinois.com linglongchinois.com
livingarchitectureacademy.com livingarchitectureacademy.com
lizscullytraining.com lizscullytraining.com
loonextrading.com loonextrading.com
loveyourbusinessschool.com loveyourbusinessschool.com
loyallactation.com loyallactation.com
makemoneywithcredit.com makemoneywithcredit.com
makingsenseofaffiliatemarketing.com makingsenseofaffiliatemarketing.com
manosfilippou.com manosfilippou.com
markethustleacademy.com markethustleacademy.com
maskilim.org maskilim.org
master-jpcuisine.com master-jpcuisine.com
mastersinlife.com mastersinlife.com
mastery.business mastery.business
mentefeliz.org mentefeliz.org
metodofourstartup.com metodofourstartup.com
michaelandrewlawdojo.com michaelandrewlawdojo.com
miiedu.com miiedu.com
mindbaracademy.com mindbaracademy.com
mindrenewalschool.com mindrenewalschool.com
minervaeducacionfinanciera.mx minervaeducacionfinanciera.mx
mmi-members.com mmi-members.com
moderncalligraphy101.com moderncalligraphy101.com
mom-sports.com mom-sports.com
moneyintelligenceacademy.com moneyintelligenceacademy.com
mongymenligne.com mongymenligne.com
moteefearabic.com moteefearabic.com
mountaindulcimeratoz.com mountaindulcimeratoz.com
moystudio.online moystudio.online
mrflynnib.com mrflynnib.com
mwgcourses.com mwgcourses.com
myfoodsafetytutor.com myfoodsafetytutor.com
myteachinghero.com myteachinghero.com
netecdigital.com netecdigital.com
synchroshaktiacademy.com synchroshaktiacademy.com
opx360.com opx360.com
planancial.com planancial.com
polygonrunway.com polygonrunway.com
prop.academy prop.academy
thehairextensionacademy.com thehairextensionacademy.com
learn.annathea.org learn.annathea.org
moneycoachuniversity.com moneycoachuniversity.com
primateacademy.com primateacademy.com
skillvillefi.teachable.com skillvillefi.teachable.com
explorare.teachable.com explorare.teachable.com
godandgoals.teachable.com godandgoals.teachable.com
responsibilitytoday.com responsibilitytoday.com
ahmed-fitness.com ahmed-fitness.com
terrickahardy.com terrickahardy.com
academyofpurpose.org academyofpurpose.org
academiadeamorpropio.com academiadeamorpropio.com
actorsspark.com actorsspark.com
sandia.co.za sandia.co.za
advanced-plc.com advanced-plc.com
school.doordata.tw school.doordata.tw
agencyacceleratorcourse.com agencyacceleratorcourse.com
agenyz.tv agenyz.tv
ailymphatic.com ailymphatic.com
allen-bradley-plc-training.com allen-bradley-plc-training.com
ashleymethodedu.com ashleymethodedu.com
alflow.net alflow.net
amazonsellerpros.com amazonsellerpros.com
aartoday.com aartoday.com
academiatraductores.com academiatraductores.com
adobetechacademy.com adobetechacademy.com
alardaacademy.com alardaacademy.com
amigoscode.com amigoscode.com
aquestacademy.com aquestacademy.com
archerymasterclass.com archerymasterclass.com
audiencegrowers.com audiencegrowers.com
aviatorcloud.com aviatorcloud.com
avidbeer.com avidbeer.com
awesomeartschool.com awesomeartschool.com
ayam-es.education ayam-es.education
ayam.education ayam.education
ayunizate.com ayunizate.com
azizbashaacademy.com azizbashaacademy.com
badassbusinessownerlearningcenter.com badassbusinessownerlearningcenter.com
balkanarchitect.com balkanarchitect.com
beabettercommunicator.com beabettercommunicator.com
bedrockuniversity.com bedrockuniversity.com
benchmarkingpluscourse.com benchmarkingpluscourse.com
benja.hk benja.hk
beyondthefringecourses.com beyondthefringecourses.com
bharatvidya.in bharatvidya.in
bigplansacademy.com bigplansacademy.com
bigtechmentor.com bigtechmentor.com
biobaliainstituteschool.org biobaliainstituteschool.org
biologycarol.co.uk biologycarol.co.uk
bitcoininsider.io bitcoininsider.io
blockyfi.org blockyfi.org
bluespire.com bluespire.com
boardingschoolbasics.com boardingschoolbasics.com
boldfuture.me boldfuture.me
boldstep.fr boldstep.fr
bradwhisnant.com bradwhisnant.com
braindeadsimplecopy.com braindeadsimplecopy.com
brainiate.academy brainiate.academy
brainpilot.com.au brainpilot.com.au
brandster.com.br brandster.com.br
breakfreefromskinpicking.com breakfreefromskinpicking.com
buildingchildcareprofessionals.com buildingchildcareprofessionals.com
bunniespro.com bunniespro.com
butchercraft.com butchercraft.com
calvarydiscipleshiponline.org calvarydiscipleshiponline.org
camillamichettiyoga.com camillamichettiyoga.com
campusdocente.net campusdocente.net
caninescience.online caninescience.online
cardmakingschool.com cardmakingschool.com
yoohoo.academy yoohoo.academy
youtap.education youtap.education
casamaestraonline.com casamaestraonline.com
cathrinmanningevents.com cathrinmanningevents.com
cdb-university.com cdb-university.com
