Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

SAFFRONROSEGOLD.COM

SAFFRONROSEGOLD.COM
Shared Attributes
Domain
launchintenselyquickthefile.vip launchintenselyquickthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchprogressiveintenselythefile.vip launchprogressiveintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchrefinedintenselythefile.vip launchrefinedintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
liquordepotdixie.com liquordepotdixie.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquorjunction.com liquorjunction.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquorstorevegas.com liquorstorevegas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
luluislandliquor.com luluislandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 8 days
manhattanliquorsfl.com manhattanliquorsfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
mybelairliquors.com mybelairliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
newaceliquor.com newaceliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
nitro2gobev.com nitro2gobev.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
oldmiltonbeverages.com oldmiltonbeverages.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
ordn.in ordn.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
ostliquorstore.net ostliquorstore.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
peavinewineandspirit.com peavinewineandspirit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 3 days
perrysstores.com perrysstores.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
planetofwine.com planetofwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
proofsomerville.com proofsomerville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
renaissancelongmont.com renaissancelongmont.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 1 day
rootsbeerdistributor.com rootsbeerdistributor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
royalliquorstore.com royalliquorstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
gemcityws.com shop.gemcityws.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 15 days
shoreviewliquors.com shoreviewliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
siennawine.com siennawine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
americanspiritsaddison.com americanspiritsaddison.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
sonsonliquor.com sonsonliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
springsliquor.com springsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
ssliquors.com ssliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
steinsandvines.com steinsandvines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 32 days
surfliquorsnj.com surfliquorsnj.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
suwaneetopshelf.com suwaneetopshelf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
sweetwaterpackagestore.com sweetwaterpackagestore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
antonswineandliquor.com antonswineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
tampaliquorz.com tampaliquorz.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
thespiritshop.org thespiritshop.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
barnbottleshop.com barnbottleshop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
topshelfwinespiritlv.com topshelfwinespiritlv.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
beera2.com beera2.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
beerworldpa.com beerworldpa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
treecitywine.com treecitywine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
berwickbeverage.com berwickbeverage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
tupelowine.com tupelowine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
turtlecreekwineandspirits.com turtlecreekwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
helloit.tech unifi2.helloit.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
bottlecapps.com bimspackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
ustopliquor.com ustopliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
vernsliquor.com vernsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
villagewineathens.com villagewineathens.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
vineyardliquors.com vineyardliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
vipliquoratl.com vipliquoratl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
warehouseliquorlr.com warehouseliquorlr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
boozerusathens.com boozerusathens.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
bottlecapps.com bottlesbeverage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
bradyswine.com bradyswine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
wedeliverstores.com wedeliverstores.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
westvail.com westvail.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
wlemporium.com wlemporium.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
worldbeverage400orders.com worldbeverage400orders.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
cabsandcrafts.com cabsandcrafts.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
calhounliquor.com calhounliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
canalsofglassboro.com canalsofglassboro.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
candcliquorfortcollins.com candcliquorfortcollins.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
yahotties.com yahotties.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 27 days
cavediverssouth.com cavediverssouth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
cellarsliquor.com cellarsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
chartertextbook.com chartertextbook.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
