Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

NR-868F196A8B

NewRelic Usage and History

NR-868F196A8B Connected Domains
Domain First Detected Last Detected Duration
aboutschwab.com aboutschwab.com Nov 2019 Feb 2025 5 years, 93 days
schwab.com schwab.com Nov 2019 May 2024 4 years, 194 days
schwab.co.uk schwab.co.uk Jul 2020 Dec 2024 4 years, 163 days
schwab.com.hk schwab.com.hk Sep 2020 Feb 2025 4 years, 145 days
schwabcharitable.org schwabcharitable.org Sep 2020 Jan 2025 4 years, 134 days
schwabpt.com schwabpt.com Oct 2020 Feb 2025 4 years, 129 days
advisorservices.schwab.com advisorservices.schwab.com Nov 2020 Feb 2025 4 years, 99 days
schwabassetmanagement.com schwabassetmanagement.com Apr 2021 Feb 2025 3 years, 324 days
clientcontent.schwabcdn.com clientcontent.schwabcdn.com Aug 2020 Mar 2024 3 years, 212 days
workplacefinancialservices.schwab.com workplacefinancialservices.schwab.com Nov 2020 Apr 2024 3 years, 150 days
franchise.schwab.com franchise.schwab.com Nov 2020 Apr 2024 3 years, 150 days
institutionalintelligent-dev.schwab.com institutionalintelligent-dev.schwab.com Jun 2021 Nov 2024 3 years, 145 days
institutionalintelligent-qa.schwab.com institutionalintelligent-qa.schwab.com Jun 2021 Nov 2024 3 years, 145 days
intelligent-client-qa.dev.schwab.tech intelligent-client-qa.dev.schwab.tech Jun 2021 Oct 2024 3 years, 137 days
intelligent-client.schwab.com intelligent-client.schwab.com Feb 2021 Apr 2024 3 years, 60 days
institutionalintelligent-vnext.schwab.com institutionalintelligent-vnext.schwab.com Apr 2021 Apr 2024 2 years, 363 days
institutionalintelligent-uat.schwab.com institutionalintelligent-uat.schwab.com Dec 2021 Nov 2024 2 years, 325 days
institutionalintelligent.schwab.com institutionalintelligent.schwab.com Apr 2021 Feb 2024 2 years, 309 days
windhaveninvestments.com windhaveninvestments.com Aug 2021 Apr 2024 2 years, 249 days
schwabtrustbankcollectives.com schwabtrustbankcollectives.com Feb 2022 Oct 2024 2 years, 225 days
workplace.schwab.com workplace.schwab.com Jul 2022 Feb 2025 2 years, 218 days
schwabmoneywise.com schwabmoneywise.com Aug 2022 Feb 2025 2 years, 188 days
thomaspartnersim.com thomaspartnersim.com May 2022 Oct 2024 2 years, 150 days
saccontent.schwabcdn.com saccontent.schwabcdn.com Jan 2022 Mar 2024 2 years, 71 days
hg.schwab.com hg.schwab.com May 2022 Apr 2024 1 year, 329 days
educationcontent.schwab.com educationcontent.schwab.com Jun 2022 Apr 2024 1 year, 290 days
international.schwab.com international.schwab.com Nov 2020 Aug 2022 1 year, 276 days
institutionalintelligent-pre.schwab.com institutionalintelligent-pre.schwab.com Jun 2021 Jan 2023 1 year, 227 days
intelligent.schwab.com intelligent.schwab.com Dec 2021 Apr 2023 1 year, 132 days
schwab.com.sg schwab.com.sg Feb 2024 Feb 2025 1 year, 15 days
mariessweetdesigns.com mariessweetdesigns.com Feb 2022 Feb 2023 1 year, 3 days
preferred.schwab.com preferred.schwab.com Apr 2023 Apr 2024 350 days
azsxwe.world azsxwe.world Jan 2023 Dec 2023 334 days
