Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

DCLACROSSETIX.CSELAX.COM

DCLACROSSETIX.CSELAX.COM
Shared Attributes
Domain
lakewv.com lakewv.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
lightsonthelakewv.com lightsonthelakewv.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 30 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
pistonsprops.com pistonsprops.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
pokerchipsforscholarships.com pokerchipsforscholarships.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
polarisstaraward.com polarisstaraward.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
rhythmofhopebenefitconcert.com rhythmofhopebenefitconcert.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 37 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
advice5kturkeytrot.com advice5kturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 23 days
t2t.org bravestbbq.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
huskyboosters.org golf.huskyboosters.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 37 days
t2t.org heroescuptickets.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 Feb 2024 92 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
houseofshadows.org houseofshadows.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 37 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
reliefbeerfest.com reliefbeerfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 36 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
pistonprop.com pistonprop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
historiclongwood.com poker.historiclongwood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 39 days
polarisstarawards.com polarisstarawards.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
sellsbroadwaydancecompany.com sellsbroadwaydancecompany.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 38 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
charlottetranshealth.org thenight.charlottetranshealth.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 347 days
GTM GTM-G-VD9RW4YRT4 Oct 2024 Oct 2024 2 days
hauntedstagestop.com hauntedstagestop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
screamfestparanormal.com screamfestparanormal.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 38 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wvlake.com wvlake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 May 2024 185 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
cselax.com dclacrosssetix.cselax.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
ghentpride.com ghentpride.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 46 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
kiwaniscarsandcandyshow.com kiwaniscarsandcandyshow.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 33 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
pistonsprop.com pistonsprop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
allstarholidayskills.com allstarholidayskills.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 51 days
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
startuprunwayfoundation.com startuprunwayfoundation.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 40 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
amshaunts.com amshaunts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 39 days
t2t.org appreciationdinner.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
laclj.org teeup.laclj.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
dodgepointoysterfarm.org dodgepointoysterfarm.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 55 days
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
t2t.org genovesedinnerdance.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
playmakers.com goodform.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 286 days
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 8 days
ashlandberryfarm.com haunt.ashlandberryfarm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 343 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
midlandmusicfest.com midlandmusicfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 28 days
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
ashlandberryfarm.com pumpkin.ashlandberryfarm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 238 days
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
ksfraceseries.com ksfraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lahey5k.org lahey5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
playmakers.com lakeloop.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Apr 2024 270 days
lakenormanhalfmarathon.com lakenormanhalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lakeunion10k.com lakeunion10k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jan 2024 May 2024 122 days
lastmilerace.com lastmilerace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
healthykidsrunningseries.org lawrenceburg-in.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
lday5k.run lday5k.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
leadvilleraceseries.com leadman.leadvilleraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Jul 2023 One Off
littleredheart5k.org littleredheart5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
healthykidsrunningseries.org lombard-il.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 213 days
loveinactionrun.com loveinactionrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
loverunstheworld.com loverunstheworld.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
luckydogdash.com luckydogdash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lucsrun.com lucsrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lwyl5k.com lwyl5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
lynchburgroadrunners.org lynchburgroadrunners.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
machotrailrun.com machotrailrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mainelighthouseride.com mainelighthouseride.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mcrrcrunforroses.org mcrrcrunforroses.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
healthykidsrunningseries.org media-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
mightymoose5k.org mightymoose5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
milesformeals5k.com milesformeals5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
milesformills.com milesformills.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
milesformills.org milesformills.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
militarycityrwr.com militarycityrwr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
millertonmadness.com millertonmadness.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
gourdyspumpkinrun.com milwaukeesignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 253 days
missioninnrun.org missioninnrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
missionpossiblerun.com missionpossiblerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
bookthatevent.com momrun.bookthatevent.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 293 days
monarchcrestcrank.com monarchcrestcrank.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
moonlightmadness.run moonlightmadness.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
moorestowntrails.org moorestowntrails.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mountaingoat.run mountaingoat.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
movemt.com movemt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
mtcturkeytrot.com mtcturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mtspokanerun.com mtspokanerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
muddytiremtb.com muddytiremtb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mylapsbolivia.com mylapsbolivia.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
naptownrun.com naptownrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
healthykidsrunningseries.org nashua-nh.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
nassaucountyturkeytrot.com nassaucountyturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
oneus.run newengland.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
nordicdanceinvitational.com nordicdanceinvitational.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
northforktri.com northforktri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
northshorehalfmarathon.com northshorehalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
healthykidsrunningseries.org norwalk-oh.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 May 2024 176 days
oakmontrun4cac.org oakmontrun4cac.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
obseniorgames.org obseniorgames.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
oceancityrunfest.com oceancityrunfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
ohanaholidayrun.com ohanaholidayrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
oldglorymarathon.com oldglorymarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
orangecityturkeytrot5k.com orangecityturkeytrot5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
epicseriesocr.com oregon.epicseriesocr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 202 days
otilloaustin.com otilloaustin.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
owschicago.com owschicago.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
pacingthecage.run pacingthecage.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
ratrelayaz.com ratrelayaz.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
peachstatechallenge.com peachstatechallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
phoenixhonorrun.org phoenixhonorrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pinkdiamondbikeride.com pinkdiamondbikeride.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 281 days
pinkonparade.org pinkonparade.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pistolcreekmarathon.org pistolcreekmarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
healthykidsrunningseries.org pitman-nj.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jan 2024 May 2024 128 days
polarprowlrun.com polarprowlrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pooches.run pooches.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
project54.org project54.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bonefrogchallenge.com race.bonefrogchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 Apr 2024 226 days
race303.com race303.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racecrossroads.com racecrossroads.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
reddirtmudrun.com reddirtmudrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
austinrattlermtb.com reg.austinrattlermtb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 344 days
bigsugargravel.com reg.bigsugargravel.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 344 days
cheqmtb.com reg.cheqmtb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 347 days
turkeytrotmiami.com reg.turkeytrotmiami.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 281 days
unboundgravel.com reg.unboundgravel.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 Nov 2023 One Off
runthepeninsula.com register.runthepeninsula.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 Dec 2023 75 days
remembrancerun.com remembrancerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
renototheredwoods.com renototheredwoods.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
resolutionrunner.com resolutionrunner.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
rhodeislandwinerun.com rhodeislandwinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
riverrunhalf.com riverrunhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 6 days
roswellturkeyrun.com roswellturkeyrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
rungsp.com rungsp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runhutchinsonisland.com runhutchinsonisland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runningoftheturkeys.com runningoftheturkeys.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runningscared5miler.com runningscared5miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runofhopeseattle.org runofhopeseattle.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runsignup.com runscore.runsignup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 233 days
runsistersrun.com runsistersrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runstcharles.com runstcharles.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runtheboar.com runtheboar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runthebridge.org runthebridge.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runthehiawatha.com runthehiawatha.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runthenight5k.com runthenight5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Dec 2023 May 2024 162 days
runtothesunmaui.com runtothesunmaui.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runvero.com runvero.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
t2t.org runwalkankeny.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Aug 2023 108 days
t2t.org runwalkbethel.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Jul 2023 64 days
t2t.org runwalkbuffalo.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Nov 2023 122 days
t2t.org runwalkdelmarva.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 254 days
t2t.org runwalknorthernky.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 162 days
t2t.org runwalkorlando.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
t2t.org runwalkpugetsound.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 162 days
t2t.org runwalkstaugustine.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 224 days
t2t.org runwalkutica.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 254 days
run-walk-roll.org run-walk-roll.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
run4thechildren.org run4thechildren.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runboogienights.com runboogienights.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runbrevard.com runbrevard.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
t2t.org runclimbbiloxi.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Feb 2024 214 days
playmakers.com runclub.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 Apr 2024 226 days
runcoloradorelays.com runcoloradorelays.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sagecitytri.org sagecitytri.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sandiegocentury.com sandiegocentury.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
santarosaturkeytrot.com santarosaturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
santascurry.com santascurry.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
santasdashforcash.com santasdashforcash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
scottcoffeerun.com scottcoffeerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
secondwindrunningclub.org secondwindrunningclub.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 10 days
gourdyspumpkinrun.com akronsignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 294 days
alzrun.com alzrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org altamonte-springs.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 206 days
shamrock5kbeerrun.com shamrock5kbeerrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
alienhalf.com alienhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 23 days
sgcyc.com sgcyc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 Feb 2024 169 days
shamrockshufflefl.com shamrockshufflefl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sharontimlinrace.org sharontimlinrace.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 7 days
healthykidsrunningseries.org allentown-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
allsportsproductionsinc.com allsportsproductionsinc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
allturkeytrots.com allturkeytrots.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
houstoncorporate5k.com signup.houstoncorporate5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
leadvilleraceseries.com silver50.leadvilleraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 Apr 2024 226 days
amazinghalf.com amazinghalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
skisignup.com skisignup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 7 days
smallgroupladies.com smallgroupladies.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
snowfunrun.org snowfunrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
solematesrace.com solematesrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racethebronx.com soundview5k.racethebronx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Mar 2024 327 days
speedy-feet.com speedy-feet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
spinalnetworkchallenge.org spinalnetworkchallenge.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
springdistanceclassic.com springdistanceclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
springmeadowtri.com springmeadowtri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 8 days
artlife5k.com artlife5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
starsstripesandstrides.com starsstripesandstrides.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
10kturkeytrek.com 10kturkeytrek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 11 days
steps4students.org steps4students.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
stone-mill-50-mile.org stone-mill-50-mile.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
stoningtonwinerun.com stoningtonwinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
stressbuster5k.com stressbuster5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
strutwytheus.org strutwytheus.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
stsrun.com stsrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
stuffyourfacerace.com stuffyourfacerace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sunmarathon.com sunmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
summersizzlertri.com summersizzlertri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
playmakers.com superbowl.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 286 days
anchoragemayorsmarathon.com anchoragemayorsmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
tacosnmargaritas5k.com tacosnmargaritas5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 May 2024 309 days
teamowen.org teamowen.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
healthykidsrunningseries.org aurora-co.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 Mar 2024 218 days
thebridgerun.com thebridgerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thebaybridgerun.com thebaybridgerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thebaybridgewalk.com thebaybridgewalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
medaldash.com thewalkingdead.medaldash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
shootoutforsoldiers.com baltimore.shootoutforsoldiers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 Sep 2023 One Off
baltimoretri.com baltimoretri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
timingmatt.com timingmatt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
title9krun.com title9krun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
baybridgewalk.com baybridgewalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
tomokamarathon.com tomokamarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
trailathon.run trailathon.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sunshinecampus.org trailmix5k.sunshinecampus.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 334 days
trailseries.org trailseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
beercitysanjose.com beercitysanjose.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
beercityslam.com beercityslam.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
trigoddesstri.com trigoddesstri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 38 days
trinonakids.org trinonakids.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
triadbrewsfest.com triadbrewsfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
trolleyrun.org trolleyrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bendtowhistler.com bendtowhistler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
turkeydashcharlotte.com turkeydashcharlotte.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
turkeytrails.com turkeytrails.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
turkeytrotbr.com turkeytrotbr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
turkeytrotcleveland.com turkeytrotcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 May 2024 317 days
turkeytrotfresno.com turkeytrotfresno.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
tuscaloosahalf.com tuscaloosahalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
tuscaloosaturkeytrot.com tuscaloosaturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
uglytree.run uglytree.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bigbadwolferun.com bigbadwolferun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bigfootdash.com bigfootdash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
biggerintexaschallenge.com biggerintexaschallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bigislandchallenge.com bigislandchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
bikecityfondo.com bikecityfondo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bikehutclassic.org bikehutclassic.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 344 days
billingscraftbeerweek.com billingscraftbeerweek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 15 days
medaldash.com usa.medaldash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
