Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

INSTITUTIONALINTELLIGENT-VNEXT.SCHWAB.COM

INSTITUTIONALINTELLIGENT-VNEXT.SCHWAB.COM
Shared Attributes
Domain
schwab.com institutionalintelligent.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD Apr 2021 Feb 2024 2 years, 309 days
NR NR-868F196A8B Apr 2021 Feb 2024 2 years, 309 days
OP OP-14738960062 Apr 2021 Feb 2024 2 years, 309 days
MK MK-916-SSU-236 Apr 2021 Aug 2023 2 years, 137 days
GTM GTM-DC-2530996 Jan 2023 Aug 2023 214 days
schwab.com institutionalintelligent-pre.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD Jun 2021 Jan 2023 1 year, 227 days
MK MK-916-SSU-236 Jun 2021 Jan 2023 1 year, 227 days
NR NR-868F196A8B Jun 2021 Jan 2023 1 year, 227 days
OP OP-14738960062 Jun 2021 Jan 2023 1 year, 227 days
GTM GTM-DC-2530996 Jan 2023 Jan 2023 One Off
schwab.com advisorservices.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
SC SC-CSCHWABADVISORSERVICESPROD Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Jun 2022 Apr 2024 1 year, 290 days
MK MK-916-SSU-236 Apr 2021 Aug 2022 1 year, 124 days
passionclub1.com passionclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Oct 2023 One Off
GTM GTM-DC-2530996 Oct 2023 Oct 2023 One Off
OP OP-14738960062 Oct 2023 Oct 2023 One Off
schwab.com preferred.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2023 Apr 2024 350 days
OP OP-14738960062 Apr 2023 Apr 2024 350 days
GTM GTM-DC-2530996 Jul 2023 Apr 2024 270 days
activeclub1.com activeclub1.com
Attribute Value First Detected Last Detected Overlap Duration
OP OP-14738960062 Oct 2023 Nov 2023 36 days
NR NR-868F196A8B Oct 2023 Nov 2023 36 days
GTM GTM-DC-2530996 Oct 2023 Nov 2023 36 days
schwab.com schwab.com
Attribute Value First Detected Last Detected Overlap Duration
OP OP-14738960062 Apr 2021 Apr 2024 2 years, 363 days
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
GTM GTM-DC-2530996 Jan 2023 Apr 2024 1 year, 75 days
schwabpt.com schwabpt.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Apr 2021 Apr 2024 2 years, 363 days
GTM GTM-DC-2530996 Jan 2023 Apr 2024 1 year, 75 days
sustainableinvestmentclub1.com sustainableinvestmentclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Nov 2023 Nov 2023 One Off
GTM GTM-DC-2530996 Nov 2023 Nov 2023 One Off
OP OP-14738960062 Nov 2023 Nov 2023 One Off
wealthbuildersinvestmentclub1.com wealthbuildersinvestmentclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Nov 2023 Nov 2023 One Off
GTM GTM-DC-2530996 Nov 2023 Nov 2023 One Off
OP OP-14738960062 Nov 2023 Nov 2023 One Off
schwab.com welcomeadvisors.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD May 2022 Sep 2022 136 days
NR NR-868F196A8B May 2022 Sep 2022 136 days
MK MK-916-SSU-236 Aug 2022 Sep 2022 46 days
crazyclub1.com crazyclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Nov 2023 38 days
GTM GTM-DC-2530996 Oct 2023 Nov 2023 38 days
OP OP-14738960062 Oct 2023 Nov 2023 38 days
eliteinvestmentclub1.com eliteinvestmentclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Nov 2023 Nov 2023 One Off
GTM GTM-DC-2530996 Nov 2023 Nov 2023 One Off
OP OP-14738960062 Nov 2023 Nov 2023 One Off
happyclub1.com happyclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Oct 2023 6 days
GTM GTM-DC-2530996 Oct 2023 Oct 2023 6 days
OP OP-14738960062 Oct 2023 Oct 2023 6 days
investmentclubinsights1.com investmentclubinsights1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Nov 2023 30 days
OP OP-14738960062 Oct 2023 Nov 2023 30 days
GTM GTM-DC-2530996 Oct 2023 Oct 2023 One Off
invincibleclub1.com invincibleclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Nov 2023 29 days
OP OP-14738960062 Oct 2023 Nov 2023 29 days
GTM GTM-DC-2530996 Oct 2023 Oct 2023 One Off
seviweb.co seviweb.co
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Sep 2023 Sep 2023 One Off