chartertextbooks.com chartertextbooks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
clocktowermn.com clocktowermn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
bottlecapps.com cornhuskerbeverage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
cpsliquor.com cpsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
creeksidebeer.com creeksidebeer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
davidsonsliquors.com davidsonsliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
bottlecapps.com dekalbbottlehouse.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
dialiquorwarehouse.com dialiquorwarehouse.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 18 days
dorrsliquormart.com dorrsliquormart.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
fultonstreetliquor.com fultonstreetliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 15 days
gomesliquors.com gomesliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 14 days
grapeleafstore.com grapeleafstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 14 days
harvestliquors.com harvestliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 13 days
heritagemhk.com heritagemhk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 13 days
bottlecapps.com highspirits.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
hopsgrainandvine.com hopsgrainandvine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
houseofkindredspiritsandwine.com houseofkindredspiritsandwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
ingloriouscaskers.com ingloriouscaskers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
instantliquor.com instantliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
ordermate.online int.ordermate.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
jaxspirits.com jaxspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
bottlecapps.com kilroyspackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
iseatz.com ihg-desktop-prod.iseatz.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PKD5TZ Mar 2022 Mar 2022 One Off
kaplanindex.com kaplanindex.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
bottlecapps.com kedronworldofbeverage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
launchdevelopedintenselythefile.vip launchdevelopedintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchfreemostthefile.vip launchfreemostthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchintenselyrefinedthefile.vip launchintenselyrefinedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchintenselysophisticatedthefile.vip launchintenselysophisticatedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchmostfreethefile.vip launchmostfreethefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchrenewedmostthefile.vip launchrenewedmostthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
bottlecapps.com ledgebrookspiritshop.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
leisers.com leisers.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
liquorbarnvaldosta.com liquorbarnvaldosta.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquorcity.com liquorcity.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquorland.us liquorland.us
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 9 days
liquorlockerclub.com liquorlockerclub.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquorloftvaldosta.net liquorloftvaldosta.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquornwine.com liquornwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquorplus.net liquorplus.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquorwfl.com liquorwfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
loadingdockliquors.com loadingdockliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
luckysliquorfl.com luckysliquorfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
bottlecapps.com macadoodles.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
mcswineandliquors.com mcswineandliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 7 days
megaliquorandsmoke.com megaliquorandsmoke.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
metroliquorstore.online metroliquorstore.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
midtownwinemerchants.com midtownwinemerchants.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
mrwineandliquor.com mrwineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
bottlecapps.com muncieliquors.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
myredcarpetliquors.com myredcarpetliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
namewhale.co namewhale.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
bottlecapps.com noblewineandspirts.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
outletliquorga.com outletliquorga.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
redrunliquors.com redrunliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
parkmobileusa.com parkmobileusa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
paulsfinewineandspirits.com paulsfinewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
regalwineliquor.com regalwineliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
peachtreeliquor.com peachtreeliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
pentictonliquor.com pentictonliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 3 days
plazapackage.com plazapackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
pyramidfinewine.com pyramidfinewine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
abcpackage.com abcpackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 25 days
roosterspackage.com roosterspackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
admicrotek.com admicrotek.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
armadilloliquor.com armadilloliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 23 days
alsbdl.com alsbdl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