bishopranchturkeytrot.com bishopranchturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
velocitymultisport.com velocitymultisport.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
verobeachhalf.com verobeachhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
villetovillerelay.com villetovillerelay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 May 2024 187 days
bloomingtonwinerun.com bloomingtonwinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
playmakers.com virtual.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 340 days
visaliasoloruns.com visaliasoloruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
visaliaturkeytrot.org visaliaturkeytrot.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
t2t.org volunteernyc.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Feb 2024 Feb 2024 One Off
boisemarathon.org boisemarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
boiserivermarathon.com boiserivermarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
wagrace.com wagrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
walk4friends.com walk4friends.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bookthatevent.com bookthatevent.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
brandermillrace.com brandermillrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
brewrun5k.com brewrun5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
weston5k.com weston5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Feb 2024 216 days
brookmills10k.com brookmills10k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bth5k.org bth5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
willrunforfoodsvdp.com willrunforfoodsvdp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
windsorcorace.com windsorcorace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
witchrun.com witchrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wolfmantriathlon.org wolfmantriathlon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 10 days
women4women.run women4women.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
womenrunthed.com womenrunthed.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 37 days
wonderful5k.com wonderful5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wrightsvilleplunge.com wrightsvilleplunge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
healthykidsrunningseries.org caledonia-mi.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
calvary5k.com calvary5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
cambridgecrabrun.com cambridgecrabrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
healthykidsrunningseries.org carlise-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
healthykidsrunningseries.org carterville.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jan 2024 May 2024 128 days
carygreenwayshalfmarathon.com carygreenwayshalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
catalina100.com catalina100.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
cdamarathon.com cdamarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
cedarcreekspringdu.com cedarcreekspringdu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
central5k.com central5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 25 days
charliepostclassic.com charliepostclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
zydecomarathon.com zydecomarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
cheahachallenge.com cheahachallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
chicagoriverswim.org chicagoriverswim.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
chippinginforthechaplaincy.com chippinginforthechaplaincy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 Apr 2024 One Off
oneus.run mn.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
christmascheerwinerun.com christmascheerwinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
christmastown5k.com christmastown5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
gourdyspumpkinrun.com cincysignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 337 days
citrusgrove5k.com citrusgrove5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
cityoftreesmarathon.com cityoftreesmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
cityoftreesmarathon.org cityoftreesmarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
citypark5k.com citypark5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
clevelandchilibowlrun.com clevelandchilibowlrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 16 days
healthykidsrunningseries.org cliftontx.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
climbeverestchallenge.com climbeverestchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
coasttocoastchallenge.com coasttocoastchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
codybeermile.com codybeermile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org collegeville-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
coloradowomensclassic.com coloradowomensclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
coltonsrun.com coltonsrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
communitytableracestoendhunger.com communitytableracestoendhunger.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
healthykidsrunningseries.org concord-township-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
conquertheoverlook.com conquertheoverlook.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
conshyclassic.com conshyclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
cozytoesrace.com cozytoesrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
craftbrewerychallenge.com craftbrewerychallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
crcmiledash.com crcmiledash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
crossstock.run crossstock.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
cure4cam.org cure4cam.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
cyclecoasttocoast.com cyclecoasttocoast.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
dads5k.com dads5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
dallasholiday5k.com dallasholiday5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
damsiterun.com damsiterun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
danasangels.org dartwalk.danasangels.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
dashfordiapers.com dashfordiapers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org delawareohio.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
dirksenderby.com dirksenderby.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 May 2024 300 days
healthykidsrunningseries.org downers-grove-il.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
healthykidsrunningseries.org doylestown-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
imfreakinawesome.com dreams.imfreakinawesome.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 211 days
duboisturkeytrot.com duboisturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
duluthrunningevents.com duluthrunningevents.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
healthykidsrunningseries.org east-windsor-ct.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
healthykidsrunningseries.org eastern-lebanon-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 213 days
elesrace5k.org elesrace5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
elpasomarathon.org elpasomarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
healthykidsrunningseries.org elsinboro-nj.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 201 days
eltourtucson.org eltourtucson.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
elusivecupidrelay.com elusivecupidrelay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
healthykidsrunningseries.org enola-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 213 days
epicpirun.com epicpirun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
evergreenclub5k.org evergreenclub5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
falalarun.com falalarun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
federalcup5k.com federalcup5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
fit4fall5k.com fit4fall5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
freedomspringstriathlon.com freedomspringstriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fresnofreedomrun.com fresnofreedomrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
ftdesoto15k.com ftdesoto15k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 14 days
fullsendchallenge.com fullsendchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fullypacked.org fullypacked.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 356 days
playmakers.com funrun.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 191 days
gardencitygravel.com gardencitygravel.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
gemcityclassic.com gemcityclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
getmoovin.org getmoovin.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
getyourhearton5k.com getyourhearton5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
ghentdistrictfoundation.org ghentdistrictfoundation.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jan 2024 May 2024 130 days
t2t.org golfwaterloo.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
grandlakemarathon.com grandlakemarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
greatbearchase.org greatbearchase.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
greensborohalf.com greensborohalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
greensborohalfmarathon.com greensborohalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
greenwayschallenge.com greenwayschallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
griffithparktrailrun.com griffithparktrailrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
habitatcycleofhope.org habitatcycleofhope.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
racethebronx.com halloweenrun.racethebronx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 Dec 2023 38 days
harpoondogtoberfest.com harpoondogtoberfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
harpoonflannel5k.com harpoonflannel5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
harriersrelay.com harriersrelay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hawaiianislandschallenge.com hawaiianislandschallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hawaiichallengeruns.com hawaiichallengeruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
haydenlakemarathon.org haydenlakemarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
heartofamericamarathon.com heartofamericamarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 293 days
highmountainhalf.com highmountainhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hillvalley88miler.com hillvalley88miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
t2t.org honordaygolf.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 224 days
hoopla4miler.com hoopla4miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
houstonfourthfest.com houstonfourthfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
howloween5k.com howloween5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
ican5k.com ican5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
oneus.run iowa.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
jakeunger.com jakeunger.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
janesvilleflannelfest.com janesvilleflannelfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Mar 2024 May 2024 72 days
jinglebell5k.org jinglebell5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
justinsraceforpeace.org justinsraceforpeace.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
kevinmalcolm5k.com kevinmalcolm5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
healthykidsrunningseries.org klamath-falls.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
priceoffreedomfoundation.org amos.priceoffreedomfoundation.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 35 days
kauaichallenges.com kauaichallenges.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
kettlekrushrace.com kettlekrushrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
kidsonfirstfoundation.org kidsonfirstfoundation.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 Oct 2023 57 days
healthykidsrunningseries.org killeen-tx.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 293 days
kirbyderby.org kirbyderby.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
kookyspookyrun.com kookyspookyrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lastbestbeerrun.com lastbestbeerrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
laurenslap.org laurenslap.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
legacyduathlon.com legacyduathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lerunforlerouge.com lerunforlerouge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
liamstrong.com liamstrong.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lifewideopen.net lifewideopen.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
louisianatri.net louisianatri.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lucky13race.com lucky13race.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
luckydog5k.com luckydog5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
luckyleprechaunrun.com luckyleprechaunrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
machoman5k.com machoman5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mainelighthouseride.org mainelighthouseride.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
malvernerun.org malvernerun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
leadvilleraceseries.com marathon.leadvilleraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Nov 2023 121 days
marketstreetrun.org marketstreetrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
hopeacresrescue.org match.hopeacresrescue.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
mattamy5k.com mattamy5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mcrrckidsontherun.org mcrrckidsontherun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
healthykidsrunningseries.org mechanicsburg-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
metromilers.com metromilers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
midsummernight5k.com midsummernight5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mightymatapeaketriathlon.com mightymatapeaketriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mightymittensplashdash.com mightymittensplashdash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
millpondmile.com millpondmile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mississippigulfcoastmarathon.com mississippigulfcoastmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mmf5k.com mmf5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
molokichallenge.com molokichallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
montanavirtualchallenge.com montanavirtualchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mooreunity.com mooreunity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
healthykidsrunningseries.org morgan-county-il.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
muttsandmarshmallows.com muttsandmarshmallows.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
natalliemay.com natalliemay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
healthykidsrunningseries.org new-cumberland-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
newyearsdayrundallas.com newyearsdayrundallas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
noahfarrellyrun.org noahfarrellyrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
northernohiomarathon.com northernohiomarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
northportfirecracker5k.com northportfirecracker5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
northtexasrunforgood.com northtexasrunforgood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
nwtr2023.com nwtr2023.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
ocmdrunfest.com ocmdrunfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
ocrunfest.com ocrunfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
medaldash.com oct.medaldash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 245 days
healthykidsrunningseries.org oreland-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
otillocascobay.com otillocascobay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
otillowhistler.com otillowhistler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
owlsroostrumble.com owlsroostrumble.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
ozarkvalleytriathlon.com ozarkvalleytriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
palsinmotion.org palsinmotion.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
barnburnermtb.com reg.barnburnermtb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 239 days
chicagotriathlon.com reg.chicagotriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 286 days
tahoetrailmtb.com reg.tahoetrailmtb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 334 days
theraddirt.com reg.theraddirt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Apr 2024 270 days
pedalpalooza4fhpc.org pedalpalooza4fhpc.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
playmakers.com relay.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 340 days
pewaukeetriathlon.com pewaukeetriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
philadelphia76virtualchallenge.com philadelphia76virtualchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
pickledyoga.com pickledyoga.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
piday.run piday.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
piggybackdash.com piggybackdash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pikespeek10k.org pikespeek10k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pinnaclesadventurerun.com pinnaclesadventurerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pintsinthesquare.com pintsinthesquare.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
pistolultra.org pistolultra.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pnwpinkribbonrun.com pnwpinkribbonrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
prairiedoghalf.com prairiedoghalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
preseasontuneup.com preseasontuneup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
race5k.com race5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
raceacrossmaryland.com raceacrossmaryland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racegermantown.com racegermantown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
rail66tt.com rail66tt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
resolutionrun.org resolutionrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 6 days
rickstrailrun.com rickstrailrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Feb 2024 May 2024 109 days
ripplerun.org ripplerun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
riverroux.com riverroux.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 May 2024 311 days
rockymountainroubaix.com rockymountainroubaix.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 6 days
rollingthundercx.com rollingthundercx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 6 days
rootedinhim5k.com rootedinhim5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Dec 2023 May 2024 151 days
ardmorerah.org ardmorerah.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
runhardhalf.org runhardhalf.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
faithinchildren.org run2022.faithinchildren.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Sep 2023 129 days
run2endhunger.org run2endhunger.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
dyrk1a.org runak.dyrk1a.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 May 2024 299 days
runapaloozarun.com runapaloozarun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runblueridge.com runblueridge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
leadvilleraceseries.com runcamp.leadvilleraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 340 days
runclearlake.com runclearlake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runford103.org runford103.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runfordogs5k.com runfordogs5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runforthekids5k.com runforthekids5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
ruck9.org ruck9.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
ruckcancer.org ruckcancer.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
arenaattack.com arenaattack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runlongislandmarathon.com runlongislandmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runningandreadingchallenge.com runningandreadingchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runsby.com runsby.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runsuffield.com runsuffield.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runthepeakrace.com runthepeakrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
t2t.org runwalkchestercounty.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 186 days
t2t.org runwalkgreateraugusta.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 224 days
t2t.org runwalkhendersonville.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Jul 2023 One Off
t2t.org runwalkloudon.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Jul 2023 40 days
t2t.org runwalkpittsburgh.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 186 days
t2t.org runwalktomball.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 Aug 2023 One Off
rwtc-waukesha.com rwtc-waukesha.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