schwabfunds.com schwabfunds.com Jun 2020 Feb 2021 244 days
everestcontent.schwab.com everestcontent.schwab.com Jun 2022 Jan 2023 215 days
rtcontent.schwab.com rtcontent.schwab.com Jun 2022 Jan 2023 215 days
tesudu.net tesudu.net Mar 2022 Sep 2022 197 days
thebigcrewchange.com thebigcrewchange.com Mar 2022 Sep 2022 197 days
wasmerschroeder.com wasmerschroeder.com Apr 2024 Oct 2024 188 days
welcomeadvisors.schwab.com welcomeadvisors.schwab.com May 2022 Sep 2022 136 days
northweb9.com northweb9.com Feb 2022 May 2022 92 days
mrciseries.com mrciseries.com Feb 2022 May 2022 91 days
feifei521.buzz feifei521.buzz Jan 2022 Apr 2022 77 days
hris.xiangrou.net hris.xiangrou.net Jul 2022 Sep 2022 76 days
welcome.schwab.com welcome.schwab.com Jul 2022 Sep 2022 76 days
schwabpcra.com schwabpcra.com Oct 2020 Nov 2020 49 days
barcd.friendlybeacon.com barcd.friendlybeacon.com Nov 2023 Jan 2024 47 days
diversifyinvestmentclub.com diversifyinvestmentclub.com Oct 2023 Nov 2023 40 days
crazyclub1.com crazyclub1.com Oct 2023 Nov 2023 38 days
marketplace.daugel.com marketplace.daugel.com Nov 2022 Dec 2022 38 days
blazingclub1.com blazingclub1.com Oct 2023 Nov 2023 37 days
activeclub1.com activeclub1.com Oct 2023 Nov 2023 36 days
uperclub1.com uperclub1.com Oct 2023 Nov 2023 36 days
braveclub1.com braveclub1.com Oct 2023 Nov 2023 34 days
investmentclubinsights1.com investmentclubinsights1.com Oct 2023 Nov 2023 30 days
retirementadvisorsolutions.schwab.com retirementadvisorsolutions.schwab.com Jul 2022 Aug 2022 30 days
invincibleclub1.com invincibleclub1.com Oct 2023 Nov 2023 29 days
centuryfinancebank.com centuryfinancebank.com Jan 2025 Feb 2025 22 days
happyclub1.com happyclub1.com Oct 2023 Oct 2023 6 days
dafgiving360.org dafgiving360.org Feb 2025 Feb 2025 1 day
passionclub1.com passionclub1.com Oct 2023 Oct 2023 One Off
sustainableinvestmentclub1.com sustainableinvestmentclub1.com Nov 2023 Nov 2023 One Off
wealthbuildersinvestmentclub1.com wealthbuildersinvestmentclub1.com Nov 2023 Nov 2023 One Off
eliteinvestmentclub1.com eliteinvestmentclub1.com Nov 2023 Nov 2023 One Off
hsszl.com hsszl.com Apr 2022 Apr 2022 One Off
seviweb.co seviweb.co Sep 2023 Sep 2023 One Off
smartmoneyinvestmentclub1.com smartmoneyinvestmentclub1.com Nov 2023 Nov 2023 One Off
1283355.com 1283355.com Jun 2023 Jun 2023 One Off
info.webwatchersonline.com info.webwatchersonline.com Aug 2022 Aug 2022 One Off
hcbmar.com hcbmar.com Feb 2022 Feb 2022 One Off
investmastersclub1.com investmastersclub1.com Nov 2023 Nov 2023 One Off
iuklife.www.howcanigetflatabs.com iuklife.www.howcanigetflatabs.com Jan 2023 Jan 2023 One Off
spprd.voipsources.com spprd.voipsources.com May 2022 May 2022 One Off
visit.jordanstext.com visit.jordanstext.com Oct 2022 Oct 2022 One Off
wiseinvestmentclub1.com wiseinvestmentclub1.com Nov 2023 Nov 2023 One Off
xasxwl.com xasxwl.com Jun 2022 Jun 2022 One Off
learn.mofo-co.com learn.mofo-co.com Jul 2022 Jul 2022 One Off
NR-868F196A8B
Usage Overlap History

Click the domain names to see more information.