GTM GTM-DC-2530996 Sep 2023 Sep 2023 One Off
OP OP-14738960062 Sep 2023 Sep 2023 One Off
smartmoneyinvestmentclub1.com smartmoneyinvestmentclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Nov 2023 Nov 2023 One Off
GTM GTM-DC-2530996 Nov 2023 Nov 2023 One Off
OP OP-14738960062 Nov 2023 Nov 2023 One Off
1283355.com 1283355.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jun 2023 Jun 2023 One Off
GTM GTM-DC-2530996 Jun 2023 Jun 2023 One Off
OP OP-14738960062 Jun 2023 Jun 2023 One Off
windhaveninvestments.com windhaveninvestments.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Aug 2021 Apr 2024 2 years, 249 days
OP OP-14738960062 Aug 2021 Apr 2024 2 years, 249 days
GTM GTM-DC-2530996 Jan 2023 Apr 2024 1 year, 73 days
diversifyinvestmentclub.com diversifyinvestmentclub.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Nov 2023 40 days
GTM GTM-DC-2530996 Oct 2023 Nov 2023 40 days
OP OP-14738960062 Oct 2023 Nov 2023 40 days
schwab.com institutionalintelligent-dev.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jun 2021 Apr 2024 2 years, 302 days
OP OP-14738960062 Mar 2022 Jul 2023 1 year, 131 days
GTM GTM-DC-2530996 Apr 2023 Jul 2023 80 days
schwab.com institutionalintelligent-uat.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Dec 2021 Apr 2024 2 years, 117 days
OP OP-14738960062 Aug 2021 Aug 2023 2 years, 23 days
GTM GTM-DC-2530996 Jan 2023 Aug 2023 214 days
uperclub1.com uperclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Nov 2023 36 days
GTM GTM-DC-2530996 Oct 2023 Nov 2023 36 days
OP OP-14738960062 Oct 2023 Nov 2023 36 days
investmastersclub1.com investmastersclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Nov 2023 Nov 2023 One Off
GTM GTM-DC-2530996 Nov 2023 Nov 2023 One Off
OP OP-14738960062 Nov 2023 Nov 2023 One Off
findyourindependentadvisor.com learninghub.findyourindependentadvisor.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD Apr 2021 Apr 2024 2 years, 363 days
MK MK-916-SSU-236 Oct 2021 Apr 2024 2 years, 168 days
OP OP-14738960062 Oct 2021 Mar 2023 1 year, 142 days
schwab.com retirementadvisorsolutions.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD Jul 2022 Aug 2022 30 days
NR NR-868F196A8B Jul 2022 Aug 2022 30 days
OP OP-14738960062 Jul 2022 Aug 2022 30 days
schwab.co.uk schwab.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Apr 2021 Apr 2024 2 years, 363 days
GTM GTM-DC-2530996 Jan 2023 Apr 2024 1 year, 75 days
blazingclub1.com blazingclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Nov 2023 37 days
GTM GTM-DC-2530996 Oct 2023 Nov 2023 37 days
OP OP-14738960062 Oct 2023 Nov 2023 37 days
braveclub1.com braveclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2023 Nov 2023 34 days
OP OP-14738960062 Oct 2023 Nov 2023 34 days
GTM GTM-DC-2530996 Nov 2023 Nov 2023 One Off
wiseinvestmentclub1.com wiseinvestmentclub1.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Nov 2023 Nov 2023 One Off
GTM GTM-DC-2530996 Nov 2023 Nov 2023 One Off
OP OP-14738960062 Nov 2023 Nov 2023 One Off
findyourindependentadvisor.com findyourindependentadvisor.com
Attribute Value First Detected Last Detected Overlap Duration
MK MK-916-SSU-236 Apr 2021 Apr 2024 2 years, 363 days
SC SC-CSCHWABADVISORSERVICESPROD Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Apr 2021 Mar 2023 1 year, 337 days
schwab.com institutionalintelligent-qa.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jun 2021 Apr 2024 2 years, 302 days
OP OP-14738960062 Jan 2022 Apr 2024 2 years, 71 days
GTM GTM-DC-2530996 Jan 2023 Apr 2024 1 year, 75 days
mariessweetdesigns.com mariessweetdesigns.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Feb 2022 Feb 2023 1 year, 3 days
OP OP-14738960062 Feb 2022 Feb 2023 1 year, 3 days