actslifewise5k.com actslifewise5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 24 days
saintaugustinetriathlon.com saintaugustinetriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
adamshalf.com adamshalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 24 days
santacatchrace.com santacatchrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
scarecrowsandwitchesflaglerbeach.com scarecrowsandwitchesflaglerbeach.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
scorefactor5k.com scorefactor5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
seacoasthalfmarathon.com seacoasthalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
alahalf.com alahalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
shenaniganchallenge.com shenaniganchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
playmakers.com mimile.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 Apr 2024 149 days
amazingkindnessrace.com amazingkindnessrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
slowafturtletrot.com slowafturtletrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
annarbortri.com annarbortri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 35 days
somersgreatescape.com somersgreatescape.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
somerssummerseries.com somerssummerseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
southerntourultra.com southerntourultra.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
healthykidsrunningseries.org apex-nc.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
spc5k.org spc5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
spooktacularfunrun.net spooktacularfunrun.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
spooky.run spooky.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
badgerstri.com autumnlake.badgerstri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 344 days
leadvilleraceseries.com stage.leadvilleraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 233 days
ashevillehalfmarathon.com ashevillehalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
startlineraceservices.com startlineraceservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
100holesforthehomeless.com 100holesforthehomeless.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 27 days
101heroesride.com 101heroesride.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 27 days
leadvilleraceseries.com 10k.leadvilleraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 340 days
stillnesscup.com stillnesscup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
storm5k10k.com storm5k10k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
stpaddys5k.com stpaddys5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
straightstreethillclimb.com straightstreethillclimb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
summitforlife.org summitforlife.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
summerbreezerun.com summerbreezerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
summersdone131.com summersdone131.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
suncoastolympictriathlon.com suncoastolympictriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sunfishtriathlon.com sunfishtriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sunshinestatechallenge.com sunshinestatechallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
trisirena.com sunsirenvirtualrun.trisirena.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 340 days
surfinsnowman.com surfinsnowman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
swimtheloop.com swimtheloop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
atlastrailseries.com atlastrailseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
healthykidsrunningseries.org auburn-nh.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
austintoaspen.com austintoaspen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
texas10series.com texas10series.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thankfulturkeyrun.com thankfulturkeyrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thecummingmarathon.com thecummingmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thechrisnewcomer.com thechrisnewcomer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
theglacierchallenge.com theglacierchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thedenver5k.com thedenver5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bachelorette5k.com bachelorette5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
thememorialdayclassic.com thememorialdayclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thestuffedturkeyrun.com thestuffedturkeyrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thetourdedonut.com thetourdedonut.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bakersfieldrudolph.run bakersfieldrudolph.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bakersfieldsoloruns.com bakersfieldsoloruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
thewoodlandsmarathon.com thewoodlandsmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
battleshiphalfmarathon.com battleshiphalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
traildays.run traildays.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
healthykidsrunningseries.org bedford-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
healthykidsrunningseries.org belton-tx.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
trisantacruz.com trisantacruz.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
trisignup.com trisignup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 11 days
tritheparks.com tritheparks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Mar 2024 May 2024 76 days
ben2shore.org ben2shore.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
beyoutifulrace.com beyoutifulrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 14 days
bigbeachmarathon.com bigbeachmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
unicorn5k.com unicorn5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
unicornracer.com unicornracer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bigislandchallenge.org bigislandchallenge.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
unitedwiththeblue5k.com unitedwiththeblue5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
biketheshore.com biketheshore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
billsbeerrun.com billsbeerrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
shootoutforsoldiers.com virginia.shootoutforsoldiers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 Dec 2023 38 days
nyctri.com virtual.nyctri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 200 days
virtualwinerunturkeytrot.com virtualwinerunturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
blueridgerelay.com blueridgerelay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 May 2024 184 days
blueridgetobeach.com blueridgetobeach.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org boise-id.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 293 days
boiserivermarathon.org boiserivermarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
walkerrun5k.com walkerrun5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
jkyog.org walkforhealthyheartsandminds.jkyog.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 Nov 2023 One Off
bootsandbrews5k.com bootsandbrews5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
wareaglerunfest.com wareaglerunfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
boxerstrail5k.com boxerstrail5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
boxerstrail5k.org boxerstrail5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org boyertown-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
playmakers.com brewrun.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 340 days
bridgerun.org bridgerun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bridgerunnc.org bridgerunnc.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
brittaschase.com brittaschase.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
whiskeyrunnashville.com whiskeyrunnashville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Jul 2023 68 days
whitefishturkeytrot.com whitefishturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 10 days
broomfieldturkeyday.com broomfieldturkeyday.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
wildbillys.run wildbillys.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wilsongobblewobble.com wilsongobblewobble.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
windermeremarathon.com windermeremarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 10 days
winter5k.com winter5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
butte100.com butte100.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
wscogfamilyfunwalkrun.com wscogfamilyfunwalkrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
playmakers.com xcspike.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 233 days
campgladiatorraceseries.com campgladiatorraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
canal.run canal.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
shootoutforsoldiers.com canandaigua.shootoutforsoldiers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Feb 2024 Feb 2024 One Off
candycanelanerun.com candycanelanerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
cannonballmarathon.com cannonballmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
canyontocoastchallenge.com canyontocoastchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
carpetcapital10miler.com carpetcapital10miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
ykmountainmantri.com ykmountainmantri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 Dec 2023 203 days
carygreenwaystour.com carygreenwaystour.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
yorkyhalfmarathon.org yorkyhalfmarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
yourfirstflight.org yourfirstflight.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 11 days
catalinaislandmarathon.com catalinaislandmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
cedarcreekfalldu.com cedarcreekfalldu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
champagne5k.com champagne5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
charlottesvilleturkeytrot.com charlottesvilleturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
chasemudrun.com chasemudrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
cheeky3.com cheeky3.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 Apr 2024 13 days
gourdyspumpkinrun.com chicagosignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 294 days
lopersclub.org hc.lopersclub.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 48 days
oneus.run ia.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 282 days
chinkapinhollow.com chinkapinhollow.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
choochoo9miler.com choochoo9miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
medaldash.com chucknorris.medaldash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
oneus.run wi.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
healthykidsrunningseries.org cleveland-oh.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
coachyantis5k.com coachyantis5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 248 days
coastaltrailruns.com coastaltrailruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 11 days
codelrun.com codelrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
colorado13er.com colorado13er.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 16 days
columbustriathlon.com columbustriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 35 days
cottonrowruns.com cottonrowruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
crawfishmantri.com crawfishmantri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
croatanresults.com croatanresults.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
crookedcreek100.com crookedcreek100.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
crossforlifeflight.org crossforlifeflight.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
racethebronx.com crotona3k.racethebronx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 162 days
crtky.com crtky.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
healthykidsrunningseries.org dallastx.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
darkstrides.com darkstrides.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
degraylaketriathlon.com degraylaketriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
denvermothersday5k.com denvermothersday5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
dkgresults.com dkgresults.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
globalrenewal.org donate.globalrenewal.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
eastern5000.run eastern5000.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
engelwoodrunners.com engelwoodrunners.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
ethne5k.org ethne5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 260 days
fairbornflyer.com fairbornflyer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
fallfestrun.com fallfestrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
farmland5k.com farmland5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
fasttracktiming.com fasttracktiming.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
feattothebeach.com feattothebeach.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
feelthelove5k.net feelthelove5k.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
flagrun5k.com flagrun5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
floridaacrossthestatechallenge.com floridaacrossthestatechallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
floridahalloweenhalfathon.com floridahalloweenhalfathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 May 2024 299 days
floridaholidayhalfathon.com floridaholidayhalfathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 14 days
floridashamrockhalfathon.com floridashamrockhalfathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 14 days
foco500.com foco500.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fosteringfootsteps.com fosteringfootsteps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
frankenfrenzyrun.com frankenfrenzyrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 Oct 2023 One Off
freedomday5k.com freedomday5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
freethem5k.org freethem5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Mar 2024 May 2024 79 days
fresnogives.org fresnogives.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fresnoturkeytrot.com fresnoturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
friendship5k.org friendship5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
frigid5kseries.com frigid5kseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fullmoontrailseries.com fullmoontrailseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
gatewayresiliencerun.com gatewayresiliencerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
gazawod.com gazawod.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
pgb1.org give.pgb1.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year
healthykidsrunningseries.org glasgow-bear-de.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
glendoramemorialday5k.com glendoramemorialday5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
globalrun4water.com globalrun4water.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
glowjbsa.com glowjbsa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
t2t.org golfsat.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 224 days
gourdyspumpkinrun.com grandrapidssignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
greatky.run greatky.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
greatpumpkin10krace.com greatpumpkin10krace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
guinnessbrewrun.com guinnessbrewrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
hachie50.com hachie50.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
triviumracing.com haganstonedu.triviumracing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 Dec 2023 203 days
healthykidsrunningseries.org hampden-ma.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
hawaiianislandchallenge.org hawaiianislandchallenge.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hawaiianislandchallenges.com hawaiianislandchallenges.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hawaiiturkeytrot.com hawaiiturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
heartbreakermarathon.com heartbreakermarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hersheywinerun.com hersheywinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
highlandsgravelclassic.com highlandsgravelclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hillbilly.run hillbilly.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hilltopusa5k.com hilltopusa5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hmsaclassical25k.com hmsaclassical25k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
hofbrauhalf.com hofbrauhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
holoholochallenge.com holoholochallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
houstonholiday5k.com houstonholiday5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hueyprun.com hueyprun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
pgb1.org huntsville.pgb1.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 201 days
icebadgersloppet.com icebadgersloppet.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
oneus.run illinois.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jan 2024 May 2024 114 days
ilove-running.com ilove-running.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
iowa310.com iowa310.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
irlrunwalk.org irlrunwalk.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jan 2024 May 2024 125 days
wgwltrail.com ironhorse.wgwltrail.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 338 days
ironmountainxc.com ironmountainxc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
johnscreeksfinest5k.net johnscreeksfinest5k.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Mar 2024 May 2024 71 days
rockinrogersville.com rockinrogersville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
michiganchallenge.com tickets.michiganchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 28 days
constitution2024.com constitution2024.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Oct 2024 Oct 2024 One Off
redshoerun-bham.org redshoerun-bham.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
epicseriesocr.com reg.epicseriesocr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Sep 2023 124 days
lutsen99er.com reg.lutsen99er.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 207 days
nyctri.com reg.nyctri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 Dec 2023 160 days
turkeytrotchicago.com reg.turkeytrotchicago.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Jul 2023 66 days
bridgesandbluffs.com register.bridgesandbluffs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 196 days
mercymallva.org register.mercymallva.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
reefsrun.com register.reefsrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Mar 2024 327 days
teeoffagainsthungernj.com register.teeoffagainsthungernj.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 186 days
registericeman.com registericeman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
reindeerruncleveland.com reindeerruncleveland.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 5 days
rendlakemarathon.com rendlakemarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
roadraceseries.com roadraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 6 days
rockville10k5k.com rockville10k5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
rockpaperrun.org rockpaperrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
route6610k.com route6610k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
rpefrun.com rpefrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
run4l.run run4l.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
run4onthe4th.com run4onthe4th.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
run4thechildren.com run4thechildren.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runatthepark.com runatthepark.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runbeercity.com runbeercity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runchino.com runchino.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
ruck9.com ruck9.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runninglabtrailfest.com runninglabtrailfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racethebronx.com runningofthebulls.racethebronx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jan 2024 Mar 2024 56 days
imfreakinawesome.com runnova5k21.imfreakinawesome.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
runsalemmo.com runsalemmo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runshinzen.com runshinzen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runsugarlandtx.com runsugarlandtx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runtheridgetrailrun.com runtheridgetrailrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runtheshore.com runtheshore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runtochallenge.com runtochallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
t2t.org runwalkjacksonms.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
t2t.org runwalkmetrodetroit.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Feb 2024 214 days
t2t.org runwalkoklahomacity.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Aug 2023 108 days
t2t.org runwalkprinceton.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 186 days