cornersfinewineandspirits.com shop.cornersfinewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
pinawineandspirits.com shop.pinawineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
fivepointsbottleshop.com shop.fivepointsbottleshop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 16 days
shopatlanticwineandspirits.com shopatlanticwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
shopdlg.com shopdlg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
shopmoransliquor.com shopmoransliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
starpackageonline.com starpackageonline.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
107liquor.com 107liquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 25 days
124package.com 124package.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 25 days
abliquor2.com abliquor2.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 25 days
suwaneetopshelfbeverage.com suwaneetopshelfbeverage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
aspen-liquor.com aspen-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 23 days
taliquorokc.com taliquorokc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
texascheerliquor.com texascheerliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
thecellarbcs.com thecellarbcs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
thejugliquors.com thejugliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
batch13wines.com batch13wines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
bearvalleyliquors.com bearvalleyliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
bottlecapps.com beverageworldpackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
bigred-liquor.com bigred-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
warehousewineliquor.com warehousewineliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
watchguardone.com watchguardone.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
boulevardnlr.com boulevardnlr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
westvail.net westvail.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
brother-liquors.com brother-liquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
bsws.shop bsws.shop
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
buddysbooze.com buddysbooze.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
butlerswineandspirits.com butlerswineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
campuswineandspirit.com campuswineandspirit.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
capitalwineandliquor.com capitalwineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
yesdrink.com yesdrink.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 27 days
chieftainliquors.com chieftainliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
cityliquorsdyersburg.com cityliquorsdyersburg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
colonial-liquors.com colonial-liquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
columbusbeverage.com columbusbeverage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
consumersdiscountwine.com consumersdiscountwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
desotoliquor.com desotoliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 18 days
enovar.solutions dev.tudo.enovar.solutions
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
dixiebeverageliquor.com dixiebeverageliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 18 days
drinksonustx.com drinksonustx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
drugcityliquors.com drugcityliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
eastsidewineandspirits.com eastsidewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
finewineseb.com finewineseb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 16 days
freemansliquormart.com freemansliquormart.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 15 days
gibbysbottleshop.com gibbysbottleshop.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 15 days
goodspiritsliquor.com goodspiritsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 14 days
goodtimeswsb.com goodtimeswsb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
greatwinesmemphis.com greatwinesmemphis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 14 days
bottlecapps.com greens.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
gtownwine.com gtownwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
helencellar.com helencellar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 13 days
houseofambrosestore.com houseofambrosestore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
hovercrossingwinespirits.com hovercrossingwinespirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
jayveeliquors.com jayveeliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
jdsliquortown.com jdsliquortown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 25 days
royalbluepackage.com royalbluepackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
savemoremrkt.com savemoremrkt.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
sharpstownliquor.com sharpstownliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
shellliquors.com shellliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
liquor.studio shop.liquor.studio
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
northstarliquorsuperstore.com shop.northstarliquorsuperstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
shopmidwayliquors.com shopmidwayliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
shopmikeskc.com shopmikeskc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
shoresliquor.com shoresliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
amherstwine.com amherstwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
skylinebroadway.com skylinebroadway.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
anjoliquors.com anjoliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