schwab.com workplace.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jul 2022 Apr 2024 1 year, 269 days
OP OP-14738960062 Jul 2022 Apr 2024 1 year, 269 days
schwab.com workplacefinancialservices.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Dec 2021 Apr 2024 2 years, 117 days
schwab.com educationcontent.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jun 2022 Apr 2024 1 year, 290 days
GTM GTM-DC-2530996 Jan 2023 Dec 2023 333 days
markitqa.com findyourindependentadvisor.markitqa.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD Apr 2021 Oct 2023 2 years, 199 days
OP OP-14738960062 Jan 2022 Jan 2023 364 days
xiangrou.net hris.xiangrou.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jul 2022 Sep 2022 76 days
OP OP-14738960062 Jul 2022 Sep 2022 76 days
hsszl.com hsszl.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2022 Apr 2022 One Off
OP OP-14738960062 Apr 2022 Apr 2022 One Off
mrciseries.com mrciseries.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Feb 2022 May 2022 91 days
OP OP-14738960062 Feb 2022 May 2022 91 days
northweb9.com northweb9.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Feb 2022 May 2022 92 days
OP OP-14738960062 Feb 2022 May 2022 92 days
schwab.com.sg schwab.com.sg
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Feb 2024 Apr 2024 66 days
GTM GTM-DC-2530996 Feb 2024 Apr 2024 55 days
schwab.com.hk schwab.com.hk
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Apr 2021 Apr 2024 2 years, 363 days
schwab.com hg.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B May 2022 Apr 2024 1 year, 329 days
GTM GTM-DC-2530996 Jan 2023 Apr 2024 1 year, 75 days
schwabcdn.com clientcontent.schwabcdn.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Mar 2024 2 years, 353 days
OP OP-14738960062 Apr 2021 Mar 2024 2 years, 353 days
schwab.com everestcontent.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jun 2022 Jan 2023 215 days
OP OP-14738960062 Jun 2022 Jan 2023 215 days
webwatchersonline.com info.webwatchersonline.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Aug 2022 Aug 2022 One Off
OP OP-14738960062 Aug 2022 Aug 2022 One Off
schwab.tech intelligent-client-qa.dev.schwab.tech
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jun 2021 Apr 2024 2 years, 312 days
GTM GTM-DC-2530996 Jan 2023 Mar 2024 1 year, 65 days
schwab.com intelligent-client.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
GTM GTM-DC-2530996 Jan 2023 Dec 2023 333 days
schwabcharitable.org schwabcharitable.org
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Apr 2021 Apr 2024 2 years, 363 days
schwabmoneywise.com schwabmoneywise.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Aug 2022 Apr 2024 1 year, 239 days
OP OP-14738960062 Aug 2022 Apr 2024 1 year, 239 days
schwabtrustbankcollectives.com schwabtrustbankcollectives.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Feb 2022 Apr 2024 2 years, 44 days
GTM GTM-DC-2530996 Jan 2023 Apr 2024 1 year, 75 days
tesudu.net tesudu.net
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Mar 2022 Sep 2022 197 days
OP OP-14738960062 Mar 2022 Sep 2022 197 days
thebigcrewchange.com thebigcrewchange.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Mar 2022 Sep 2022 197 days
OP OP-14738960062 Aug 2022 Sep 2022 45 days
azsxwe.world azsxwe.world
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jan 2023 Dec 2023 334 days
OP OP-14738960062 Jan 2023 Dec 2023 334 days
hcbmar.com hcbmar.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Feb 2022 Feb 2022 One Off
OP OP-14738960062 Feb 2022 Feb 2022 One Off
howcanigetflatabs.com iuklife.www.howcanigetflatabs.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jan 2023 Jan 2023 One Off
OP OP-14738960062 Jan 2023 Jan 2023 One Off
schwabinstitutional.com login.si2.schwabinstitutional.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD Apr 2021 Apr 2021 One Off