t2t.org runwalktrinitypasco.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 186 days
runway5kflagler.com runway5kflagler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
adkwhiskeyrun.com adkwhiskeyrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 23 days
salemhalfmarathon.com salemhalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
salutetoservice5k.com salutetoservice5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
adirondackcoastcraftfair.com adirondackcoastcraftfair.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 23 days
santaruncharlotte.com santaruncharlotte.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
adventuresignup.com adventuresignup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
saratogastryders.org saratogastryders.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 203 days
nathanroten.com aegisacademy.nathanroten.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
armonkforautism.org armonkforautism.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
scbtrack.com scbtrack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
senecacreekgreenwayrace.com senecacreekgreenwayrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
alamedapint.com alamedapint.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
alien.run alien.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 23 days
shakori40ultra.com shakori40ultra.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
shamrockshuffle3k.com shamrockshuffle3k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
shopspectrumsports.com shopspectrumsports.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sixpackseries.com sixpackseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sizzlingsolesrace.com sizzlingsolesrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
slowafsantadash.com slowafsantadash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
annapolisrunforthelighthouse.org annapolisrunforthelighthouse.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
annarborfirecracker5k.com annarborfirecracker5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 35 days
annarbormarathon.com annarbormarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 35 days
andersoncountychamber.org andersoncountychamber.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 178 days
southgulfcoveyachtclub.com southgulfcoveyachtclub.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
spc5k.com spc5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
springfeverrun.com springfeverrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
springoutoftheden.com springoutoftheden.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
ascensionstvincentcancerchallenge.org ascensionstvincentcancerchallenge.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
strengthinourstreets.com strengthinourstreets.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
strollforhospice.org strollforhospice.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
academystreetstrut.com academystreetstrut.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 24 days
sugarrushrace.com sugarrushrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
superbowl.run superbowl.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
superbowl4miler.com superbowl4miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
swimtothemoon.net swimtothemoon.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 39 days
appleharvestrun.com appleharvestrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
shootoutforsoldiers.com atlanta.shootoutforsoldiers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 Sep 2023 One Off
atlantapride5k.com atlantapride5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
aut2run.org aut2run.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
the5kchickenrun.com the5kchickenrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thankyouplaces.com thankyouplaces.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
theburnsidemile.com theburnsidemile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
aztlanxcclassic.com aztlanxcclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thejackiepangfund.org thejackiepangfund.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thelouisianamarathon.com thelouisianamarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
theracedirector.com theracedirector.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thewoodlandsmarathon.org thewoodlandsmarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
title9k.com title9k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bataanchallenge.com bataanchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bayareakidstriseries.org bayareakidstriseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
toptiertiming.com toptiertiming.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
tourswithjoy.com tourswithjoy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
beatyesterday.run beatyesterday.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
thedonnafoundation.org tpc.thedonnafoundation.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 Apr 2024 One Off
sunshinecamp.org trailmixrun.sunshinecamp.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 334 days
beercitysacramento.com beercitysacramento.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
beercityseries.com beercityseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
tri312.com tri312.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
trotforturkeys.com trotforturkeys.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
turkeychaserace.com turkeychaserace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
turkeystrut.com turkeystrut.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
turkletrot.com turkletrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
tylerturkeytrot.com tylerturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 9 days
udmusicman5k.com udmusicman5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
blackacrexc.run blackacrexc.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
veteranshavenrun.org veteranshavenrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
veteransmile.com veteransmile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
veteransva5k.com veteransva5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
vintageparkhalfmarathon.com vintageparkhalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
virr.com virr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bloomandzoom.com bloomandzoom.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
virtualwinerun.com virtualwinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
visaliaturkeytrot.com visaliaturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
blossom.run blossom.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
blossombikeride.com blossombikeride.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
vision5k.com vision5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
virginiaroadtripchallenge.com virginiaroadtripchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bobbickel.com bobbickel.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bohicketrun.com bohicketrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
boisehalf.org boisehalf.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 Nov 2023 77 days
boisemarathon.com boisemarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
jkyog.org walk4healthyheartsandminds.jkyog.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 191 days
wallacehuckfest.com wallacehuckfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wallissandshalfmarathon.com wallissandshalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 10 days
bootsfortroops5k.com bootsfortroops5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
wgwltrail.com borderbike.wgwltrail.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 338 days
playmakers.com warmup.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Apr 2024 270 days
warrior5k.com warrior5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bourbonbelt.run bourbonbelt.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
weldyourmettleultra.com weldyourmettleultra.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
healthykidsrunningseries.org breckenridge-co.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
brevardcorporate5k.com brevardcorporate5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
westgatefit.com westgatefit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 7 days
whispertri.com whispertri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
whitefishlakerun.com whitefishlakerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
brokenspokechallenge.com brokenspokechallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
wildturkeychase.com wildturkeychase.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
buckscountymarathonweekend.com buckscountymarathonweekend.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
windsorbrewrace.com windsorbrewrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
healthykidsrunningseries.org buda-kyle-tx.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
withoutlimitscrosscountrycamp.com withoutlimitscrosscountrycamp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
woodlandsmarathon.com woodlandsmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
healthykidsrunningseries.org woodstock-ga.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 293 days
womensdistancefestival.com womensdistancefestival.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Mar 2024 May 2024 66 days
wvseries.com wvseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wvmarathon.com wvmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
ymcawbtri.com ymcawbtri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
caryunitywalk.com caryunitywalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
yorktownindependenceruns.com yorktownindependenceruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
yorkymarathon.org yorkymarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
catalinaislandhalfmarathon.com catalinaislandhalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
cfaandersonrace.com cfaandersonrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
zombiefest.org zombiefest.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
cleaninternational.org challenges.cleaninternational.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 198 days
charlestonwinterseries.com charlestonwinterseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
charlotteracefest.com charlotteracefest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org chattanoogatn.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
cherryblossomexpo.org cherryblossomexpo.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
chicagobrewrun.com chicagobrewrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
oneus.run il.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 282 days
chinkapinhollowgravelgrinder.com chinkapinhollowgravelgrinder.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
oneus.run ne.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
ckcciderrun.com ckcciderrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
climbkili.org climbkili.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
clovisrudolph.run clovisrudolph.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
coastalresortsgolf.com coastalresortsgolf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
codel48.com codel48.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
coloradopeakschallenge.com coloradopeakschallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
competetodefeatbraintumors.com competetodefeatbraintumors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
healthykidsrunningseries.org conshohockenpa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 293 days
covington5k.com covington5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
cow.run cow.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
coyotes1mile.com coyotes1mile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
coyotesinvite.com coyotesinvite.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
dashfordiapers.org dashfordiapers.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
daytonaturkeytrot.com daytonaturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
dcwinerun.com dcwinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
detroitmothersdayrun.com detroitmothersdayrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
gourdyspumpkinrun.com detroitsignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 337 days
devilsdenrun.com devilsdenrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
dogs5k.com dogs5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
danasangels.org donate.danasangels.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
doughnutday5k.com doughnutday5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
dualduel.org dualduel.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
duluthwomenstenmile.com duluthwomenstenmile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org east-brunswick-nj.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
epicislandlaketri.com epicislandlaketri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
epicraces.com epicraces.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 May 2024 185 days
eringobraghrun.com eringobraghrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
fayettevillehalf.com fayettevillehalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
haworthrun.org haworthrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
firecrackerrunwalk.com firecrackerrunwalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
floppinflounder.com floppinflounder.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fortknoxchristmasinjuly.com fortknoxchristmasinjuly.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fortnightbeforechristmas.com fortnightbeforechristmas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
frederickmarketstreetmile.com frederickmarketstreetmile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 24 days
frederickss8k.com frederickss8k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 May 2024 178 days
freedomrun10k.com freedomrun10k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fresnospringfling.com fresnospringfling.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fresnovalentinerun.com fresnovalentinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
furry5k.com furry5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
geisthalf.com geisthalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
healthykidsrunningseries.org georgetown-ma.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 213 days
ghostsandgoblinsrun.com ghostsandgoblinsrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 13 days
ghsmuttstrut.com ghsmuttstrut.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 May 2024 295 days
healthykidsrunningseries.org glenview.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
gobblegallop.com gobblegallop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
gobblewobblerace.com gobblewobblerace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
gobblewobblerace.org gobblewobblerace.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
t2t.org golfbentwater.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Jul 2023 One Off
t2t.org golfeagleoaks.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Dec 2023 160 days
t2t.org golfmbveteransday.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 162 days
haiti5k.run haiti5k.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
halloween31.run halloween31.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
harpoon5miler.com harpoon5miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
harvest5k.com harvest5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hauntedhousingrun.com hauntedhousingrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
heritageeagles5k.com heritageeagles5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hhsprojectgraduation.org hhsprojectgraduation.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 364 days
highlandsranch5k.com highlandsranch5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
hitopsprincetonhalfmarathon.com hitopsprincetonhalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hmsaclassic25k.com hmsaclassic25k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
healthykidsrunningseries.org hoffman-estates-palatine-il.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
holdthefortraces.com holdthefortraces.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
playmakers.com holiday.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 340 days
honorthefallen5k.com honorthefallen5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
huffingforstuffing.com huffingforstuffing.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
healthykidsrunningseries.org indiana-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
gourdyspumpkinrun.com indianapolissignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 337 days
itascaoktoberfast5k.org itascaoktoberfast5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Mar 2024 May 2024 73 days
izzorace.com izzorace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
healthykidsrunningseries.org jarrell-tx.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 293 days
jeffgalloway131.com jeffgalloway131.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
jicrun.com jicrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
jimmyrun.com jimmyrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
jingleallthewayrun.com jingleallthewayrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
jinglejog5k.com jinglejog5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
jubileejog5k.com jubileejog5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
juneteenthfreedomrun.com juneteenthfreedomrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
jurassicrun.com jurassicrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
kaylarun.com kaylarun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
kesslermountainjam.com kesslermountainjam.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
keylargobridgerun.com keylargobridgerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
keylargotokeywestchallenge.com keylargotokeywestchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
knobstone.run knobstone.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
kprunwalkroll.com kprunwalkroll.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
laborday.run laborday.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lahalf.com lahalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lakebluffpumpkinchase.org lakebluffpumpkinchase.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lakecumberlandcpac.com lakecumberlandcpac.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lakecumberlandrunners.com lakecumberlandrunners.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lakejacksonturkeytrot.com lakejacksonturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
healthykidsrunningseries.org lakenona.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
healthykidsrunningseries.org lancaster-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
healthykidsrunningseries.org lansdale-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 293 days
leesjbr.com leesjbr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
leprechauns.run leprechauns.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lighthouseloophalfmarathon.com lighthouseloophalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lmhalf.com lmhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
logantriathlon.com logantriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
loggerheadtriathlon.com loggerheadtriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
gourdyspumpkinrun.com louisvillesignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
loverunwestlake.com loverunwestlake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lynchburgsuperherorun.com lynchburgsuperherorun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
machomtb.com machomtb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mag7raceseries.com mag7raceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
medaldash.com marchofthedogs.medaldash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 5 days
healthykidsrunningseries.org marplenewtown-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
massacremarathon.com massacremarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
maui5k.org maui5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mauiislandchallenge.com mauiislandchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
mcrrcsudsandsoles.org mcrrcsudsandsoles.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
healthykidsrunningseries.org menomonie-wi.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
milegobbler.com milegobbler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
miles4myeloma.org miles4myeloma.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
militarycitymm.com militarycitymm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
millbrookwinerun.com millbrookwinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
minergoldrush.com minergoldrush.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
molokaichallenges.com molokaichallenges.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
montanagravelchallenge.com montanagravelchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
healthykidsrunningseries.org mount-juliet-tn.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
mountainmanmemorialmarch.com mountainmanmemorialmarch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
msgulfcoastmarathon.com msgulfcoastmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