angkorwine.com angkorwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
spadesliquor.com spadesliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
spiritsofnatchez.com spiritsofnatchez.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
sportsmanliquor.com sportsmanliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
gryphonog.com spotfire.gryphonog.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
adams-liquor.com adams-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 25 days
airportdiscountws.com airportdiscountws.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
swigthis.com swigthis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
taskersbeerbarn.com taskersbeerbarn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
terraceliquordepot.com terraceliquordepot.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
thecellars.com thecellars.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
theliquorstore5.com theliquorstore5.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
theridgewineandspirits.com theridgewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
timberlanewine.com timberlanewine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
bartowliquors.com bartowliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
topshelfmilton.com topshelfmilton.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
beerwineworld.com beerwineworld.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
travisheightswine.com travisheightswine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
tykesliquor.com tykesliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
beveragecity2.com beveragecity2.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
bigsspiritsandwine.shop bigsspiritsandwine.shop
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
usabevco.com usabevco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
ordermate.online usatest.ordermate.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
warehousepackage.com warehousepackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
bottlehousect.com bottlehousect.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
boulevardwine.com boulevardwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
bradyswinewarehouse.com bradyswinewarehouse.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
weststwine.com weststwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
squerb.com widgets.squerb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
wildduckboston.com wildduckboston.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
burlingameliquors.com burlingameliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
xpressliquor.net xpressliquor.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 27 days
captainjacksbev.com captainjacksbev.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
cellarnorman.com cellarnorman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 20 days
zeesdws.com zeesdws.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
alcoholdelivery.com central.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
readportal.info client.readportal.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
colmarbeerstore.com colmarbeerstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
corkrunner.com corkrunner.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
crestliquors.com crestliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
bottlecapps.com decatur.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
deepdiscounttulsa.com deepdiscounttulsa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 18 days
drinktuscany.com drinktuscany.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
alcoholdelivery.com eastern.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
edwinswine.com edwinswine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
elitebeverages.net elitebeverages.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
foremostlakeview.com foremostlakeview.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 15 days
fredsavalonliquors.com fredsavalonliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
fridgeliquormhk.com fridgeliquormhk.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 15 days
bottlecapps.com gomers.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
imgans.com imgans.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
jcwob.com jcwob.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
jerrysimcoebeverage.com jerrysimcoebeverage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
jimmysliquorstore.com jimmysliquorstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
kenyonsmarket.com kenyonsmarket.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
kwikandconvenient.com kwikandconvenient.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
launchintenselydevelopedthefile.vip launchintenselydevelopedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchintenselyrenewedthefile.vip launchintenselyrenewedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
liquorexpressathens.com liquorexpressathens.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
liquorstopfountain.com liquorstopfountain.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
maplewoodwineliquor.com maplewoodwineliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
maxsliquors.com maxsliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
bottlecapps.com megapackagestore.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
meritfinewines.com meritfinewines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
alcoholdelivery.com mountain.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
napavalleybeverageco.com napavalleybeverageco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
northridgeliquor.com northridgeliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
hopcitybeer.com orderonline.hopcitybeer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