MK MK-916-SSU-236 Apr 2021 Apr 2021 One Off
riastandsforyou.com riastandsforyou.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Feb 2023 Apr 2023 47 days
aboutschwab.com aboutschwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Apr 2021 Apr 2024 2 years, 363 days
schwab.com rtcontent.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jun 2022 Jan 2023 215 days
OP OP-14738960062 Jun 2022 Jan 2023 215 days
schwabassetmanagement.com schwabassetmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
OP OP-14738960062 Jun 2022 Apr 2024 1 year, 309 days
voipsources.com spprd.voipsources.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B May 2022 May 2022 One Off
OP OP-14738960062 May 2022 May 2022 One Off
thomaspartnersim.com thomaspartnersim.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B May 2022 Apr 2024 1 year, 333 days
GTM GTM-DC-2530996 Jan 2023 Apr 2024 1 year, 75 days
jordanstext.com visit.jordanstext.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Oct 2022 Oct 2022 One Off
OP OP-14738960062 Oct 2022 Oct 2022 One Off
xasxwl.com xasxwl.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jun 2022 Jun 2022 One Off
OP OP-14738960062 Jun 2022 Jun 2022 One Off
schwab.com international.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Aug 2022 1 year, 124 days
OP OP-14738960062 Apr 2021 Aug 2022 1 year, 124 days
mofo-co.com learn.mofo-co.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jul 2022 Jul 2022 One Off
OP OP-14738960062 Jul 2022 Jul 2022 One Off
daugel.com marketplace.daugel.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Nov 2022 Dec 2022 38 days
OP OP-14738960062 Nov 2022 Dec 2022 38 days
wallst.com sasimulator.schwab.wallst.com
Attribute Value First Detected Last Detected Overlap Duration
SC SC-CSCHWABADVISORSERVICESPROD Oct 2021 Feb 2024 2 years, 112 days
schwabnetwork.com schwabnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-DC-2530996 Sep 2023 Apr 2024 194 days
friendlybeacon.com barcd.friendlybeacon.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Nov 2023 Jan 2024 47 days
wasmerschroeder.com wasmerschroeder.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2024 Apr 2024 2 days
schwab.com franchise.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Apr 2021 Apr 2024 2 years, 363 days
schwab.com intelligent.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Dec 2021 Apr 2023 1 year, 132 days
json.trade json.trade
Attribute Value First Detected Last Detected Overlap Duration
OP OP-14738960062 Sep 2022 Feb 2023 146 days
schwabcdn.com saccontent.schwabcdn.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jan 2022 Mar 2024 2 years, 71 days
json.trade schwab.json.trade
Attribute Value First Detected Last Detected Overlap Duration
OP OP-14738960062 Jul 2022 Oct 2022 105 days
schwab.com welcome.schwab.com
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jul 2022 Sep 2022 76 days
feifei521.buzz feifei521.buzz
Attribute Value First Detected Last Detected Overlap Duration
NR NR-868F196A8B Jan 2022 Apr 2022 77 days
csa-events.com impact17-p3.csa-events.com
Attribute Value First Detected Last Detected Overlap Duration
MK MK-916-SSU-236 Apr 2021 Oct 2022 1 year, 179 days
INSTITUTIONALINTELLIGENT-VNEXT.SCHWAB.COM
Non IP Attributes
Attribute First Last
SC SC-CSCHWABADVISORSERVICESPROD Apr 2021 Apr 2024
MK MK-916-SSU-236 Apr 2021 Apr 2024
NR NR-868F196A8B Apr 2021 Apr 2024
OP OP-14738960062 Apr 2021 Apr 2024
GTM GTM-DC-2530996 Jan 2023 Apr 2024
INSTITUTIONALINTELLIGENT-VNEXT.SCHWAB.COM
Overlap Attribute Domains
institutionalintelligent.schwab.com institutionalintelligent.schwab.com
institutionalintelligent-pre.schwab.com institutionalintelligent-pre.schwab.com