leadvilleraceseries.com mtbcamp.leadvilleraceseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 340 days
musiccityruckmarch.com musiccityruckmarch.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
myplacetorace.com myplacetorace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
nanticokeriverswimandtri.com nanticokeriverswimandtri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
t2t.org neverforgetconcert-nashville.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
newrivermarathon.com newrivermarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 204 days
healthykidsrunningseries.org newton-ma.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 216 days
nice5k.com nice5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
nun.run nun.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
t2t.org nycrun.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
oahuchallenge.com oahuchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
healthykidsrunningseries.org oconomowoc-wi.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
ocssaints5k.org ocssaints5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
odysseyswimrun.com odysseyswimrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 204 days
omniturkeytrot5k.com omniturkeytrot5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
onhillevents.com onhillevents.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
onurmark.net onurmark.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 203 days
otillomackinac.com otillomackinac.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
oviedoturkeytrot.com oviedoturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
palmblufftrailrace.com palmblufftrailrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
pascozeropointfivek.org pascozeropointfivek.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
paws5k.com paws5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
pawsfurpink.com pawsfurpink.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
pepsichallengeskirace.com pepsichallengeskirace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
healthykidsrunningseries.org perkasie-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 May 2024 176 days
personalbestquest5miler.com personalbestquest5miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
philly76challenge.com philly76challenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
piedmontoktrot.org piedmontoktrot.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pistolultra.com pistolultra.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
raawc.com raawc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racebethanybeach.com racebethanybeach.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
raceforhome.com raceforhome.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racefortheprintery.com racefortheprintery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
istpsu.com test-rsu-prod1.istpsu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 36 days
dnc.com tickets.dnc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 8 days
raleighhauntedhouse.com tickets.raleighhauntedhouse.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 36 days
beerandcheesefest.com beerandcheesefest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Oct 2024 Oct 2024 3 days
windandvibes.org windandvibes.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
chippewavalleyfacilityengineers.org chippewavalleyfacilityengineers.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
dnc.com flsummit.dnc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 8 days
saratogastryders.org holidayparty.saratogastryders.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 38 days
jscwempowermentconference.com jscwempowermentconference.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
pistonprops.com pistonprops.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
reindeerrun.org reindeerrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 May 2024 311 days
ridewythehope.org ridewythehope.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
badgerstri.com riverwinds.badgerstri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Oct 2023 158 days
rockhillstriders.org rockhillstriders.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
rocknrun4kids.com rocknrun4kids.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
landonpadgett.org run.landonpadgett.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
run317.com run317.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
runajm.com runajm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runforruss.com runforruss.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runhard.org runhard.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runmambo.com runmambo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runmarshall.com runmarshall.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
runmilehigh.com runmilehigh.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runningoftheleprechauns.com runningoftheleprechauns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runningwithed.com runningwithed.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runontherocks.org runontherocks.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runrainier.com runrainier.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runsanta.com runsanta.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runsignup.com runsignup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 11 days
runthe110.com runthe110.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runthesplit.com runthesplit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
t2t.org runwalkalpena.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 224 days
t2t.org runwalkcapegirardeau.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Jul 2023 One Off
t2t.org runwalkdenver.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
t2t.org runwalkjeffersoncity.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 186 days
t2t.org runwalkmedina.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 224 days
t2t.org runwalkmyrtlebeach.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Jul 2023 64 days
runwalkorroll5k.com runwalkorroll5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
t2t.org runwalktempe.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 Nov 2023 One Off
runwiththealewives.com runwiththealewives.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runwiththecopswaukesha.com runwiththecopswaukesha.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
runyamacraw.com runyamacraw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 11 days
runyouryear.com runyouryear.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sacketsharbormarathon.com sacketsharbormarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bostontobarharbor.com bostontobarharbor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
sbymarathon.com sbymarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
seaturtlehalf.com seaturtlehalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
semcsports.com semcsports.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
alpineendurancemedicine.com alpineendurancemedicine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
alloutmultipro.com alloutmultipro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 221 days
sixcinvite.com sixcinvite.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
amberlycharity5k.com amberlycharity5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
slowaftrickortrot.com slowaftrickortrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
annapolisrunfest.com annapolisrunfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
soaraboveadversity.org soaraboveadversity.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
somerstrong5k.org somerstrong5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
spacecoastturkeytrot.com spacecoastturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
spaceracehsv.com spaceracehsv.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
splitsecondpro.com splitsecondpro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 49 days
springcleanrace.com springcleanrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
stetsonrentals.com stetsonrentals.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
stopthesilencewalk.org stopthesilencewalk.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sugarbranch.run sugarbranch.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
summitnorthtrailruns.com summitnorthtrailruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
sunsetscramble.com sunsetscramble.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
svkidstri.org svkidstri.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
syracusehalf.com syracusehalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
applefestrun.com applefestrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
tahoetomalibu.com tahoetomalibu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
tammanyturkeytrot.com tammanyturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
ardmorerah.com ardmorerah.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
tctcjinglebellrun.com tctcjinglebellrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
avalon50.com avalon50.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 20 days
theblazing5k.com theblazing5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
awesome80schallenge.com awesome80schallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
thefastandthefiorini.com thefastandthefiorini.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thegreatsouthbayrun.com thegreatsouthbayrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thelooprace.com thelooprace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
azhrun.com azhrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
theperfect10.org theperfect10.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
backbaytriathlon.com backbaytriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
theultimateheartrace.com theultimateheartrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thewoodlandsmarathon.net thewoodlandsmarathon.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
thrillscranton.com thrillscranton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
tiger10k.com tiger10k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
baltcopolicerun.com baltcopolicerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
tobaccoroadrelay.com tobaccoroadrelay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bashatbeach.com bashatbeach.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
battleofwaterlootri.com battleofwaterlootri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 35 days
battleship12k.com battleship12k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
tourdedonutohio.com tourdedonutohio.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bearlakebrawl.com bearlakebrawl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
trailheadfootrace.com trailheadfootrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
beattheheatrun.com beattheheatrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
triangletix.bm triangletix.bm
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
triridgefield.org triridgefield.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Dec 2023 May 2024 147 days
belmar5.com belmar5.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
turkeychase.com turkeychase.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
turkeytrothawaii.com turkeytrothawaii.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
tyler5k.run tyler5k.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bethanybeach5k.com bethanybeach5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
bethanyturkeytrot.com bethanyturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
unicornrunner.com unicornrunner.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
unifiedrunwalkforcancer.com unifiedrunwalkforcancer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
unleashedvirtualruns.com unleashedvirtualruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bikesignup.com bikesignup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 15 days
unionchamber.com biz.unionchamber.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jul 2023 Feb 2024 216 days
blackacre.run blackacre.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
verobeachtriathlon.com verobeachtriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
veteranshavenrun.com veteranshavenrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
veteranshonorrun.org veteranshonorrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
blazin5miler.com blazin5miler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
blueravenproductions.com blueravenproductions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jan 2024 May 2024 139 days
jkyog.org walkforeducationandhealthcare.jkyog.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 191 days
walkthedogday.com walkthedogday.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wallballforwarfighters.com wallballforwarfighters.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
bohickethalf.com bohickethalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
boisehalf.com boisehalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 Jan 2024 82 days
walnutcreekrunclub.com walnutcreekrunclub.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
warriorsobstaclesrace.com warriorsobstaclesrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
boscobelfirecrackerrun.com boscobelfirecrackerrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
westyhalf.com westyhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
whitelakehalf.com whitelakehalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wilsoncreek.run wilsoncreek.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wisconsinduseries.com wisconsinduseries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
buckeyechallenge.com buckeyechallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
buckeyechallenge2021.com buckeyechallenge2021.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
worldfoodrun.com worldfoodrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wshs5k.com wshs5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
wyomingvalleystriders.com wyomingvalleystriders.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
cafecito5k.com cafecito5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org canonsburg-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 213 days
yorkyturkeytrot.com yorkyturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
yorkyturkeytrot.org yorkyturkeytrot.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racethebronx.com youthinmovement.racethebronx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Mar 2024 327 days
healthykidsrunningseries.org carthage.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 Jan 2024 88 days
healthykidsrunningseries.org cedar-park.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
celticsolstice.com celticsolstice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 25 days
celticsolstice.org celticsolstice.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
zorvinowinerun.com zorvinowinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
charitydistancefestival.com charitydistancefestival.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
gourdyspumpkinrun.com cincinnatisignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
cinnaminsonrunning.com cinnaminsonrunning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
city5k.com city5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
cityofcollegeshalf.com cityofcollegeshalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
clevelandstpatricksdayrun.com clevelandstpatricksdayrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 260 days
clevelandtenmiler.com clevelandtenmiler.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 16 days
healthykidsrunningseries.org coatesvillepa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
cocyclingtoserve.com cocyclingtoserve.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
coloradosundownxc.com coloradosundownxc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 Apr 2024 One Off
coloradotrailchallenge.com coloradotrailchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
copperhead20.com copperhead20.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
corinthrotary5k.com corinthrotary5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
countdowntofitness.org countdowntofitness.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
craftbeerhalf.com craftbeerhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
craftclassicatlanta.com craftclassicatlanta.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 Apr 2024 One Off
crafthalf.com crafthalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
crafthalfmarathon.com crafthalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 22 days
cyclemountdora.com cyclemountdora.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
cycletosavelives.com cycletosavelives.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
healthykidsrunningseries.org denver.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 336 days
wgwltrail.com derailed.wgwltrail.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 Dec 2023 78 days
shootoutforsoldiers.com nctriangle.shootoutforsoldiers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 Dec 2023 75 days
dogdaysjulyrun.com dogdaysjulyrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 Apr 2024 One Off
marisafund.org donate.marisafund.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
drumstickdash.net drumstickdash.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
drumstickdash.org drumstickdash.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 21 days
eggslegs.com eggslegs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
eltourdezona.org eltourdezona.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 217 days
eriehalf.com eriehalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
eringobraughrun.com eringobraughrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
fall5k.com fall5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
familiesonchallenge.com familiesonchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
fff5kfunrun.com fff5kfunrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
firststridesnmb.com firststridesnmb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 20 days
flamingfoliagerelay.com flamingfoliagerelay.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fontanatriathlon.com fontanatriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
foster5k.org foster5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fox8foxtrot.com fox8foxtrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 356 days
freedomtriathlon.com freedomtriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fresnopiday.com fresnopiday.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
fresnosoloruns.com fresnosoloruns.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
friendshipdayct.com friendshipdayct.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
frozenfootrace.com frozenfootrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
ftsc24.com ftsc24.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
gfarun.org gfarun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
glowinthedark5k.com glowinthedark5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 May 2024 355 days
t2t.org golfdcmetro.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Aug 2023 108 days
t2t.org golflowcountry.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 162 days
t2t.org golfmarinepark.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2023 One Off
t2t.org golfnortherncolorado.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Feb 2024 Feb 2024 One Off
t2t.org golfpeachtree.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Dec 2023 224 days
greatbearchase.com greatbearchase.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
greensborogobbler.run greensborogobbler.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 19 days
t2t.org gtptampabay.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 278 days
heartthrobrun.com heartthrobrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
heatthestreetsomaha.com heatthestreetsomaha.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
heatthestreetsomaha.org heatthestreetsomaha.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
herohustle5k.com herohustle5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hitopsprincetonhalf.com hitopsprincetonhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hitthebrixx.com hitthebrixx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hobooken5k.com hobooken5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
holycowrun.com holycowrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hoopla.run hoopla.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
hotterthanjuly.run hotterthanjuly.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
houstonresolutionrun.com houstonresolutionrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
htmfreedom5k.com htmfreedom5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
innsbrookhalf.com innsbrookhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
ipswichalehalfmarathon.com ipswichalehalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
ironmountainlegend.com ironmountainlegend.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
irun4movement.com irun4movement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
irun4rescues.com irun4rescues.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 18 days
janney5k.org janney5k.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
jerseycitymarathon.com jerseycitymarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