outerbridgeliquor.com outerbridgeliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
overstreetmarket.com overstreetmarket.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 3 days
oxfordws.com oxfordws.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
paidup.com paidup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 33 days
palmwinespirits.com palmwinespirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
paradisecoveliquor.com paradisecoveliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 3 days
rickersbeerandwine.com rickersbeerandwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
pearlandfinewineandspirits.com pearlandfinewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
platinumbws.com platinumbws.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 2 days
popatopwine.com popatopwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
poplarwine-spirits.com poplarwine-spirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
iseatz.com ihg.iseatz.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-PKD5TZ Mar 2022 Mar 2022 One Off
royalatlanticwines.com royalatlanticwines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
rumsonwineandspirits.com rumsonwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
scottsmarket.com scottsmarket.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
brownbagliquor.com shop.brownbagliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
alcoholdelivery.com shop.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
shopbarnesliquor.com shopbarnesliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
shopbottlestexas.com shopbottlestexas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
shopliquorlineup.com shopliquorlineup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
sigmanbottle.com sigmanbottle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 35 days
snappiesips.com snappiesips.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
southsideliquor.net southsideliquor.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
southacademyliquormart.com southacademyliquormart.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
andreasgrosphotography.com andreasgrosphotography.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
spankysliquor.com spankysliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
spacitywine.com spacitywine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
bottlecapps.com spiritofharwichport.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
squerb-staging.com squerb-staging.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
starliquorsbottlecapps.net starliquorsbottlecapps.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
starwestbankliquor.com starwestbankliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
bottlecapps.com stockbridgebottle.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
streamwoodliquor.com streamwoodliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
bottlecapps.com superiorliquor.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
swliquors.com swliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
taphouseliquor.com taphouseliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
squerb.com auth.squerb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
thebottleshoppememphis.com thebottleshoppememphis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
thevineyard.com thevineyard.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
batavialiquorwine.com batavialiquorwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
tradingpostliquor.com tradingpostliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
trinityspiritsandwine.com trinityspiritsandwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
bethanydiscountliquor.com bethanydiscountliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
biggameliquors.com biggameliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
bigliquorwestminster.com bigliquorwestminster.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
bottlecapps.com urbanwineshop.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
bishopswineandspirits.com bishopswineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 22 days
vikingliquor.com vikingliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
bnnfoodmart.com bnnfoodmart.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
walherbookstore.com walherbookstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
walkerbookstores.com walkerbookstores.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
walnutliquors.com walnutliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
wandwcellars.com wandwcellars.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
boozerusathens.net boozerusathens.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
bottlecapps.com bottleshopathens.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
bottomsupbevs.com bottomsupbevs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
whiskeycentral.com whiskeycentral.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
winebinofokc.com winebinofokc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 28 days
zekesliquor.com zekesliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
ordermate.online us.ordermate.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
cjsliquor.com cjsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
colonialwine.shop colonialwine.shop
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
corknbottlelr.com corknbottlelr.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
bottlecapps.com crazybruces.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
crossroadsar.com crossroadsar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
cubanliquor.com cubanliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 19 days
destinationwineandliquor.com destinationwineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 18 days