institutionalintelligent-vnext.schwab.com institutionalintelligent-vnext.schwab.com
advisorservices.schwab.com advisorservices.schwab.com
passionclub1.com passionclub1.com
preferred.schwab.com preferred.schwab.com
activeclub1.com activeclub1.com
schwab.com schwab.com
schwabpt.com schwabpt.com
sustainableinvestmentclub1.com sustainableinvestmentclub1.com
wealthbuildersinvestmentclub1.com wealthbuildersinvestmentclub1.com
welcomeadvisors.schwab.com welcomeadvisors.schwab.com
crazyclub1.com crazyclub1.com
eliteinvestmentclub1.com eliteinvestmentclub1.com
happyclub1.com happyclub1.com
investmentclubinsights1.com investmentclubinsights1.com
invincibleclub1.com invincibleclub1.com
seviweb.co seviweb.co
smartmoneyinvestmentclub1.com smartmoneyinvestmentclub1.com
1283355.com 1283355.com
windhaveninvestments.com windhaveninvestments.com
diversifyinvestmentclub.com diversifyinvestmentclub.com
institutionalintelligent-dev.schwab.com institutionalintelligent-dev.schwab.com
institutionalintelligent-uat.schwab.com institutionalintelligent-uat.schwab.com
uperclub1.com uperclub1.com
investmastersclub1.com investmastersclub1.com
learninghub.findyourindependentadvisor.com learninghub.findyourindependentadvisor.com
retirementadvisorsolutions.schwab.com retirementadvisorsolutions.schwab.com
schwab.co.uk schwab.co.uk
blazingclub1.com blazingclub1.com
braveclub1.com braveclub1.com
wiseinvestmentclub1.com wiseinvestmentclub1.com
findyourindependentadvisor.com findyourindependentadvisor.com
institutionalintelligent-qa.schwab.com institutionalintelligent-qa.schwab.com
mariessweetdesigns.com mariessweetdesigns.com
workplace.schwab.com workplace.schwab.com
workplacefinancialservices.schwab.com workplacefinancialservices.schwab.com
educationcontent.schwab.com educationcontent.schwab.com
findyourindependentadvisor.markitqa.com findyourindependentadvisor.markitqa.com
hris.xiangrou.net hris.xiangrou.net
hsszl.com hsszl.com
mrciseries.com mrciseries.com
northweb9.com northweb9.com
schwab.com.sg schwab.com.sg
schwab.com.hk schwab.com.hk
hg.schwab.com hg.schwab.com
clientcontent.schwabcdn.com clientcontent.schwabcdn.com
everestcontent.schwab.com everestcontent.schwab.com
info.webwatchersonline.com info.webwatchersonline.com
intelligent-client-qa.dev.schwab.tech intelligent-client-qa.dev.schwab.tech
intelligent-client.schwab.com intelligent-client.schwab.com
schwabcharitable.org schwabcharitable.org
schwabmoneywise.com schwabmoneywise.com
schwabtrustbankcollectives.com schwabtrustbankcollectives.com
tesudu.net tesudu.net
thebigcrewchange.com thebigcrewchange.com
azsxwe.world azsxwe.world
hcbmar.com hcbmar.com
iuklife.www.howcanigetflatabs.com iuklife.www.howcanigetflatabs.com
login.si2.schwabinstitutional.com login.si2.schwabinstitutional.com
riastandsforyou.com riastandsforyou.com
aboutschwab.com aboutschwab.com
rtcontent.schwab.com rtcontent.schwab.com
schwabassetmanagement.com schwabassetmanagement.com
spprd.voipsources.com spprd.voipsources.com
thomaspartnersim.com thomaspartnersim.com
visit.jordanstext.com visit.jordanstext.com
xasxwl.com xasxwl.com
international.schwab.com international.schwab.com
learn.mofo-co.com learn.mofo-co.com
marketplace.daugel.com marketplace.daugel.com
sasimulator.schwab.wallst.com sasimulator.schwab.wallst.com
schwabnetwork.com schwabnetwork.com
barcd.friendlybeacon.com barcd.friendlybeacon.com
wasmerschroeder.com wasmerschroeder.com
franchise.schwab.com franchise.schwab.com
intelligent.schwab.com intelligent.schwab.com
json.trade json.trade
saccontent.schwabcdn.com saccontent.schwabcdn.com
schwab.json.trade schwab.json.trade
welcome.schwab.com welcome.schwab.com
feifei521.buzz feifei521.buzz
impact17-p3.csa-events.com impact17-p3.csa-events.com
INSTITUTIONALINTELLIGENT-VNEXT.SCHWAB.COM
IP History

Click the IP addresses to see over domains using them.