healthykidsrunningseries.org johnstown-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
johnstownbeermile.com johnstownbeermile.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 17 days
gourdyspumpkinrun.com kansascitysignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 294 days
kiwanismidnightrun.com kiwanismidnightrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 248 days
knaextravaganza.com knaextravaganza.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
kolachefactory5k.com kolachefactory5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
kwanzaa5k.com kwanzaa5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lakeeffecthalfmarathon.com lakeeffecthalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lakesuperiorshorerun.com lakesuperiorshorerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lambertclassic.com lambertclassic.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
landsharktriathlon.com landsharktriathlon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
gourdyspumpkinrun.com lansingsignup.gourdyspumpkinrun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
leavestoleases.com leavestoleases.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lifewideopen.com lifewideopen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lifewideopen.org lifewideopen.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
llbeanroadrace.com llbeanroadrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
lobocancerchallenge.org lobocancerchallenge.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
shootoutforsoldiers.com longisland.shootoutforsoldiers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Nov 2023 Feb 2024 91 days
longwoodmonsterdash.com longwoodmonsterdash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
medaldash.com love.medaldash.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
love5k.com love5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
lubbockwinerun.com lubbockwinerun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
luckybrewrace.com luckybrewrace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 16 days
unboundgravel.com lunar.unboundgravel.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 Apr 2024 309 days
manhattanmontauk.com manhattanmontauk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
marshalluniversitymarathon.com marshalluniversitymarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
mauimarathonsignup.com mauimarathonsignup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
maythe4thrunwithyou.com maythe4thrunwithyou.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
maythecourserace.com maythecourserace.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
healthykidsrunningseries.org mcguire-air-force-base-nj.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Oct 2023 May 2024 213 days
mcrrcrununderlights.com mcrrcrununderlights.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
healthykidsrunningseries.org mechanicsville-va.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Aug 2023 May 2024 293 days
healthykidsrunningseries.org midlothian-va.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
mikeariensrunwalk.com mikeariensrunwalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 244 days
milehightri.com milehightri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 15 days
oneus.run minnesota.oneus.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
missouriendurancechallenge.com missouriendurancechallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mommasday5k.com mommasday5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
moorestownturkeytrot.com moorestownturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mothersdayrunwalk.com mothersdayrunwalk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mountaingoatrun.org mountaingoatrun.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
movemontanachallenge.com movemontanachallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
movemtchallenge.com movemtchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
movethrough.org movethrough.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
msgratos.com msgratos.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
mtlemmongravelgrinder.com mtlemmongravelgrinder.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
healthykidsrunningseries.org mullica-hill-mantua-nj.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
musiccitymilesandmemories.com musiccitymilesandmemories.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
healthykidsrunningseries.org new-braunfels-tx.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Mar 2024 May 2024 75 days
newtownturkeytrot.com newtownturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
newyearsday5k.run newyearsday5k.run
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 14 days
nickycass5kchallenge.com nickycass5kchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
northtexasturkeytrot.com northtexasturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Apr 2024 May 2024 25 days
t2t.org nyctowerclimb.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Nov 2023 186 days
ola5k.com ola5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
otilloorcas.com otilloorcas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
oviedohalloween5k.com oviedohalloween5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
ovtri.com ovtri.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
paddlesignup.com paddlesignup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 17 days
panther5krun.com panther5krun.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
parkshalfmarathon.com parkshalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
healthykidsrunningseries.org parrish-fl.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
paws4pride.org paws4pride.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
payitforward5k.com payitforward5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 13 days
healthykidsrunningseries.org perryhall-md.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 Oct 2023 123 days
healthykidsrunningseries.org phoenixville-pa.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Sep 2023 May 2024 252 days
healthykidsrunningseries.org pinehurst-nc.healthykidsrunningseries.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 May 2024 1 year, 12 days
pinkathon.com pinkathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pirates5k.com pirates5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pistolcreekmarathon.com pistolcreekmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
pomona5k.com pomona5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
poppasday5k.com poppasday5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
portervillerunforlife.com portervillerunforlife.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 12 days
princetonhalfmarathon.com princetonhalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
princetonhalfmarathon.org princetonhalfmarathon.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
pupsandpastries.com pupsandpastries.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
pvaquathlon5k.com pvaquathlon5k.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 4 days
quietresortsgolf.com quietresortsgolf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racedaymanagement.com racedaymanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Mar 2024 May 2024 55 days
racethebloom.com racethebloom.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
racethedecades.com racethedecades.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
radskimo.com radskimo.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
redcarpetrunhalf.com redcarpetrunhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
redmondharvesthalf.com redmondharvesthalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
redwhiteandruck.com redwhiteandruck.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2024 May 2024 One Off
305halfmarathon.com reg.305halfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 Jun 2023 Nov 2023 161 days
chicagohalfmarathon.com reg.chicagohalfmarathon.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Feb 2024 286 days
chicagospringhalf.com reg.chicagospringhalf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-TMP7T3SB18 May 2023 Apr 2024 347 days
saratogastryders.org summerpicnic.saratogastryders.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
wytheharvestfest.com wytheharvestfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
sfsevents.org can-ogr.sfsevents.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 39 days
gorgasstreethorror.com gorgasstreethorror.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 45 days
noncomm.org noncomm.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
DCLACROSSETIX.CSELAX.COM
Non IP Attributes
Attribute First Last
GTM GTM-G-TMP7T3SB18 May 2023 May 2024
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024
DCLACROSSETIX.CSELAX.COM
Overlap Attribute Domains
lakewv.com lakewv.com
lightsonthelakewv.com lightsonthelakewv.com
pistonsprops.com pistonsprops.com
pokerchipsforscholarships.com pokerchipsforscholarships.com
polarisstaraward.com polarisstaraward.com
rhythmofhopebenefitconcert.com rhythmofhopebenefitconcert.com
advice5kturkeytrot.com advice5kturkeytrot.com
bravestbbq.t2t.org bravestbbq.t2t.org
golf.huskyboosters.org golf.huskyboosters.org
heroescuptickets.t2t.org heroescuptickets.t2t.org
houseofshadows.org houseofshadows.org
reliefbeerfest.com reliefbeerfest.com
pistonprop.com pistonprop.com
poker.historiclongwood.com poker.historiclongwood.com
polarisstarawards.com polarisstarawards.com
sellsbroadwaydancecompany.com sellsbroadwaydancecompany.com
thenight.charlottetranshealth.org thenight.charlottetranshealth.org
dclacrossetix.cselax.com dclacrossetix.cselax.com
hauntedstagestop.com hauntedstagestop.com
screamfestparanormal.com screamfestparanormal.com
wvlake.com wvlake.com
dclacrosssetix.cselax.com dclacrosssetix.cselax.com
ghentpride.com ghentpride.com
kiwaniscarsandcandyshow.com kiwaniscarsandcandyshow.com
pistonsprop.com pistonsprop.com
allstarholidayskills.com allstarholidayskills.com
startuprunwayfoundation.com startuprunwayfoundation.com
amshaunts.com amshaunts.com
appreciationdinner.t2t.org appreciationdinner.t2t.org
teeup.laclj.org teeup.laclj.org
dodgepointoysterfarm.org dodgepointoysterfarm.org
genovesedinnerdance.t2t.org genovesedinnerdance.t2t.org
goodform.playmakers.com goodform.playmakers.com
haunt.ashlandberryfarm.com haunt.ashlandberryfarm.com
midlandmusicfest.com midlandmusicfest.com
pumpkin.ashlandberryfarm.com pumpkin.ashlandberryfarm.com
ksfraceseries.com ksfraceseries.com
lahey5k.org lahey5k.org
lakeloop.playmakers.com lakeloop.playmakers.com
lakenormanhalfmarathon.com lakenormanhalfmarathon.com
lakeunion10k.com lakeunion10k.com
lastmilerace.com lastmilerace.com
lawrenceburg-in.healthykidsrunningseries.org lawrenceburg-in.healthykidsrunningseries.org
lday5k.run lday5k.run
leadman.leadvilleraceseries.com leadman.leadvilleraceseries.com
littleredheart5k.org littleredheart5k.org
lombard-il.healthykidsrunningseries.org lombard-il.healthykidsrunningseries.org
loveinactionrun.com loveinactionrun.com
loverunstheworld.com loverunstheworld.com
luckydogdash.com luckydogdash.com
lucsrun.com lucsrun.com
lwyl5k.com lwyl5k.com
lynchburgroadrunners.org lynchburgroadrunners.org
machotrailrun.com machotrailrun.com
mainelighthouseride.com mainelighthouseride.com
mcrrcrunforroses.org mcrrcrunforroses.org
media-pa.healthykidsrunningseries.org media-pa.healthykidsrunningseries.org
mightymoose5k.org mightymoose5k.org
milesformeals5k.com milesformeals5k.com
milesformills.com milesformills.com
milesformills.org milesformills.org
militarycityrwr.com militarycityrwr.com
millertonmadness.com millertonmadness.com
milwaukeesignup.gourdyspumpkinrun.com milwaukeesignup.gourdyspumpkinrun.com
missioninnrun.org missioninnrun.org
missionpossiblerun.com missionpossiblerun.com
momrun.bookthatevent.com momrun.bookthatevent.com
monarchcrestcrank.com monarchcrestcrank.com
moonlightmadness.run moonlightmadness.run
moorestowntrails.org moorestowntrails.org
mountaingoat.run mountaingoat.run
movemt.com movemt.com
mtcturkeytrot.com mtcturkeytrot.com
mtspokanerun.com mtspokanerun.com
muddytiremtb.com muddytiremtb.com
mylapsbolivia.com mylapsbolivia.com
naptownrun.com naptownrun.com
nashua-nh.healthykidsrunningseries.org nashua-nh.healthykidsrunningseries.org
nassaucountyturkeytrot.com nassaucountyturkeytrot.com
newengland.oneus.run newengland.oneus.run
nordicdanceinvitational.com nordicdanceinvitational.com
northforktri.com northforktri.com
northshorehalfmarathon.com northshorehalfmarathon.com
norwalk-oh.healthykidsrunningseries.org norwalk-oh.healthykidsrunningseries.org
oakmontrun4cac.org oakmontrun4cac.org
obseniorgames.org obseniorgames.org
oceancityrunfest.com oceancityrunfest.com
ohanaholidayrun.com ohanaholidayrun.com
oldglorymarathon.com oldglorymarathon.com
orangecityturkeytrot5k.com orangecityturkeytrot5k.com
oregon.epicseriesocr.com oregon.epicseriesocr.com
otilloaustin.com otilloaustin.com
owschicago.com owschicago.com
pacingthecage.run pacingthecage.run
ratrelayaz.com ratrelayaz.com
peachstatechallenge.com peachstatechallenge.com
phoenixhonorrun.org phoenixhonorrun.org
pinkdiamondbikeride.com pinkdiamondbikeride.com
pinkonparade.org pinkonparade.org
pistolcreekmarathon.org pistolcreekmarathon.org
pitman-nj.healthykidsrunningseries.org pitman-nj.healthykidsrunningseries.org
polarprowlrun.com polarprowlrun.com
pooches.run pooches.run
project54.org project54.org
race.bonefrogchallenge.com race.bonefrogchallenge.com
race303.com race303.com
racecrossroads.com racecrossroads.com
reddirtmudrun.com reddirtmudrun.com
reg.austinrattlermtb.com reg.austinrattlermtb.com
reg.bigsugargravel.com reg.bigsugargravel.com
reg.cheqmtb.com reg.cheqmtb.com
reg.turkeytrotmiami.com reg.turkeytrotmiami.com
reg.unboundgravel.com reg.unboundgravel.com
register.runthepeninsula.com register.runthepeninsula.com
remembrancerun.com remembrancerun.com
renototheredwoods.com renototheredwoods.com
resolutionrunner.com resolutionrunner.com
rhodeislandwinerun.com rhodeislandwinerun.com
riverrunhalf.com riverrunhalf.com
roswellturkeyrun.com roswellturkeyrun.com
rungsp.com rungsp.com
runhutchinsonisland.com runhutchinsonisland.com
runningoftheturkeys.com runningoftheturkeys.com
runningscared5miler.com runningscared5miler.com
runofhopeseattle.org runofhopeseattle.org
runscore.runsignup.com runscore.runsignup.com
runsistersrun.com runsistersrun.com
runstcharles.com runstcharles.com
runtheboar.com runtheboar.com
runthebridge.org runthebridge.org
runthehiawatha.com runthehiawatha.com
runthenight5k.com runthenight5k.com
runtothesunmaui.com runtothesunmaui.com
runvero.com runvero.com
runwalkankeny.t2t.org runwalkankeny.t2t.org
runwalkbethel.t2t.org runwalkbethel.t2t.org
runwalkbuffalo.t2t.org runwalkbuffalo.t2t.org
runwalkdelmarva.t2t.org runwalkdelmarva.t2t.org
runwalknorthernky.t2t.org runwalknorthernky.t2t.org
runwalkorlando.t2t.org runwalkorlando.t2t.org
runwalkpugetsound.t2t.org runwalkpugetsound.t2t.org
runwalkstaugustine.t2t.org runwalkstaugustine.t2t.org
runwalkutica.t2t.org runwalkutica.t2t.org
run-walk-roll.org run-walk-roll.org
run4thechildren.org run4thechildren.org
runboogienights.com runboogienights.com
runbrevard.com runbrevard.com
runclimbbiloxi.t2t.org runclimbbiloxi.t2t.org
runclub.playmakers.com runclub.playmakers.com
runcoloradorelays.com runcoloradorelays.com
sagecitytri.org sagecitytri.org
sandiegocentury.com sandiegocentury.com
santarosaturkeytrot.com santarosaturkeytrot.com
santascurry.com santascurry.com
santasdashforcash.com santasdashforcash.com
scottcoffeerun.com scottcoffeerun.com
secondwindrunningclub.org secondwindrunningclub.org
akronsignup.gourdyspumpkinrun.com akronsignup.gourdyspumpkinrun.com
alzrun.com alzrun.com
altamonte-springs.healthykidsrunningseries.org altamonte-springs.healthykidsrunningseries.org
shamrock5kbeerrun.com shamrock5kbeerrun.com
alienhalf.com alienhalf.com
sgcyc.com sgcyc.com
shamrockshufflefl.com shamrockshufflefl.com
sharontimlinrace.org sharontimlinrace.org
allentown-pa.healthykidsrunningseries.org allentown-pa.healthykidsrunningseries.org
allsportsproductionsinc.com allsportsproductionsinc.com
allturkeytrots.com allturkeytrots.com
signup.houstoncorporate5k.com signup.houstoncorporate5k.com
silver50.leadvilleraceseries.com silver50.leadvilleraceseries.com
amazinghalf.com amazinghalf.com
skisignup.com skisignup.com
smallgroupladies.com smallgroupladies.com
snowfunrun.org snowfunrun.org
solematesrace.com solematesrace.com
soundview5k.racethebronx.com soundview5k.racethebronx.com
speedy-feet.com speedy-feet.com
spinalnetworkchallenge.org spinalnetworkchallenge.org
springdistanceclassic.com springdistanceclassic.com
springmeadowtri.com springmeadowtri.com
artlife5k.com artlife5k.com
starsstripesandstrides.com starsstripesandstrides.com
10kturkeytrek.com 10kturkeytrek.com
steps4students.org steps4students.org
stone-mill-50-mile.org stone-mill-50-mile.org
stoningtonwinerun.com stoningtonwinerun.com
stressbuster5k.com stressbuster5k.com
strutwytheus.org strutwytheus.org
stsrun.com stsrun.com
stuffyourfacerace.com stuffyourfacerace.com
sunmarathon.com sunmarathon.com
summersizzlertri.com summersizzlertri.com
superbowl.playmakers.com superbowl.playmakers.com
anchoragemayorsmarathon.com anchoragemayorsmarathon.com
tacosnmargaritas5k.com tacosnmargaritas5k.com
teamowen.org teamowen.org
aurora-co.healthykidsrunningseries.org aurora-co.healthykidsrunningseries.org
thebridgerun.com thebridgerun.com
thebaybridgerun.com thebaybridgerun.com
thebaybridgewalk.com thebaybridgewalk.com
thewalkingdead.medaldash.com thewalkingdead.medaldash.com
baltimore.shootoutforsoldiers.com baltimore.shootoutforsoldiers.com
baltimoretri.com baltimoretri.com
timingmatt.com timingmatt.com
title9krun.com title9krun.com
baybridgewalk.com baybridgewalk.com
tomokamarathon.com tomokamarathon.com
trailathon.run trailathon.run
trailmix5k.sunshinecampus.org trailmix5k.sunshinecampus.org
trailseries.org trailseries.org
beercitysanjose.com beercitysanjose.com
beercityslam.com beercityslam.com
trigoddesstri.com trigoddesstri.com
trinonakids.org trinonakids.org
triadbrewsfest.com triadbrewsfest.com
trolleyrun.org trolleyrun.org
bendtowhistler.com bendtowhistler.com
turkeydashcharlotte.com turkeydashcharlotte.com
turkeytrails.com turkeytrails.com
turkeytrotbr.com turkeytrotbr.com
turkeytrotcleveland.com turkeytrotcleveland.com
turkeytrotfresno.com turkeytrotfresno.com
tuscaloosahalf.com tuscaloosahalf.com
tuscaloosaturkeytrot.com tuscaloosaturkeytrot.com
uglytree.run uglytree.run
bigbadwolferun.com bigbadwolferun.com
bigfootdash.com bigfootdash.com
biggerintexaschallenge.com biggerintexaschallenge.com
bigislandchallenge.com bigislandchallenge.com
bikecityfondo.com bikecityfondo.com
bikehutclassic.org bikehutclassic.org
billingscraftbeerweek.com billingscraftbeerweek.com
usa.medaldash.com usa.medaldash.com
bishopranchturkeytrot.com bishopranchturkeytrot.com
velocitymultisport.com velocitymultisport.com
verobeachhalf.com verobeachhalf.com
villetovillerelay.com villetovillerelay.com
bloomingtonwinerun.com bloomingtonwinerun.com
virtual.playmakers.com virtual.playmakers.com
visaliasoloruns.com visaliasoloruns.com
visaliaturkeytrot.org visaliaturkeytrot.org
volunteernyc.t2t.org volunteernyc.t2t.org
boisemarathon.org boisemarathon.org
boiserivermarathon.com boiserivermarathon.com
wagrace.com wagrace.com
walk4friends.com walk4friends.com
bookthatevent.com bookthatevent.com
brandermillrace.com brandermillrace.com
brewrun5k.com brewrun5k.com
weston5k.com weston5k.com
brookmills10k.com brookmills10k.com
bth5k.org bth5k.org
willrunforfoodsvdp.com willrunforfoodsvdp.com
windsorcorace.com windsorcorace.com
witchrun.com witchrun.com
wolfmantriathlon.org wolfmantriathlon.org
women4women.run women4women.run
womenrunthed.com womenrunthed.com
wonderful5k.com wonderful5k.com
wrightsvilleplunge.com wrightsvilleplunge.com
caledonia-mi.healthykidsrunningseries.org caledonia-mi.healthykidsrunningseries.org
calvary5k.com calvary5k.com
cambridgecrabrun.com cambridgecrabrun.com
carlise-pa.healthykidsrunningseries.org carlise-pa.healthykidsrunningseries.org
carterville.healthykidsrunningseries.org carterville.healthykidsrunningseries.org
carygreenwayshalfmarathon.com carygreenwayshalfmarathon.com
catalina100.com catalina100.com
cdamarathon.com cdamarathon.com
cedarcreekspringdu.com cedarcreekspringdu.com
central5k.com central5k.com
charliepostclassic.com charliepostclassic.com
zydecomarathon.com zydecomarathon.com
cheahachallenge.com cheahachallenge.com
chicagoriverswim.org chicagoriverswim.org
chippinginforthechaplaincy.com chippinginforthechaplaincy.com
mn.oneus.run mn.oneus.run
christmascheerwinerun.com christmascheerwinerun.com
christmastown5k.com christmastown5k.com
cincysignup.gourdyspumpkinrun.com cincysignup.gourdyspumpkinrun.com
citrusgrove5k.com citrusgrove5k.com
cityoftreesmarathon.com cityoftreesmarathon.com
cityoftreesmarathon.org cityoftreesmarathon.org
citypark5k.com citypark5k.com
clevelandchilibowlrun.com clevelandchilibowlrun.com
cliftontx.healthykidsrunningseries.org cliftontx.healthykidsrunningseries.org
climbeverestchallenge.com climbeverestchallenge.com
coasttocoastchallenge.com coasttocoastchallenge.com
codybeermile.com codybeermile.com
collegeville-pa.healthykidsrunningseries.org collegeville-pa.healthykidsrunningseries.org
coloradowomensclassic.com coloradowomensclassic.com
coltonsrun.com coltonsrun.com
communitytableracestoendhunger.com communitytableracestoendhunger.com
concord-township-pa.healthykidsrunningseries.org concord-township-pa.healthykidsrunningseries.org
conquertheoverlook.com conquertheoverlook.com
conshyclassic.com conshyclassic.com
cozytoesrace.com cozytoesrace.com
craftbrewerychallenge.com craftbrewerychallenge.com
crcmiledash.com crcmiledash.com