bottlecapps.com dixiepackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
dunbarbottling.com dunbarbottling.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
dylansliquor.com dylansliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
eastaveliquor.com eastaveliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
elegantwineandliquors.com elegantwineandliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 17 days
grapevineliquorsnj.com grapevineliquorsnj.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 14 days
highpeakswineandspirits.com highpeakswineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 13 days
hopsscotchvinery.com hopsscotchvinery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
launchcompletelyadvancedthefile.vip launchcompletelyadvancedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchintenselyswiftthefile.vip launchintenselyswiftthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchrenewedintenselythefile.vip launchrenewedintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchswiftintenselythefile.vip launchswiftintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
bottlecapps.com liquorcab.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 21 days
localvinestore.com localvinestore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
loyaltyliquor.com loyaltyliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
mdlwineandspirits.com mdlwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
metcalfdiscountliquor.com metcalfdiscountliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
midnightliquors.com midnightliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
mrliquor3.com mrliquor3.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
northlakeliquors.com northlakeliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
oldbridgeliquors.com oldbridgeliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
onthewaypackage.com onthewaypackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 4 days
ostliquorstore.com ostliquorstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
alcoholdelivery.com pacific.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 24 days
partytimerome.com partytimerome.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 33 days
peacockwineandspirits.com peacockwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
presswhore.com presswhore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 34 days
prestobeer.com prestobeer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
rallyliquor.com rallyliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 36 days
SAFFRONROSEGOLD.COM
Non IP Attributes
Attribute First Last
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022
GTM GTM-UA-171061286-1 Dec 2021 Dec 2021
GTM GTM-PKD5TZ Mar 2022 Mar 2022
SAFFRONROSEGOLD.COM
Overlap Attribute Domains
saffronrosegold.com saffronrosegold.com
launchintenselyquickthefile.vip launchintenselyquickthefile.vip
launchprogressiveintenselythefile.vip launchprogressiveintenselythefile.vip
launchrefinedintenselythefile.vip launchrefinedintenselythefile.vip
liquordepotdixie.com liquordepotdixie.com
liquorjunction.com liquorjunction.com
liquorstorevegas.com liquorstorevegas.com
luluislandliquor.com luluislandliquor.com
manhattanliquorsfl.com manhattanliquorsfl.com
mybelairliquors.com mybelairliquors.com
newaceliquor.com newaceliquor.com
nitro2gobev.com nitro2gobev.com
oldmiltonbeverages.com oldmiltonbeverages.com
ordn.in ordn.in
ostliquorstore.net ostliquorstore.net
peavinewineandspirit.com peavinewineandspirit.com
perrysstores.com perrysstores.com
planetofwine.com planetofwine.com
proofsomerville.com proofsomerville.com
renaissancelongmont.com renaissancelongmont.com
rootsbeerdistributor.com rootsbeerdistributor.com
royalliquorstore.com royalliquorstore.com
shop.gemcityws.com shop.gemcityws.com
shoreviewliquors.com shoreviewliquors.com
siennawine.com siennawine.com
americanspiritsaddison.com americanspiritsaddison.com
sonsonliquor.com sonsonliquor.com
springsliquor.com springsliquor.com
ssliquors.com ssliquors.com
steinsandvines.com steinsandvines.com
surfliquorsnj.com surfliquorsnj.com
suwaneetopshelf.com suwaneetopshelf.com
sweetwaterpackagestore.com sweetwaterpackagestore.com
antonswineandliquor.com antonswineandliquor.com
tampaliquorz.com tampaliquorz.com
thespiritshop.org thespiritshop.org
barnbottleshop.com barnbottleshop.com
topshelfwinespiritlv.com topshelfwinespiritlv.com
beera2.com beera2.com
beerworldpa.com beerworldpa.com
treecitywine.com treecitywine.com
berwickbeverage.com berwickbeverage.com
tupelowine.com tupelowine.com
turtlecreekwineandspirits.com turtlecreekwineandspirits.com
unifi2.helloit.tech unifi2.helloit.tech
bimspackage.bottlecapps.com bimspackage.bottlecapps.com
ustopliquor.com ustopliquor.com
vernsliquor.com vernsliquor.com
villagewineathens.com villagewineathens.com
vineyardliquors.com vineyardliquors.com
vipliquoratl.com vipliquoratl.com
warehouseliquorlr.com warehouseliquorlr.com
boozerusathens.com boozerusathens.com
bottlesbeverage.bottlecapps.com bottlesbeverage.bottlecapps.com
bradyswine.com bradyswine.com
wedeliverstores.com wedeliverstores.com
westvail.com westvail.com
wlemporium.com wlemporium.com
worldbeverage400orders.com worldbeverage400orders.com
cabsandcrafts.com cabsandcrafts.com
calhounliquor.com calhounliquor.com
canalsofglassboro.com canalsofglassboro.com
candcliquorfortcollins.com candcliquorfortcollins.com
yahotties.com yahotties.com
cavediverssouth.com cavediverssouth.com
cellarsliquor.com cellarsliquor.com
chartertextbook.com chartertextbook.com
chartertextbooks.com chartertextbooks.com
clocktowermn.com clocktowermn.com
cornhuskerbeverage.bottlecapps.com cornhuskerbeverage.bottlecapps.com
cpsliquor.com cpsliquor.com
creeksidebeer.com creeksidebeer.com
davidsonsliquors.com davidsonsliquors.com
dekalbbottlehouse.bottlecapps.com dekalbbottlehouse.bottlecapps.com
dialiquorwarehouse.com dialiquorwarehouse.com
