Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

DCLACROSSSETIX.CSELAX.COM

DCLACROSSSETIX.CSELAX.COM
Shared Attributes
Domain
screamfestparanormal.com screamfestparanormal.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 38 days
istpsu.com test-rsu-prod1.istpsu.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 36 days
dnc.com tickets.dnc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 8 days
raleighhauntedhouse.com tickets.raleighhauntedhouse.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 36 days
beerandcheesefest.com beerandcheesefest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Oct 2024 Oct 2024 3 days
windandvibes.org windandvibes.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
wvlake.com wvlake.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
chippewavalleyfacilityengineers.org chippewavalleyfacilityengineers.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
dnc.com flsummit.dnc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 8 days
ghentpride.com ghentpride.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 46 days
saratogastryders.org holidayparty.saratogastryders.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 38 days
jscwempowermentconference.com jscwempowermentconference.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
kiwaniscarsandcandyshow.com kiwaniscarsandcandyshow.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 33 days
pistonprops.com pistonprops.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
pistonsprop.com pistonsprop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
advice5kturkeytrot.com advice5kturkeytrot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
priceoffreedomfoundation.org amos.priceoffreedomfoundation.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 35 days
t2t.org bravestbbq.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
huskyboosters.org golf.huskyboosters.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 37 days
t2t.org heroescuptickets.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
houseofshadows.org houseofshadows.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 37 days
lakewv.com lakewv.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
lightsonthelakewv.com lightsonthelakewv.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 30 days
pistonsprops.com pistonsprops.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
pokerchipsforscholarships.com pokerchipsforscholarships.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
polarisstaraward.com polarisstaraward.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
rhythmofhopebenefitconcert.com rhythmofhopebenefitconcert.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 37 days
allstarholidayskills.com allstarholidayskills.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 51 days
amshaunts.com amshaunts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
startuprunwayfoundation.com startuprunwayfoundation.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 40 days
saratogastryders.org summerpicnic.saratogastryders.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
t2t.org appreciationdinner.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
laclj.org teeup.laclj.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
wytheharvestfest.com wytheharvestfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
sfsevents.org can-ogr.sfsevents.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 39 days
dodgepointoysterfarm.org dodgepointoysterfarm.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 55 days
t2t.org genovesedinnerdance.t2t.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
playmakers.com goodform.playmakers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 8 days
gorgasstreethorror.com gorgasstreethorror.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 45 days
ashlandberryfarm.com haunt.ashlandberryfarm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
midlandmusicfest.com midlandmusicfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 28 days
noncomm.org noncomm.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
ashlandberryfarm.com pumpkin.ashlandberryfarm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
rockinrogersville.com rockinrogersville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
sellsbroadwaydancecompany.com sellsbroadwaydancecompany.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 38 days
michiganchallenge.com tickets.michiganchallenge.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Oct 2024 28 days
constitution2024.com constitution2024.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Oct 2024 Oct 2024 One Off
cselax.com dclacrossetix.cselax.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
hauntedstagestop.com hauntedstagestop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 57 days
reliefbeerfest.com reliefbeerfest.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Sep 2024 36 days
pistonprop.com pistonprop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
historiclongwood.com poker.historiclongwood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Aug 2024 Oct 2024 39 days
polarisstarawards.com polarisstarawards.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Sep 2024 Sep 2024 One Off
charlottetranshealth.org thenight.charlottetranshealth.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-G-VD9RW4YRT4 Oct 2024 Oct 2024 2 days
DCLACROSSSETIX.CSELAX.COM
Non IP Attributes
Attribute
GTM GTM-G-TMP7T3SB18
Mar 2023 - May 2024
GTM GTM-G-VD9RW4YRT4
Aug 2024 - Oct 2024
DCLACROSSSETIX.CSELAX.COM
IP History

Click the IP addresses to see over domains using them.