crossstock.run crossstock.run
cure4cam.org cure4cam.org
cyclecoasttocoast.com cyclecoasttocoast.com
dads5k.com dads5k.com
dallasholiday5k.com dallasholiday5k.com
damsiterun.com damsiterun.com
dartwalk.danasangels.org dartwalk.danasangels.org
dashfordiapers.com dashfordiapers.com
delawareohio.healthykidsrunningseries.org delawareohio.healthykidsrunningseries.org
dirksenderby.com dirksenderby.com
downers-grove-il.healthykidsrunningseries.org downers-grove-il.healthykidsrunningseries.org
doylestown-pa.healthykidsrunningseries.org doylestown-pa.healthykidsrunningseries.org
dreams.imfreakinawesome.com dreams.imfreakinawesome.com
duboisturkeytrot.com duboisturkeytrot.com
duluthrunningevents.com duluthrunningevents.com
east-windsor-ct.healthykidsrunningseries.org east-windsor-ct.healthykidsrunningseries.org
eastern-lebanon-pa.healthykidsrunningseries.org eastern-lebanon-pa.healthykidsrunningseries.org
elesrace5k.org elesrace5k.org
elpasomarathon.org elpasomarathon.org
elsinboro-nj.healthykidsrunningseries.org elsinboro-nj.healthykidsrunningseries.org
eltourtucson.org eltourtucson.org
elusivecupidrelay.com elusivecupidrelay.com
enola-pa.healthykidsrunningseries.org enola-pa.healthykidsrunningseries.org
epicpirun.com epicpirun.com
evergreenclub5k.org evergreenclub5k.org
falalarun.com falalarun.com
federalcup5k.com federalcup5k.com
fit4fall5k.com fit4fall5k.com
freedomspringstriathlon.com freedomspringstriathlon.com
fresnofreedomrun.com fresnofreedomrun.com
ftdesoto15k.com ftdesoto15k.com
fullsendchallenge.com fullsendchallenge.com
fullypacked.org fullypacked.org
funrun.playmakers.com funrun.playmakers.com
gardencitygravel.com gardencitygravel.com
gemcityclassic.com gemcityclassic.com
getmoovin.org getmoovin.org
getyourhearton5k.com getyourhearton5k.com
ghentdistrictfoundation.org ghentdistrictfoundation.org
golfwaterloo.t2t.org golfwaterloo.t2t.org
grandlakemarathon.com grandlakemarathon.com
greatbearchase.org greatbearchase.org
greensborohalf.com greensborohalf.com
greensborohalfmarathon.com greensborohalfmarathon.com
greenwayschallenge.com greenwayschallenge.com
griffithparktrailrun.com griffithparktrailrun.com
habitatcycleofhope.org habitatcycleofhope.org
halloweenrun.racethebronx.com halloweenrun.racethebronx.com
harpoondogtoberfest.com harpoondogtoberfest.com
harpoonflannel5k.com harpoonflannel5k.com
harriersrelay.com harriersrelay.com
hawaiianislandschallenge.com hawaiianislandschallenge.com
hawaiichallengeruns.com hawaiichallengeruns.com
haydenlakemarathon.org haydenlakemarathon.org
heartofamericamarathon.com heartofamericamarathon.com
highmountainhalf.com highmountainhalf.com
hillvalley88miler.com hillvalley88miler.com
honordaygolf.t2t.org honordaygolf.t2t.org
hoopla4miler.com hoopla4miler.com
houstonfourthfest.com houstonfourthfest.com
howloween5k.com howloween5k.com
ican5k.com ican5k.com
iowa.oneus.run iowa.oneus.run
jakeunger.com jakeunger.com
janesvilleflannelfest.com janesvilleflannelfest.com
jinglebell5k.org jinglebell5k.org
justinsraceforpeace.org justinsraceforpeace.org
kevinmalcolm5k.com kevinmalcolm5k.com
klamath-falls.healthykidsrunningseries.org klamath-falls.healthykidsrunningseries.org
amos.priceoffreedomfoundation.org amos.priceoffreedomfoundation.org
kauaichallenges.com kauaichallenges.com
kettlekrushrace.com kettlekrushrace.com
kidsonfirstfoundation.org kidsonfirstfoundation.org
killeen-tx.healthykidsrunningseries.org killeen-tx.healthykidsrunningseries.org
kirbyderby.org kirbyderby.org
kookyspookyrun.com kookyspookyrun.com
lastbestbeerrun.com lastbestbeerrun.com
laurenslap.org laurenslap.org
legacyduathlon.com legacyduathlon.com
lerunforlerouge.com lerunforlerouge.com
liamstrong.com liamstrong.com
lifewideopen.net lifewideopen.net
louisianatri.net louisianatri.net
lucky13race.com lucky13race.com
luckydog5k.com luckydog5k.com
luckyleprechaunrun.com luckyleprechaunrun.com
machoman5k.com machoman5k.com
mainelighthouseride.org mainelighthouseride.org
malvernerun.org malvernerun.org
marathon.leadvilleraceseries.com marathon.leadvilleraceseries.com
marketstreetrun.org marketstreetrun.org
match.hopeacresrescue.org match.hopeacresrescue.org
mattamy5k.com mattamy5k.com
mcrrckidsontherun.org mcrrckidsontherun.org
mechanicsburg-pa.healthykidsrunningseries.org mechanicsburg-pa.healthykidsrunningseries.org
metromilers.com metromilers.com
midsummernight5k.com midsummernight5k.com
mightymatapeaketriathlon.com mightymatapeaketriathlon.com
mightymittensplashdash.com mightymittensplashdash.com
millpondmile.com millpondmile.com
mississippigulfcoastmarathon.com mississippigulfcoastmarathon.com
mmf5k.com mmf5k.com
molokichallenge.com molokichallenge.com
montanavirtualchallenge.com montanavirtualchallenge.com
mooreunity.com mooreunity.com
morgan-county-il.healthykidsrunningseries.org morgan-county-il.healthykidsrunningseries.org
muttsandmarshmallows.com muttsandmarshmallows.com
natalliemay.com natalliemay.com
new-cumberland-pa.healthykidsrunningseries.org new-cumberland-pa.healthykidsrunningseries.org
newyearsdayrundallas.com newyearsdayrundallas.com
noahfarrellyrun.org noahfarrellyrun.org
northernohiomarathon.com northernohiomarathon.com
northportfirecracker5k.com northportfirecracker5k.com
northtexasrunforgood.com northtexasrunforgood.com
nwtr2023.com nwtr2023.com
ocmdrunfest.com ocmdrunfest.com
ocrunfest.com ocrunfest.com
oct.medaldash.com oct.medaldash.com
oreland-pa.healthykidsrunningseries.org oreland-pa.healthykidsrunningseries.org
otillocascobay.com otillocascobay.com
otillowhistler.com otillowhistler.com
owlsroostrumble.com owlsroostrumble.com
ozarkvalleytriathlon.com ozarkvalleytriathlon.com
palsinmotion.org palsinmotion.org
reg.barnburnermtb.com reg.barnburnermtb.com
reg.chicagotriathlon.com reg.chicagotriathlon.com
reg.tahoetrailmtb.com reg.tahoetrailmtb.com
reg.theraddirt.com reg.theraddirt.com
pedalpalooza4fhpc.org pedalpalooza4fhpc.org
relay.playmakers.com relay.playmakers.com
pewaukeetriathlon.com pewaukeetriathlon.com
philadelphia76virtualchallenge.com philadelphia76virtualchallenge.com
pickledyoga.com pickledyoga.com
piday.run piday.run
piggybackdash.com piggybackdash.com
pikespeek10k.org pikespeek10k.org
pinnaclesadventurerun.com pinnaclesadventurerun.com
pintsinthesquare.com pintsinthesquare.com
pistolultra.org pistolultra.org
pnwpinkribbonrun.com pnwpinkribbonrun.com
prairiedoghalf.com prairiedoghalf.com
preseasontuneup.com preseasontuneup.com
race5k.com race5k.com
raceacrossmaryland.com raceacrossmaryland.com
racegermantown.com racegermantown.com
rail66tt.com rail66tt.com
resolutionrun.org resolutionrun.org
rickstrailrun.com rickstrailrun.com
ripplerun.org ripplerun.org
riverroux.com riverroux.com
rockymountainroubaix.com rockymountainroubaix.com
rollingthundercx.com rollingthundercx.com
rootedinhim5k.com rootedinhim5k.com
ardmorerah.org ardmorerah.org
runhardhalf.org runhardhalf.org
run2022.faithinchildren.org run2022.faithinchildren.org
run2endhunger.org run2endhunger.org
runak.dyrk1a.org runak.dyrk1a.org
runapaloozarun.com runapaloozarun.com
runblueridge.com runblueridge.com
runcamp.leadvilleraceseries.com runcamp.leadvilleraceseries.com
runclearlake.com runclearlake.com
runford103.org runford103.org
runfordogs5k.com runfordogs5k.com
runforthekids5k.com runforthekids5k.com
ruck9.org ruck9.org
ruckcancer.org ruckcancer.org
arenaattack.com arenaattack.com
runlongislandmarathon.com runlongislandmarathon.com
runningandreadingchallenge.com runningandreadingchallenge.com
runsby.com runsby.com
runsuffield.com runsuffield.com
runthepeakrace.com runthepeakrace.com
runwalkchestercounty.t2t.org runwalkchestercounty.t2t.org
runwalkgreateraugusta.t2t.org runwalkgreateraugusta.t2t.org
runwalkhendersonville.t2t.org runwalkhendersonville.t2t.org
runwalkloudon.t2t.org runwalkloudon.t2t.org
runwalkpittsburgh.t2t.org runwalkpittsburgh.t2t.org
runwalktomball.t2t.org runwalktomball.t2t.org
rwtc-waukesha.com rwtc-waukesha.com
actslifewise5k.com actslifewise5k.com
saintaugustinetriathlon.com saintaugustinetriathlon.com
adamshalf.com adamshalf.com
santacatchrace.com santacatchrace.com
scarecrowsandwitchesflaglerbeach.com scarecrowsandwitchesflaglerbeach.com
scorefactor5k.com scorefactor5k.com
seacoasthalfmarathon.com seacoasthalfmarathon.com
alahalf.com alahalf.com
shenaniganchallenge.com shenaniganchallenge.com
mimile.playmakers.com mimile.playmakers.com
amazingkindnessrace.com amazingkindnessrace.com
slowafturtletrot.com slowafturtletrot.com
annarbortri.com annarbortri.com
somersgreatescape.com somersgreatescape.com
somerssummerseries.com somerssummerseries.com
southerntourultra.com southerntourultra.com
apex-nc.healthykidsrunningseries.org apex-nc.healthykidsrunningseries.org
spc5k.org spc5k.org
spooktacularfunrun.net spooktacularfunrun.net
spooky.run spooky.run
autumnlake.badgerstri.com autumnlake.badgerstri.com
stage.leadvilleraceseries.com stage.leadvilleraceseries.com
ashevillehalfmarathon.com ashevillehalfmarathon.com
startlineraceservices.com startlineraceservices.com
100holesforthehomeless.com 100holesforthehomeless.com
101heroesride.com 101heroesride.com
10k.leadvilleraceseries.com 10k.leadvilleraceseries.com
stillnesscup.com stillnesscup.com
storm5k10k.com storm5k10k.com
stpaddys5k.com stpaddys5k.com
straightstreethillclimb.com straightstreethillclimb.com
summitforlife.org summitforlife.org
summerbreezerun.com summerbreezerun.com
summersdone131.com summersdone131.com
suncoastolympictriathlon.com suncoastolympictriathlon.com
sunfishtriathlon.com sunfishtriathlon.com
sunshinestatechallenge.com sunshinestatechallenge.com
sunsirenvirtualrun.trisirena.com sunsirenvirtualrun.trisirena.com
surfinsnowman.com surfinsnowman.com
swimtheloop.com swimtheloop.com
atlastrailseries.com atlastrailseries.com
auburn-nh.healthykidsrunningseries.org auburn-nh.healthykidsrunningseries.org
austintoaspen.com austintoaspen.com
texas10series.com texas10series.com
thankfulturkeyrun.com thankfulturkeyrun.com
thecummingmarathon.com thecummingmarathon.com
thechrisnewcomer.com thechrisnewcomer.com
theglacierchallenge.com theglacierchallenge.com
thedenver5k.com thedenver5k.com
bachelorette5k.com bachelorette5k.com
thememorialdayclassic.com thememorialdayclassic.com
thestuffedturkeyrun.com thestuffedturkeyrun.com
thetourdedonut.com thetourdedonut.com
bakersfieldrudolph.run bakersfieldrudolph.run
bakersfieldsoloruns.com bakersfieldsoloruns.com
thewoodlandsmarathon.com thewoodlandsmarathon.com
battleshiphalfmarathon.com battleshiphalfmarathon.com
traildays.run traildays.run
bedford-pa.healthykidsrunningseries.org bedford-pa.healthykidsrunningseries.org
belton-tx.healthykidsrunningseries.org belton-tx.healthykidsrunningseries.org
trisantacruz.com trisantacruz.com
trisignup.com trisignup.com
tritheparks.com tritheparks.com
ben2shore.org ben2shore.org
beyoutifulrace.com beyoutifulrace.com
bigbeachmarathon.com bigbeachmarathon.com
unicorn5k.com unicorn5k.com
unicornracer.com unicornracer.com
bigislandchallenge.org bigislandchallenge.org
unitedwiththeblue5k.com unitedwiththeblue5k.com
biketheshore.com biketheshore.com
billsbeerrun.com billsbeerrun.com
virginia.shootoutforsoldiers.com virginia.shootoutforsoldiers.com
virtual.nyctri.com virtual.nyctri.com
virtualwinerunturkeytrot.com virtualwinerunturkeytrot.com
blueridgerelay.com blueridgerelay.com
blueridgetobeach.com blueridgetobeach.com
boise-id.healthykidsrunningseries.org boise-id.healthykidsrunningseries.org
boiserivermarathon.org boiserivermarathon.org
walkerrun5k.com walkerrun5k.com
walkforhealthyheartsandminds.jkyog.org walkforhealthyheartsandminds.jkyog.org
bootsandbrews5k.com bootsandbrews5k.com
wareaglerunfest.com wareaglerunfest.com
boxerstrail5k.com boxerstrail5k.com
boxerstrail5k.org boxerstrail5k.org
boyertown-pa.healthykidsrunningseries.org boyertown-pa.healthykidsrunningseries.org
brewrun.playmakers.com brewrun.playmakers.com
bridgerun.org bridgerun.org
bridgerunnc.org bridgerunnc.org
brittaschase.com brittaschase.com
whiskeyrunnashville.com whiskeyrunnashville.com
whitefishturkeytrot.com whitefishturkeytrot.com
broomfieldturkeyday.com broomfieldturkeyday.com
wildbillys.run wildbillys.run
wilsongobblewobble.com wilsongobblewobble.com
windermeremarathon.com windermeremarathon.com
winter5k.com winter5k.com
butte100.com butte100.com
wscogfamilyfunwalkrun.com wscogfamilyfunwalkrun.com
xcspike.playmakers.com xcspike.playmakers.com
campgladiatorraceseries.com campgladiatorraceseries.com
canal.run canal.run
canandaigua.shootoutforsoldiers.com canandaigua.shootoutforsoldiers.com
candycanelanerun.com candycanelanerun.com
cannonballmarathon.com cannonballmarathon.com
canyontocoastchallenge.com canyontocoastchallenge.com
carpetcapital10miler.com carpetcapital10miler.com
ykmountainmantri.com ykmountainmantri.com
carygreenwaystour.com carygreenwaystour.com
yorkyhalfmarathon.org yorkyhalfmarathon.org
yourfirstflight.org yourfirstflight.org
catalinaislandmarathon.com catalinaislandmarathon.com
cedarcreekfalldu.com cedarcreekfalldu.com
champagne5k.com champagne5k.com
charlottesvilleturkeytrot.com charlottesvilleturkeytrot.com
chasemudrun.com chasemudrun.com
cheeky3.com cheeky3.com
chicagosignup.gourdyspumpkinrun.com chicagosignup.gourdyspumpkinrun.com
hc.lopersclub.org hc.lopersclub.org
ia.oneus.run ia.oneus.run
chinkapinhollow.com chinkapinhollow.com
choochoo9miler.com choochoo9miler.com
chucknorris.medaldash.com chucknorris.medaldash.com
wi.oneus.run wi.oneus.run
cleveland-oh.healthykidsrunningseries.org cleveland-oh.healthykidsrunningseries.org
coachyantis5k.com coachyantis5k.com
coastaltrailruns.com coastaltrailruns.com
codelrun.com codelrun.com
colorado13er.com colorado13er.com
columbustriathlon.com columbustriathlon.com
cottonrowruns.com cottonrowruns.com
crawfishmantri.com crawfishmantri.com
croatanresults.com croatanresults.com
crookedcreek100.com crookedcreek100.com
crossforlifeflight.org crossforlifeflight.org
crotona3k.racethebronx.com crotona3k.racethebronx.com
crtky.com crtky.com
dallastx.healthykidsrunningseries.org dallastx.healthykidsrunningseries.org
darkstrides.com darkstrides.com
degraylaketriathlon.com degraylaketriathlon.com
denvermothersday5k.com denvermothersday5k.com
dkgresults.com dkgresults.com
donate.globalrenewal.org donate.globalrenewal.org
eastern5000.run eastern5000.run
engelwoodrunners.com engelwoodrunners.com
ethne5k.org ethne5k.org
fairbornflyer.com fairbornflyer.com
fallfestrun.com fallfestrun.com
farmland5k.com farmland5k.com
fasttracktiming.com fasttracktiming.com
feattothebeach.com feattothebeach.com
feelthelove5k.net feelthelove5k.net
flagrun5k.com flagrun5k.com
floridaacrossthestatechallenge.com floridaacrossthestatechallenge.com
floridahalloweenhalfathon.com floridahalloweenhalfathon.com
floridaholidayhalfathon.com floridaholidayhalfathon.com
floridashamrockhalfathon.com floridashamrockhalfathon.com
foco500.com foco500.com
fosteringfootsteps.com fosteringfootsteps.com
frankenfrenzyrun.com frankenfrenzyrun.com
freedomday5k.com freedomday5k.com
freethem5k.org freethem5k.org
fresnogives.org fresnogives.org
fresnoturkeytrot.com fresnoturkeytrot.com
friendship5k.org friendship5k.org
frigid5kseries.com frigid5kseries.com
fullmoontrailseries.com fullmoontrailseries.com
gatewayresiliencerun.com gatewayresiliencerun.com
gazawod.com gazawod.com
give.pgb1.org give.pgb1.org
glasgow-bear-de.healthykidsrunningseries.org glasgow-bear-de.healthykidsrunningseries.org
glendoramemorialday5k.com glendoramemorialday5k.com
globalrun4water.com globalrun4water.com
glowjbsa.com glowjbsa.com
golfsat.t2t.org golfsat.t2t.org
grandrapidssignup.gourdyspumpkinrun.com grandrapidssignup.gourdyspumpkinrun.com
greatky.run greatky.run
greatpumpkin10krace.com greatpumpkin10krace.com
guinnessbrewrun.com guinnessbrewrun.com
hachie50.com hachie50.com
haganstonedu.triviumracing.com haganstonedu.triviumracing.com
hampden-ma.healthykidsrunningseries.org hampden-ma.healthykidsrunningseries.org
hawaiianislandchallenge.org hawaiianislandchallenge.org
hawaiianislandchallenges.com hawaiianislandchallenges.com
hawaiiturkeytrot.com hawaiiturkeytrot.com
heartbreakermarathon.com heartbreakermarathon.com
hersheywinerun.com hersheywinerun.com
highlandsgravelclassic.com highlandsgravelclassic.com
hillbilly.run hillbilly.run
hilltopusa5k.com hilltopusa5k.com
hmsaclassical25k.com hmsaclassical25k.com
hofbrauhalf.com hofbrauhalf.com
holoholochallenge.com holoholochallenge.com
houstonholiday5k.com houstonholiday5k.com
hueyprun.com hueyprun.com
huntsville.pgb1.org huntsville.pgb1.org
icebadgersloppet.com icebadgersloppet.com
illinois.oneus.run illinois.oneus.run
ilove-running.com ilove-running.com
iowa310.com iowa310.com
irlrunwalk.org irlrunwalk.org
ironhorse.wgwltrail.com ironhorse.wgwltrail.com
ironmountainxc.com ironmountainxc.com
johnscreeksfinest5k.net johnscreeksfinest5k.net
rockinrogersville.com rockinrogersville.com
tickets.michiganchallenge.com tickets.michiganchallenge.com
constitution2024.com constitution2024.com
redshoerun-bham.org redshoerun-bham.org
reg.epicseriesocr.com reg.epicseriesocr.com
reg.lutsen99er.com reg.lutsen99er.com
reg.nyctri.com reg.nyctri.com
reg.turkeytrotchicago.com reg.turkeytrotchicago.com
register.bridgesandbluffs.com register.bridgesandbluffs.com
register.mercymallva.org register.mercymallva.org
register.reefsrun.com register.reefsrun.com
register.teeoffagainsthungernj.com register.teeoffagainsthungernj.com
registericeman.com registericeman.com
reindeerruncleveland.com reindeerruncleveland.com
rendlakemarathon.com rendlakemarathon.com
roadraceseries.com roadraceseries.com
rockville10k5k.com rockville10k5k.com
rockpaperrun.org rockpaperrun.org
route6610k.com route6610k.com
rpefrun.com rpefrun.com
run4l.run run4l.run
run4onthe4th.com run4onthe4th.com
run4thechildren.com run4thechildren.com
runatthepark.com runatthepark.com
runbeercity.com runbeercity.com
runchino.com runchino.com
ruck9.com ruck9.com
runninglabtrailfest.com runninglabtrailfest.com
runningofthebulls.racethebronx.com runningofthebulls.racethebronx.com
runnova5k21.imfreakinawesome.com runnova5k21.imfreakinawesome.com
runsalemmo.com runsalemmo.com
runshinzen.com runshinzen.com
runsugarlandtx.com runsugarlandtx.com
runtheridgetrailrun.com runtheridgetrailrun.com
runtheshore.com runtheshore.com
runtochallenge.com runtochallenge.com
runwalkjacksonms.t2t.org runwalkjacksonms.t2t.org
runwalkmetrodetroit.t2t.org runwalkmetrodetroit.t2t.org
runwalkoklahomacity.t2t.org runwalkoklahomacity.t2t.org
runwalkprinceton.t2t.org runwalkprinceton.t2t.org
runwalktrinitypasco.t2t.org runwalktrinitypasco.t2t.org
runway5kflagler.com runway5kflagler.com
adkwhiskeyrun.com adkwhiskeyrun.com
salemhalfmarathon.com salemhalfmarathon.com
salutetoservice5k.com salutetoservice5k.com
adirondackcoastcraftfair.com adirondackcoastcraftfair.com
santaruncharlotte.com santaruncharlotte.com
adventuresignup.com adventuresignup.com
saratogastryders.org saratogastryders.org
aegisacademy.nathanroten.com aegisacademy.nathanroten.com
armonkforautism.org armonkforautism.org
scbtrack.com scbtrack.com
senecacreekgreenwayrace.com senecacreekgreenwayrace.com
alamedapint.com alamedapint.com
alien.run alien.run
shakori40ultra.com shakori40ultra.com
shamrockshuffle3k.com shamrockshuffle3k.com
shopspectrumsports.com shopspectrumsports.com
sixpackseries.com sixpackseries.com
sizzlingsolesrace.com sizzlingsolesrace.com
slowafsantadash.com slowafsantadash.com
annapolisrunforthelighthouse.org annapolisrunforthelighthouse.org
annarborfirecracker5k.com annarborfirecracker5k.com
annarbormarathon.com annarbormarathon.com
andersoncountychamber.org andersoncountychamber.org
southgulfcoveyachtclub.com southgulfcoveyachtclub.com
spc5k.com spc5k.com
springfeverrun.com springfeverrun.com
springoutoftheden.com springoutoftheden.com
ascensionstvincentcancerchallenge.org ascensionstvincentcancerchallenge.org
strengthinourstreets.com strengthinourstreets.com
strollforhospice.org strollforhospice.org
academystreetstrut.com academystreetstrut.com
sugarrushrace.com sugarrushrace.com
superbowl.run superbowl.run
superbowl4miler.com superbowl4miler.com
swimtothemoon.net swimtothemoon.net
appleharvestrun.com appleharvestrun.com
atlanta.shootoutforsoldiers.com atlanta.shootoutforsoldiers.com
atlantapride5k.com atlantapride5k.com
aut2run.org aut2run.org
the5kchickenrun.com the5kchickenrun.com
thankyouplaces.com thankyouplaces.com
theburnsidemile.com theburnsidemile.com
aztlanxcclassic.com aztlanxcclassic.com
thejackiepangfund.org thejackiepangfund.org
thelouisianamarathon.com thelouisianamarathon.com
theracedirector.com theracedirector.com
thewoodlandsmarathon.org thewoodlandsmarathon.org
title9k.com title9k.com
bataanchallenge.com bataanchallenge.com
bayareakidstriseries.org bayareakidstriseries.org
toptiertiming.com toptiertiming.com
tourswithjoy.com tourswithjoy.com
beatyesterday.run beatyesterday.run
tpc.thedonnafoundation.org tpc.thedonnafoundation.org
trailmixrun.sunshinecamp.org trailmixrun.sunshinecamp.org
beercitysacramento.com beercitysacramento.com
beercityseries.com beercityseries.com
tri312.com tri312.com
trotforturkeys.com trotforturkeys.com
turkeychaserace.com turkeychaserace.com
turkeystrut.com turkeystrut.com
turkletrot.com turkletrot.com
tylerturkeytrot.com tylerturkeytrot.com
udmusicman5k.com udmusicman5k.com
blackacrexc.run blackacrexc.run
veteranshavenrun.org veteranshavenrun.org
veteransmile.com veteransmile.com
veteransva5k.com veteransva5k.com
vintageparkhalfmarathon.com vintageparkhalfmarathon.com
virr.com virr.com
bloomandzoom.com bloomandzoom.com
virtualwinerun.com virtualwinerun.com
visaliaturkeytrot.com visaliaturkeytrot.com
blossom.run blossom.run
blossombikeride.com blossombikeride.com
vision5k.com vision5k.com
virginiaroadtripchallenge.com virginiaroadtripchallenge.com
bobbickel.com bobbickel.com
bohicketrun.com bohicketrun.com
boisehalf.org boisehalf.org
boisemarathon.com boisemarathon.com
walk4healthyheartsandminds.jkyog.org walk4healthyheartsandminds.jkyog.org
wallacehuckfest.com wallacehuckfest.com
wallissandshalfmarathon.com wallissandshalfmarathon.com
bootsfortroops5k.com bootsfortroops5k.com