ceevirtual.com ceevirtual.com
center4dignity.com center4dignity.com
champcademy.com champcademy.com
edgecate.com edgecate.com
cheekyschool.com cheekyschool.com
douus.com douus.com
ecomsecretsacademy.com ecomsecretsacademy.com
edrone.academy edrone.academy
eedu.online eedu.online
faber.academy faber.academy
femalemusicianacademy.com femalemusicianacademy.com
fullyfundedmissionary.org fullyfundedmissionary.org
furniturecourse.com furniturecourse.com
futureofpeople.academy futureofpeople.academy
garyclarke.tech garyclarke.tech
geography-lounge.com geography-lounge.com
gettingtotheprofits.com gettingtotheprofits.com
ghirasalaqeeda.com ghirasalaqeeda.com
giftedsocietyacademy.org giftedsocietyacademy.org
globalsisterhoodschool.org globalsisterhoodschool.org
gnyanasangha.com gnyanasangha.com
goldtraining.it goldtraining.it
gonefreeflying.com gonefreeflying.com
graceincolorclassroom.com graceincolorclassroom.com
grammar.cool grammar.cool
graphologyonline.com graphologyonline.com
gregorylandsmancourses.com gregorylandsmancourses.com
gregorylandsmantreatments.com gregorylandsmantreatments.com
groomadogcourse.com groomadogcourse.com
growinginchrist.com growinginchrist.com
gwctlearning.com gwctlearning.com
habits.ae habits.ae
hairretailersacademy.com hairretailersacademy.com
healthphysics.academy healthphysics.academy
heartmaps.com heartmaps.com
hedacademy.fr hedacademy.fr
heylegal.co.uk heylegal.co.uk
hiddengemconsulting.com hiddengemconsulting.com
houseofanthonyelle.com houseofanthonyelle.com
houseofwhite.net houseofwhite.net
hrwebsource.com hrwebsource.com
impactfreepreview.com impactfreepreview.com
iuda.dance iuda.dance
jaynespencerwatercolor.com jaynespencerwatercolor.com
jettrades.net jettrades.net
jfdplus.com jfdplus.com
jobvise.net jobvise.net
juliaacademy.com juliaacademy.com
jumpstartitacademy.com jumpstartitacademy.com
kaariprehab.com kaariprehab.com
kabbalahbyheart.com kabbalahbyheart.com
kalendoleman.com kalendoleman.com
kalicurriculum.com kalicurriculum.com
kazoneonline.com kazoneonline.com
ken-rea.com ken-rea.com
kimkatglass.com kimkatglass.com
kindlestartup.academy kindlestartup.academy
kisss.academy kisss.academy
knowledgette.com knowledgette.com
kodigitalstudio.com kodigitalstudio.com
kodlama.io kodlama.io
kpi.academy kpi.academy
kundalinibodywork.online kundalinibodywork.online
learncatgrooming.com.au learncatgrooming.com.au
learningcrypto.co.uk learningcrypto.co.uk
learningwithervin.com learningwithervin.com
learnmagic.com learnmagic.com
learntheventure.com learntheventure.com
learnwithnesha.com learnwithnesha.com
learnworkwin.com learnworkwin.com
letsdrawtodayclub.com letsdrawtodayclub.com
lilibarbery.tv lilibarbery.tv
lilium.academy lilium.academy
lionahottaschool.com lionahottaschool.com
lisapowers.courses lisapowers.courses
lissarankinmd.com lissarankinmd.com
littlelighthouseacademy.org littlelighthouseacademy.org
livetantraacademy.com livetantraacademy.com
loftylearning.com loftylearning.com
lorenzofiorentino-corsi.it lorenzofiorentino-corsi.it
lovedaphnemaecourses.com lovedaphnemaecourses.com
lovelybylindsey-bridalhaireducation.com lovelybylindsey-bridalhaireducation.com
lovingright.co lovingright.co
lucysartlab.com lucysartlab.com
jugglingcare.com jugglingcare.com
magicka.academy magicka.academy
marketinginblack.com marketinginblack.com
marketingschool.hk marketingschool.hk
martialartscenter.de martialartscenter.de
martingureasko.com martingureasko.com
masstercursos.com masstercursos.com
matusnursingreviewacademy.com matusnursingreviewacademy.com
media101.org media101.org
medispeakonline.com medispeakonline.com
meiofrancesa.com meiofrancesa.com
mentorify.com mentorify.com
meurecall.com meurecall.com
mindsetclasses.com mindsetclasses.com
moneyzg.academy moneyzg.academy
morethancertified.com morethancertified.com
multisensorymath.online multisensorymath.online
muslim-teachers.com muslim-teachers.com
mxgraphics-academy.com mxgraphics-academy.com
myonlinecnaplatform.com myonlinecnaplatform.com
mytoxtraining.com mytoxtraining.com
myyogatime.com myyogatime.com
marcotafelli.com marcotafelli.com
millionairepoolman.com millionairepoolman.com
paypercallmasterclass.com paypercallmasterclass.com
phdsec.com phdsec.com
praxiscenterforaestheticstudies.com praxiscenterforaestheticstudies.com
gingerbreadarts.com gingerbreadarts.com
glidefastplus.com glidefastplus.com
imgroadmap.com imgroadmap.com
learn.thesimpletarot.com learn.thesimpletarot.com
proemcees.com proemcees.com
nassfit.com nassfit.com
ryansmethod.com ryansmethod.com
THB.ACADEMY
IP History

Click the IP addresses to see over domains using them.