dorrsliquormart.com dorrsliquormart.com
fultonstreetliquor.com fultonstreetliquor.com
gomesliquors.com gomesliquors.com
grapeleafstore.com grapeleafstore.com
harvestliquors.com harvestliquors.com
heritagemhk.com heritagemhk.com
highspirits.bottlecapps.com highspirits.bottlecapps.com
hopsgrainandvine.com hopsgrainandvine.com
houseofkindredspiritsandwine.com houseofkindredspiritsandwine.com
ingloriouscaskers.com ingloriouscaskers.com
instantliquor.com instantliquor.com
int.ordermate.online int.ordermate.online
jaxspirits.com jaxspirits.com
kilroyspackage.bottlecapps.com kilroyspackage.bottlecapps.com
ihg-desktop-prod.iseatz.com ihg-desktop-prod.iseatz.com
kaplanindex.com kaplanindex.com
kedronworldofbeverage.bottlecapps.com kedronworldofbeverage.bottlecapps.com
launchdevelopedintenselythefile.vip launchdevelopedintenselythefile.vip
launchfreemostthefile.vip launchfreemostthefile.vip
launchintenselyrefinedthefile.vip launchintenselyrefinedthefile.vip
launchintenselysophisticatedthefile.vip launchintenselysophisticatedthefile.vip
launchmostfreethefile.vip launchmostfreethefile.vip
launchrenewedmostthefile.vip launchrenewedmostthefile.vip
ledgebrookspiritshop.bottlecapps.com ledgebrookspiritshop.bottlecapps.com
leisers.com leisers.com
liquorbarnvaldosta.com liquorbarnvaldosta.com
liquorcity.com liquorcity.com
liquorland.us liquorland.us
liquorlockerclub.com liquorlockerclub.com
liquorloftvaldosta.net liquorloftvaldosta.net
liquornwine.com liquornwine.com
liquorplus.net liquorplus.net
liquorwfl.com liquorwfl.com
loadingdockliquors.com loadingdockliquors.com
luckysliquorfl.com luckysliquorfl.com
macadoodles.bottlecapps.com macadoodles.bottlecapps.com
mcswineandliquors.com mcswineandliquors.com
megaliquorandsmoke.com megaliquorandsmoke.com
metroliquorstore.online metroliquorstore.online
midtownwinemerchants.com midtownwinemerchants.com
mrwineandliquor.com mrwineandliquor.com
muncieliquors.bottlecapps.com muncieliquors.bottlecapps.com
myredcarpetliquors.com myredcarpetliquors.com
namewhale.co namewhale.co
noblewineandspirts.bottlecapps.com noblewineandspirts.bottlecapps.com
outletliquorga.com outletliquorga.com
redrunliquors.com redrunliquors.com
parkmobileusa.com parkmobileusa.com
paulsfinewineandspirits.com paulsfinewineandspirits.com
regalwineliquor.com regalwineliquor.com
peachtreeliquor.com peachtreeliquor.com
pentictonliquor.com pentictonliquor.com
plazapackage.com plazapackage.com
pyramidfinewine.com pyramidfinewine.com
abcpackage.com abcpackage.com
roosterspackage.com roosterspackage.com
admicrotek.com admicrotek.com
armadilloliquor.com armadilloliquor.com
alsbdl.com alsbdl.com
shop.cornersfinewineandspirits.com shop.cornersfinewineandspirits.com
shop.pinawineandspirits.com shop.pinawineandspirits.com
shop.fivepointsbottleshop.com shop.fivepointsbottleshop.com
shopatlanticwineandspirits.com shopatlanticwineandspirits.com
shopdlg.com shopdlg.com
shopmoransliquor.com shopmoransliquor.com
starpackageonline.com starpackageonline.com
107liquor.com 107liquor.com
124package.com 124package.com
abliquor2.com abliquor2.com
suwaneetopshelfbeverage.com suwaneetopshelfbeverage.com
aspen-liquor.com aspen-liquor.com
taliquorokc.com taliquorokc.com
texascheerliquor.com texascheerliquor.com
thecellarbcs.com thecellarbcs.com
thejugliquors.com thejugliquors.com
batch13wines.com batch13wines.com
bearvalleyliquors.com bearvalleyliquors.com
beverageworldpackage.bottlecapps.com beverageworldpackage.bottlecapps.com
bigred-liquor.com bigred-liquor.com
warehousewineliquor.com warehousewineliquor.com
watchguardone.com watchguardone.com
boulevardnlr.com boulevardnlr.com
westvail.net westvail.net
brother-liquors.com brother-liquors.com
bsws.shop bsws.shop
buddysbooze.com buddysbooze.com
butlerswineandspirits.com butlerswineandspirits.com
campuswineandspirit.com campuswineandspirit.com
capitalwineandliquor.com capitalwineandliquor.com
yesdrink.com yesdrink.com
chieftainliquors.com chieftainliquors.com
cityliquorsdyersburg.com cityliquorsdyersburg.com
colonial-liquors.com colonial-liquors.com
columbusbeverage.com columbusbeverage.com
consumersdiscountwine.com consumersdiscountwine.com
desotoliquor.com desotoliquor.com
dev.tudo.enovar.solutions dev.tudo.enovar.solutions
dixiebeverageliquor.com dixiebeverageliquor.com
drinksonustx.com drinksonustx.com
drugcityliquors.com drugcityliquors.com
eastsidewineandspirits.com eastsidewineandspirits.com
finewineseb.com finewineseb.com
freemansliquormart.com freemansliquormart.com
gibbysbottleshop.com gibbysbottleshop.com
goodspiritsliquor.com goodspiritsliquor.com
goodtimeswsb.com goodtimeswsb.com
greatwinesmemphis.com greatwinesmemphis.com
greens.bottlecapps.com greens.bottlecapps.com
gtownwine.com gtownwine.com
helencellar.com helencellar.com
houseofambrosestore.com houseofambrosestore.com
hovercrossingwinespirits.com hovercrossingwinespirits.com
jayveeliquors.com jayveeliquors.com
jdsliquortown.com jdsliquortown.com
royalbluepackage.com royalbluepackage.com
savemoremrkt.com savemoremrkt.com
sharpstownliquor.com sharpstownliquor.com
shellliquors.com shellliquors.com
shop.liquor.studio shop.liquor.studio
shop.northstarliquorsuperstore.com shop.northstarliquorsuperstore.com
shopmidwayliquors.com shopmidwayliquors.com
shopmikeskc.com shopmikeskc.com
shoresliquor.com shoresliquor.com
amherstwine.com amherstwine.com
skylinebroadway.com skylinebroadway.com
anjoliquors.com anjoliquors.com
angkorwine.com angkorwine.com
spadesliquor.com spadesliquor.com
spiritsofnatchez.com spiritsofnatchez.com
sportsmanliquor.com sportsmanliquor.com
spotfire.gryphonog.com spotfire.gryphonog.com
adams-liquor.com adams-liquor.com
airportdiscountws.com airportdiscountws.com
swigthis.com swigthis.com
taskersbeerbarn.com taskersbeerbarn.com
terraceliquordepot.com terraceliquordepot.com
thecellars.com thecellars.com
theliquorstore5.com theliquorstore5.com
theridgewineandspirits.com theridgewineandspirits.com
timberlanewine.com timberlanewine.com