borderbike.wgwltrail.com borderbike.wgwltrail.com
warmup.playmakers.com warmup.playmakers.com
warrior5k.com warrior5k.com
bourbonbelt.run bourbonbelt.run
weldyourmettleultra.com weldyourmettleultra.com
breckenridge-co.healthykidsrunningseries.org breckenridge-co.healthykidsrunningseries.org
brevardcorporate5k.com brevardcorporate5k.com
westgatefit.com westgatefit.com
whispertri.com whispertri.com
whitefishlakerun.com whitefishlakerun.com
brokenspokechallenge.com brokenspokechallenge.com
wildturkeychase.com wildturkeychase.com
buckscountymarathonweekend.com buckscountymarathonweekend.com
windsorbrewrace.com windsorbrewrace.com
buda-kyle-tx.healthykidsrunningseries.org buda-kyle-tx.healthykidsrunningseries.org
withoutlimitscrosscountrycamp.com withoutlimitscrosscountrycamp.com
woodlandsmarathon.com woodlandsmarathon.com
woodstock-ga.healthykidsrunningseries.org woodstock-ga.healthykidsrunningseries.org
womensdistancefestival.com womensdistancefestival.com
wvseries.com wvseries.com
wvmarathon.com wvmarathon.com
ymcawbtri.com ymcawbtri.com
caryunitywalk.com caryunitywalk.com
yorktownindependenceruns.com yorktownindependenceruns.com
yorkymarathon.org yorkymarathon.org
catalinaislandhalfmarathon.com catalinaislandhalfmarathon.com
cfaandersonrace.com cfaandersonrace.com
zombiefest.org zombiefest.org
challenges.cleaninternational.org challenges.cleaninternational.org
charlestonwinterseries.com charlestonwinterseries.com
charlotteracefest.com charlotteracefest.com
chattanoogatn.healthykidsrunningseries.org chattanoogatn.healthykidsrunningseries.org
cherryblossomexpo.org cherryblossomexpo.org
chicagobrewrun.com chicagobrewrun.com
il.oneus.run il.oneus.run
chinkapinhollowgravelgrinder.com chinkapinhollowgravelgrinder.com
ne.oneus.run ne.oneus.run
ckcciderrun.com ckcciderrun.com
climbkili.org climbkili.org
clovisrudolph.run clovisrudolph.run
coastalresortsgolf.com coastalresortsgolf.com
codel48.com codel48.com
coloradopeakschallenge.com coloradopeakschallenge.com
competetodefeatbraintumors.com competetodefeatbraintumors.com
conshohockenpa.healthykidsrunningseries.org conshohockenpa.healthykidsrunningseries.org
covington5k.com covington5k.com
cow.run cow.run
coyotes1mile.com coyotes1mile.com
coyotesinvite.com coyotesinvite.com
dashfordiapers.org dashfordiapers.org
daytonaturkeytrot.com daytonaturkeytrot.com
dcwinerun.com dcwinerun.com
detroitmothersdayrun.com detroitmothersdayrun.com
detroitsignup.gourdyspumpkinrun.com detroitsignup.gourdyspumpkinrun.com
devilsdenrun.com devilsdenrun.com
dogs5k.com dogs5k.com
donate.danasangels.org donate.danasangels.org
doughnutday5k.com doughnutday5k.com
dualduel.org dualduel.org
duluthwomenstenmile.com duluthwomenstenmile.com
east-brunswick-nj.healthykidsrunningseries.org east-brunswick-nj.healthykidsrunningseries.org
epicislandlaketri.com epicislandlaketri.com
epicraces.com epicraces.com
eringobraghrun.com eringobraghrun.com
fayettevillehalf.com fayettevillehalf.com
haworthrun.org haworthrun.org
firecrackerrunwalk.com firecrackerrunwalk.com
floppinflounder.com floppinflounder.com
fortknoxchristmasinjuly.com fortknoxchristmasinjuly.com
fortnightbeforechristmas.com fortnightbeforechristmas.com
frederickmarketstreetmile.com frederickmarketstreetmile.com
frederickss8k.com frederickss8k.com
freedomrun10k.com freedomrun10k.com
fresnospringfling.com fresnospringfling.com
fresnovalentinerun.com fresnovalentinerun.com
furry5k.com furry5k.com
geisthalf.com geisthalf.com
georgetown-ma.healthykidsrunningseries.org georgetown-ma.healthykidsrunningseries.org
ghostsandgoblinsrun.com ghostsandgoblinsrun.com
ghsmuttstrut.com ghsmuttstrut.com
glenview.healthykidsrunningseries.org glenview.healthykidsrunningseries.org
gobblegallop.com gobblegallop.com
gobblewobblerace.com gobblewobblerace.com
gobblewobblerace.org gobblewobblerace.org
golfbentwater.t2t.org golfbentwater.t2t.org
golfeagleoaks.t2t.org golfeagleoaks.t2t.org
golfmbveteransday.t2t.org golfmbveteransday.t2t.org
haiti5k.run haiti5k.run
halloween31.run halloween31.run
harpoon5miler.com harpoon5miler.com
harvest5k.com harvest5k.com
hauntedhousingrun.com hauntedhousingrun.com
heritageeagles5k.com heritageeagles5k.com
hhsprojectgraduation.org hhsprojectgraduation.org
highlandsranch5k.com highlandsranch5k.com
hitopsprincetonhalfmarathon.com hitopsprincetonhalfmarathon.com
hmsaclassic25k.com hmsaclassic25k.com
hoffman-estates-palatine-il.healthykidsrunningseries.org hoffman-estates-palatine-il.healthykidsrunningseries.org
holdthefortraces.com holdthefortraces.com
holiday.playmakers.com holiday.playmakers.com
honorthefallen5k.com honorthefallen5k.com
huffingforstuffing.com huffingforstuffing.com
indiana-pa.healthykidsrunningseries.org indiana-pa.healthykidsrunningseries.org
indianapolissignup.gourdyspumpkinrun.com indianapolissignup.gourdyspumpkinrun.com
itascaoktoberfast5k.org itascaoktoberfast5k.org
izzorace.com izzorace.com
jarrell-tx.healthykidsrunningseries.org jarrell-tx.healthykidsrunningseries.org
jeffgalloway131.com jeffgalloway131.com
jicrun.com jicrun.com
jimmyrun.com jimmyrun.com
jingleallthewayrun.com jingleallthewayrun.com
jinglejog5k.com jinglejog5k.com
jubileejog5k.com jubileejog5k.com
juneteenthfreedomrun.com juneteenthfreedomrun.com
jurassicrun.com jurassicrun.com
kaylarun.com kaylarun.com
kesslermountainjam.com kesslermountainjam.com
keylargobridgerun.com keylargobridgerun.com
keylargotokeywestchallenge.com keylargotokeywestchallenge.com
knobstone.run knobstone.run
kprunwalkroll.com kprunwalkroll.com
laborday.run laborday.run
lahalf.com lahalf.com
lakebluffpumpkinchase.org lakebluffpumpkinchase.org
lakecumberlandcpac.com lakecumberlandcpac.com
lakecumberlandrunners.com lakecumberlandrunners.com
lakejacksonturkeytrot.com lakejacksonturkeytrot.com
lakenona.healthykidsrunningseries.org lakenona.healthykidsrunningseries.org
lancaster-pa.healthykidsrunningseries.org lancaster-pa.healthykidsrunningseries.org
lansdale-pa.healthykidsrunningseries.org lansdale-pa.healthykidsrunningseries.org
leesjbr.com leesjbr.com
leprechauns.run leprechauns.run
lighthouseloophalfmarathon.com lighthouseloophalfmarathon.com
lmhalf.com lmhalf.com
logantriathlon.com logantriathlon.com
loggerheadtriathlon.com loggerheadtriathlon.com
louisvillesignup.gourdyspumpkinrun.com louisvillesignup.gourdyspumpkinrun.com
loverunwestlake.com loverunwestlake.com
lynchburgsuperherorun.com lynchburgsuperherorun.com
machomtb.com machomtb.com
mag7raceseries.com mag7raceseries.com
marchofthedogs.medaldash.com marchofthedogs.medaldash.com
marplenewtown-pa.healthykidsrunningseries.org marplenewtown-pa.healthykidsrunningseries.org
massacremarathon.com massacremarathon.com
maui5k.org maui5k.org
mauiislandchallenge.com mauiislandchallenge.com
mcrrcsudsandsoles.org mcrrcsudsandsoles.org
menomonie-wi.healthykidsrunningseries.org menomonie-wi.healthykidsrunningseries.org
milegobbler.com milegobbler.com
miles4myeloma.org miles4myeloma.org
militarycitymm.com militarycitymm.com
millbrookwinerun.com millbrookwinerun.com
minergoldrush.com minergoldrush.com
molokaichallenges.com molokaichallenges.com
montanagravelchallenge.com montanagravelchallenge.com
mount-juliet-tn.healthykidsrunningseries.org mount-juliet-tn.healthykidsrunningseries.org
mountainmanmemorialmarch.com mountainmanmemorialmarch.com
msgulfcoastmarathon.com msgulfcoastmarathon.com
mtbcamp.leadvilleraceseries.com mtbcamp.leadvilleraceseries.com
musiccityruckmarch.com musiccityruckmarch.com
myplacetorace.com myplacetorace.com
nanticokeriverswimandtri.com nanticokeriverswimandtri.com
neverforgetconcert-nashville.t2t.org neverforgetconcert-nashville.t2t.org
newrivermarathon.com newrivermarathon.com
newton-ma.healthykidsrunningseries.org newton-ma.healthykidsrunningseries.org
nice5k.com nice5k.com
nun.run nun.run
nycrun.t2t.org nycrun.t2t.org
oahuchallenge.com oahuchallenge.com
oconomowoc-wi.healthykidsrunningseries.org oconomowoc-wi.healthykidsrunningseries.org
ocssaints5k.org ocssaints5k.org
odysseyswimrun.com odysseyswimrun.com
omniturkeytrot5k.com omniturkeytrot5k.com
onhillevents.com onhillevents.com
onurmark.net onurmark.net
otillomackinac.com otillomackinac.com
oviedoturkeytrot.com oviedoturkeytrot.com
palmblufftrailrace.com palmblufftrailrace.com
pascozeropointfivek.org pascozeropointfivek.org
paws5k.com paws5k.com
pawsfurpink.com pawsfurpink.com
pepsichallengeskirace.com pepsichallengeskirace.com
perkasie-pa.healthykidsrunningseries.org perkasie-pa.healthykidsrunningseries.org
personalbestquest5miler.com personalbestquest5miler.com
philly76challenge.com philly76challenge.com
piedmontoktrot.org piedmontoktrot.org
pistolultra.com pistolultra.com
raawc.com raawc.com
racebethanybeach.com racebethanybeach.com
raceforhome.com raceforhome.com
racefortheprintery.com racefortheprintery.com
test-rsu-prod1.istpsu.com test-rsu-prod1.istpsu.com
tickets.dnc.com tickets.dnc.com
tickets.raleighhauntedhouse.com tickets.raleighhauntedhouse.com
beerandcheesefest.com beerandcheesefest.com
windandvibes.org windandvibes.org
chippewavalleyfacilityengineers.org chippewavalleyfacilityengineers.org
flsummit.dnc.com flsummit.dnc.com
holidayparty.saratogastryders.org holidayparty.saratogastryders.org
jscwempowermentconference.com jscwempowermentconference.com
pistonprops.com pistonprops.com
reindeerrun.org reindeerrun.org
ridewythehope.org ridewythehope.org
riverwinds.badgerstri.com riverwinds.badgerstri.com
rockhillstriders.org rockhillstriders.org
rocknrun4kids.com rocknrun4kids.com
run.landonpadgett.org run.landonpadgett.org
run317.com run317.com
runajm.com runajm.com
runforruss.com runforruss.com
runhard.org runhard.org
runmambo.com runmambo.com
runmarshall.com runmarshall.com
runmilehigh.com runmilehigh.com
runningoftheleprechauns.com runningoftheleprechauns.com
runningwithed.com runningwithed.com
runontherocks.org runontherocks.org
runrainier.com runrainier.com
runsanta.com runsanta.com
runsignup.com runsignup.com
runthe110.com runthe110.com
runthesplit.com runthesplit.com
runwalkalpena.t2t.org runwalkalpena.t2t.org
runwalkcapegirardeau.t2t.org runwalkcapegirardeau.t2t.org
runwalkdenver.t2t.org runwalkdenver.t2t.org
runwalkjeffersoncity.t2t.org runwalkjeffersoncity.t2t.org
runwalkmedina.t2t.org runwalkmedina.t2t.org
runwalkmyrtlebeach.t2t.org runwalkmyrtlebeach.t2t.org
runwalkorroll5k.com runwalkorroll5k.com
runwalktempe.t2t.org runwalktempe.t2t.org
runwiththealewives.com runwiththealewives.com
runwiththecopswaukesha.com runwiththecopswaukesha.com
runyamacraw.com runyamacraw.com
runyouryear.com runyouryear.com
sacketsharbormarathon.com sacketsharbormarathon.com
bostontobarharbor.com bostontobarharbor.com
sbymarathon.com sbymarathon.com
seaturtlehalf.com seaturtlehalf.com
semcsports.com semcsports.com
alpineendurancemedicine.com alpineendurancemedicine.com
alloutmultipro.com alloutmultipro.com
sixcinvite.com sixcinvite.com
amberlycharity5k.com amberlycharity5k.com
slowaftrickortrot.com slowaftrickortrot.com
annapolisrunfest.com annapolisrunfest.com
soaraboveadversity.org soaraboveadversity.org
somerstrong5k.org somerstrong5k.org
spacecoastturkeytrot.com spacecoastturkeytrot.com
spaceracehsv.com spaceracehsv.com
splitsecondpro.com splitsecondpro.com
springcleanrace.com springcleanrace.com
stetsonrentals.com stetsonrentals.com
stopthesilencewalk.org stopthesilencewalk.org
sugarbranch.run sugarbranch.run
summitnorthtrailruns.com summitnorthtrailruns.com
sunsetscramble.com sunsetscramble.com
svkidstri.org svkidstri.org
syracusehalf.com syracusehalf.com
applefestrun.com applefestrun.com
tahoetomalibu.com tahoetomalibu.com
tammanyturkeytrot.com tammanyturkeytrot.com
ardmorerah.com ardmorerah.com
tctcjinglebellrun.com tctcjinglebellrun.com
avalon50.com avalon50.com
theblazing5k.com theblazing5k.com
awesome80schallenge.com awesome80schallenge.com
thefastandthefiorini.com thefastandthefiorini.com
thegreatsouthbayrun.com thegreatsouthbayrun.com
thelooprace.com thelooprace.com
azhrun.com azhrun.com
theperfect10.org theperfect10.org
backbaytriathlon.com backbaytriathlon.com
theultimateheartrace.com theultimateheartrace.com
thewoodlandsmarathon.net thewoodlandsmarathon.net
thrillscranton.com thrillscranton.com
tiger10k.com tiger10k.com
baltcopolicerun.com baltcopolicerun.com
tobaccoroadrelay.com tobaccoroadrelay.com
bashatbeach.com bashatbeach.com
battleofwaterlootri.com battleofwaterlootri.com
battleship12k.com battleship12k.com
tourdedonutohio.com tourdedonutohio.com
bearlakebrawl.com bearlakebrawl.com
trailheadfootrace.com trailheadfootrace.com
beattheheatrun.com beattheheatrun.com
triangletix.bm triangletix.bm
triridgefield.org triridgefield.org
belmar5.com belmar5.com
turkeychase.com turkeychase.com
turkeytrothawaii.com turkeytrothawaii.com
tyler5k.run tyler5k.run
bethanybeach5k.com bethanybeach5k.com
bethanyturkeytrot.com bethanyturkeytrot.com
unicornrunner.com unicornrunner.com
unifiedrunwalkforcancer.com unifiedrunwalkforcancer.com
unleashedvirtualruns.com unleashedvirtualruns.com
bikesignup.com bikesignup.com
biz.unionchamber.com biz.unionchamber.com
blackacre.run blackacre.run
verobeachtriathlon.com verobeachtriathlon.com
veteranshavenrun.com veteranshavenrun.com
veteranshonorrun.org veteranshonorrun.org
blazin5miler.com blazin5miler.com
blueravenproductions.com blueravenproductions.com
walkforeducationandhealthcare.jkyog.org walkforeducationandhealthcare.jkyog.org
walkthedogday.com walkthedogday.com
wallballforwarfighters.com wallballforwarfighters.com
bohickethalf.com bohickethalf.com
boisehalf.com boisehalf.com
walnutcreekrunclub.com walnutcreekrunclub.com
warriorsobstaclesrace.com warriorsobstaclesrace.com
boscobelfirecrackerrun.com boscobelfirecrackerrun.com
westyhalf.com westyhalf.com
whitelakehalf.com whitelakehalf.com
wilsoncreek.run wilsoncreek.run
wisconsinduseries.com wisconsinduseries.com
buckeyechallenge.com buckeyechallenge.com
buckeyechallenge2021.com buckeyechallenge2021.com
worldfoodrun.com worldfoodrun.com
wshs5k.com wshs5k.com
wyomingvalleystriders.com wyomingvalleystriders.com
cafecito5k.com cafecito5k.com
canonsburg-pa.healthykidsrunningseries.org canonsburg-pa.healthykidsrunningseries.org
yorkyturkeytrot.com yorkyturkeytrot.com
yorkyturkeytrot.org yorkyturkeytrot.org
youthinmovement.racethebronx.com youthinmovement.racethebronx.com
carthage.healthykidsrunningseries.org carthage.healthykidsrunningseries.org
cedar-park.healthykidsrunningseries.org cedar-park.healthykidsrunningseries.org
celticsolstice.com celticsolstice.com
celticsolstice.org celticsolstice.org
zorvinowinerun.com zorvinowinerun.com
charitydistancefestival.com charitydistancefestival.com
cincinnatisignup.gourdyspumpkinrun.com cincinnatisignup.gourdyspumpkinrun.com
cinnaminsonrunning.com cinnaminsonrunning.com
city5k.com city5k.com
cityofcollegeshalf.com cityofcollegeshalf.com
clevelandstpatricksdayrun.com clevelandstpatricksdayrun.com
clevelandtenmiler.com clevelandtenmiler.com
coatesvillepa.healthykidsrunningseries.org coatesvillepa.healthykidsrunningseries.org
cocyclingtoserve.com cocyclingtoserve.com
coloradosundownxc.com coloradosundownxc.com
coloradotrailchallenge.com coloradotrailchallenge.com
copperhead20.com copperhead20.com
corinthrotary5k.com corinthrotary5k.com
countdowntofitness.org countdowntofitness.org
craftbeerhalf.com craftbeerhalf.com
craftclassicatlanta.com craftclassicatlanta.com
crafthalf.com crafthalf.com
crafthalfmarathon.com crafthalfmarathon.com
cyclemountdora.com cyclemountdora.com
cycletosavelives.com cycletosavelives.com
denver.healthykidsrunningseries.org denver.healthykidsrunningseries.org
derailed.wgwltrail.com derailed.wgwltrail.com
nctriangle.shootoutforsoldiers.com nctriangle.shootoutforsoldiers.com
dogdaysjulyrun.com dogdaysjulyrun.com
donate.marisafund.org donate.marisafund.org
drumstickdash.net drumstickdash.net
drumstickdash.org drumstickdash.org
eggslegs.com eggslegs.com
eltourdezona.org eltourdezona.org
eriehalf.com eriehalf.com
eringobraughrun.com eringobraughrun.com
fall5k.com fall5k.com
familiesonchallenge.com familiesonchallenge.com
fff5kfunrun.com fff5kfunrun.com
firststridesnmb.com firststridesnmb.com
flamingfoliagerelay.com flamingfoliagerelay.com
fontanatriathlon.com fontanatriathlon.com
foster5k.org foster5k.org
fox8foxtrot.com fox8foxtrot.com
freedomtriathlon.com freedomtriathlon.com
fresnopiday.com fresnopiday.com
fresnosoloruns.com fresnosoloruns.com
friendshipdayct.com friendshipdayct.com
frozenfootrace.com frozenfootrace.com
ftsc24.com ftsc24.com
gfarun.org gfarun.org
glowinthedark5k.com glowinthedark5k.com
golfdcmetro.t2t.org golfdcmetro.t2t.org
golflowcountry.t2t.org golflowcountry.t2t.org
golfmarinepark.t2t.org golfmarinepark.t2t.org
golfnortherncolorado.t2t.org golfnortherncolorado.t2t.org
golfpeachtree.t2t.org golfpeachtree.t2t.org
greatbearchase.com greatbearchase.com
greensborogobbler.run greensborogobbler.run
gtptampabay.t2t.org gtptampabay.t2t.org
heartthrobrun.com heartthrobrun.com
heatthestreetsomaha.com heatthestreetsomaha.com
heatthestreetsomaha.org heatthestreetsomaha.org
herohustle5k.com herohustle5k.com
hitopsprincetonhalf.com hitopsprincetonhalf.com
hitthebrixx.com hitthebrixx.com
hobooken5k.com hobooken5k.com
holycowrun.com holycowrun.com
hoopla.run hoopla.run
hotterthanjuly.run hotterthanjuly.run
houstonresolutionrun.com houstonresolutionrun.com
htmfreedom5k.com htmfreedom5k.com
innsbrookhalf.com innsbrookhalf.com
ipswichalehalfmarathon.com ipswichalehalfmarathon.com
ironmountainlegend.com ironmountainlegend.com
irun4movement.com irun4movement.com
irun4rescues.com irun4rescues.com
janney5k.org janney5k.org
jerseycitymarathon.com jerseycitymarathon.com
johnstown-pa.healthykidsrunningseries.org johnstown-pa.healthykidsrunningseries.org
johnstownbeermile.com johnstownbeermile.com
kansascitysignup.gourdyspumpkinrun.com kansascitysignup.gourdyspumpkinrun.com
kiwanismidnightrun.com kiwanismidnightrun.com
knaextravaganza.com knaextravaganza.com
kolachefactory5k.com kolachefactory5k.com
kwanzaa5k.com kwanzaa5k.com
lakeeffecthalfmarathon.com lakeeffecthalfmarathon.com
lakesuperiorshorerun.com lakesuperiorshorerun.com
lambertclassic.com lambertclassic.com
landsharktriathlon.com landsharktriathlon.com
lansingsignup.gourdyspumpkinrun.com lansingsignup.gourdyspumpkinrun.com
leavestoleases.com leavestoleases.com
lifewideopen.com lifewideopen.com
lifewideopen.org lifewideopen.org
llbeanroadrace.com llbeanroadrace.com
lobocancerchallenge.org lobocancerchallenge.org
longisland.shootoutforsoldiers.com longisland.shootoutforsoldiers.com
longwoodmonsterdash.com longwoodmonsterdash.com
love.medaldash.com love.medaldash.com
love5k.com love5k.com
lubbockwinerun.com lubbockwinerun.com
luckybrewrace.com luckybrewrace.com
lunar.unboundgravel.com lunar.unboundgravel.com
manhattanmontauk.com manhattanmontauk.com
marshalluniversitymarathon.com marshalluniversitymarathon.com
mauimarathonsignup.com mauimarathonsignup.com
maythe4thrunwithyou.com maythe4thrunwithyou.com
maythecourserace.com maythecourserace.com
mcguire-air-force-base-nj.healthykidsrunningseries.org mcguire-air-force-base-nj.healthykidsrunningseries.org
mcrrcrununderlights.com mcrrcrununderlights.com
mechanicsville-va.healthykidsrunningseries.org mechanicsville-va.healthykidsrunningseries.org
midlothian-va.healthykidsrunningseries.org midlothian-va.healthykidsrunningseries.org
mikeariensrunwalk.com mikeariensrunwalk.com
milehightri.com milehightri.com
minnesota.oneus.run minnesota.oneus.run
missouriendurancechallenge.com missouriendurancechallenge.com
mommasday5k.com mommasday5k.com
moorestownturkeytrot.com moorestownturkeytrot.com
mothersdayrunwalk.com mothersdayrunwalk.com
mountaingoatrun.org mountaingoatrun.org
movemontanachallenge.com movemontanachallenge.com
movemtchallenge.com movemtchallenge.com
movethrough.org movethrough.org
msgratos.com msgratos.com
mtlemmongravelgrinder.com mtlemmongravelgrinder.com
mullica-hill-mantua-nj.healthykidsrunningseries.org mullica-hill-mantua-nj.healthykidsrunningseries.org
musiccitymilesandmemories.com musiccitymilesandmemories.com
new-braunfels-tx.healthykidsrunningseries.org new-braunfels-tx.healthykidsrunningseries.org
newtownturkeytrot.com newtownturkeytrot.com
newyearsday5k.run newyearsday5k.run
nickycass5kchallenge.com nickycass5kchallenge.com
northtexasturkeytrot.com northtexasturkeytrot.com
nyctowerclimb.t2t.org nyctowerclimb.t2t.org
ola5k.com ola5k.com
otilloorcas.com otilloorcas.com
oviedohalloween5k.com oviedohalloween5k.com
ovtri.com ovtri.com
paddlesignup.com paddlesignup.com
panther5krun.com panther5krun.com
parkshalfmarathon.com parkshalfmarathon.com
parrish-fl.healthykidsrunningseries.org parrish-fl.healthykidsrunningseries.org
paws4pride.org paws4pride.org
payitforward5k.com payitforward5k.com
perryhall-md.healthykidsrunningseries.org perryhall-md.healthykidsrunningseries.org
phoenixville-pa.healthykidsrunningseries.org phoenixville-pa.healthykidsrunningseries.org
pinehurst-nc.healthykidsrunningseries.org pinehurst-nc.healthykidsrunningseries.org
pinkathon.com pinkathon.com
pirates5k.com pirates5k.com
pistolcreekmarathon.com pistolcreekmarathon.com
pomona5k.com pomona5k.com
poppasday5k.com poppasday5k.com
portervillerunforlife.com portervillerunforlife.com
princetonhalfmarathon.com princetonhalfmarathon.com
princetonhalfmarathon.org princetonhalfmarathon.org
pupsandpastries.com pupsandpastries.com
pvaquathlon5k.com pvaquathlon5k.com
quietresortsgolf.com quietresortsgolf.com
racedaymanagement.com racedaymanagement.com
racethebloom.com racethebloom.com
racethedecades.com racethedecades.com
radskimo.com radskimo.com
redcarpetrunhalf.com redcarpetrunhalf.com
redmondharvesthalf.com redmondharvesthalf.com
redwhiteandruck.com redwhiteandruck.com
reg.305halfmarathon.com reg.305halfmarathon.com
reg.chicagohalfmarathon.com reg.chicagohalfmarathon.com
reg.chicagospringhalf.com reg.chicagospringhalf.com
summerpicnic.saratogastryders.org summerpicnic.saratogastryders.org
wytheharvestfest.com wytheharvestfest.com
can-ogr.sfsevents.org can-ogr.sfsevents.org
gorgasstreethorror.com gorgasstreethorror.com
noncomm.org noncomm.org
DCLACROSSETIX.CSELAX.COM
IP History

Click the IP addresses to see over domains using them.