bartowliquors.com bartowliquors.com
topshelfmilton.com topshelfmilton.com
beerwineworld.com beerwineworld.com
travisheightswine.com travisheightswine.com
tykesliquor.com tykesliquor.com
beveragecity2.com beveragecity2.com
bigsspiritsandwine.shop bigsspiritsandwine.shop
usabevco.com usabevco.com
usatest.ordermate.online usatest.ordermate.online
warehousepackage.com warehousepackage.com
bottlehousect.com bottlehousect.com
boulevardwine.com boulevardwine.com
bradyswinewarehouse.com bradyswinewarehouse.com
weststwine.com weststwine.com
widgets.squerb.com widgets.squerb.com
wildduckboston.com wildduckboston.com
burlingameliquors.com burlingameliquors.com
xpressliquor.net xpressliquor.net
captainjacksbev.com captainjacksbev.com
cellarnorman.com cellarnorman.com
zeesdws.com zeesdws.com
central.alcoholdelivery.com central.alcoholdelivery.com
client.readportal.info client.readportal.info
colmarbeerstore.com colmarbeerstore.com
corkrunner.com corkrunner.com
crestliquors.com crestliquors.com
decatur.bottlecapps.com decatur.bottlecapps.com
deepdiscounttulsa.com deepdiscounttulsa.com
drinktuscany.com drinktuscany.com
eastern.alcoholdelivery.com eastern.alcoholdelivery.com
edwinswine.com edwinswine.com
elitebeverages.net elitebeverages.net
foremostlakeview.com foremostlakeview.com
fredsavalonliquors.com fredsavalonliquors.com
fridgeliquormhk.com fridgeliquormhk.com
gomers.bottlecapps.com gomers.bottlecapps.com
imgans.com imgans.com
jcwob.com jcwob.com
jerrysimcoebeverage.com jerrysimcoebeverage.com
jimmysliquorstore.com jimmysliquorstore.com
kenyonsmarket.com kenyonsmarket.com
kwikandconvenient.com kwikandconvenient.com
launchintenselydevelopedthefile.vip launchintenselydevelopedthefile.vip
launchintenselyrenewedthefile.vip launchintenselyrenewedthefile.vip
liquorexpressathens.com liquorexpressathens.com
liquorstopfountain.com liquorstopfountain.com
maplewoodwineliquor.com maplewoodwineliquor.com
maxsliquors.com maxsliquors.com
megapackagestore.bottlecapps.com megapackagestore.bottlecapps.com
meritfinewines.com meritfinewines.com
mountain.alcoholdelivery.com mountain.alcoholdelivery.com
napavalleybeverageco.com napavalleybeverageco.com
northridgeliquor.com northridgeliquor.com
orderonline.hopcitybeer.com orderonline.hopcitybeer.com
outerbridgeliquor.com outerbridgeliquor.com
overstreetmarket.com overstreetmarket.com
oxfordws.com oxfordws.com
paidup.com paidup.com
palmwinespirits.com palmwinespirits.com
paradisecoveliquor.com paradisecoveliquor.com
rickersbeerandwine.com rickersbeerandwine.com
pearlandfinewineandspirits.com pearlandfinewineandspirits.com
platinumbws.com platinumbws.com
popatopwine.com popatopwine.com
poplarwine-spirits.com poplarwine-spirits.com
ihg.iseatz.com ihg.iseatz.com
royalatlanticwines.com royalatlanticwines.com
rumsonwineandspirits.com rumsonwineandspirits.com
scottsmarket.com scottsmarket.com
shop.brownbagliquor.com shop.brownbagliquor.com
shop.alcoholdelivery.com shop.alcoholdelivery.com
shopbarnesliquor.com shopbarnesliquor.com
shopbottlestexas.com shopbottlestexas.com
shopliquorlineup.com shopliquorlineup.com
sigmanbottle.com sigmanbottle.com
snappiesips.com snappiesips.com
southsideliquor.net southsideliquor.net
southacademyliquormart.com southacademyliquormart.com
andreasgrosphotography.com andreasgrosphotography.com
spankysliquor.com spankysliquor.com
spacitywine.com spacitywine.com
spiritofharwichport.bottlecapps.com spiritofharwichport.bottlecapps.com
squerb-staging.com squerb-staging.com
starliquorsbottlecapps.net starliquorsbottlecapps.net
starwestbankliquor.com starwestbankliquor.com
stockbridgebottle.bottlecapps.com stockbridgebottle.bottlecapps.com
streamwoodliquor.com streamwoodliquor.com
superiorliquor.bottlecapps.com superiorliquor.bottlecapps.com
swliquors.com swliquors.com
taphouseliquor.com taphouseliquor.com
auth.squerb.com auth.squerb.com
thebottleshoppememphis.com thebottleshoppememphis.com
thevineyard.com thevineyard.com
batavialiquorwine.com batavialiquorwine.com
tradingpostliquor.com tradingpostliquor.com
trinityspiritsandwine.com trinityspiritsandwine.com
bethanydiscountliquor.com bethanydiscountliquor.com
biggameliquors.com biggameliquors.com
bigliquorwestminster.com bigliquorwestminster.com
urbanwineshop.bottlecapps.com urbanwineshop.bottlecapps.com
bishopswineandspirits.com bishopswineandspirits.com
vikingliquor.com vikingliquor.com
bnnfoodmart.com bnnfoodmart.com
walherbookstore.com walherbookstore.com
walkerbookstores.com walkerbookstores.com
walnutliquors.com walnutliquors.com
wandwcellars.com wandwcellars.com
boozerusathens.net boozerusathens.net
bottleshopathens.bottlecapps.com bottleshopathens.bottlecapps.com
bottomsupbevs.com bottomsupbevs.com
whiskeycentral.com whiskeycentral.com
winebinofokc.com winebinofokc.com
zekesliquor.com zekesliquor.com
us.ordermate.online us.ordermate.online
cjsliquor.com cjsliquor.com
colonialwine.shop colonialwine.shop
corknbottlelr.com corknbottlelr.com
crazybruces.bottlecapps.com crazybruces.bottlecapps.com
crossroadsar.com crossroadsar.com
cubanliquor.com cubanliquor.com
destinationwineandliquor.com destinationwineandliquor.com
dixiepackage.bottlecapps.com dixiepackage.bottlecapps.com
dunbarbottling.com dunbarbottling.com
dylansliquor.com dylansliquor.com
eastaveliquor.com eastaveliquor.com
elegantwineandliquors.com elegantwineandliquors.com
grapevineliquorsnj.com grapevineliquorsnj.com
highpeakswineandspirits.com highpeakswineandspirits.com
hopsscotchvinery.com hopsscotchvinery.com
launchcompletelyadvancedthefile.vip launchcompletelyadvancedthefile.vip
launchintenselyswiftthefile.vip launchintenselyswiftthefile.vip
launchrenewedintenselythefile.vip launchrenewedintenselythefile.vip
launchswiftintenselythefile.vip launchswiftintenselythefile.vip
liquorcab.bottlecapps.com liquorcab.bottlecapps.com
localvinestore.com localvinestore.com
loyaltyliquor.com loyaltyliquor.com
mdlwineandspirits.com mdlwineandspirits.com
metcalfdiscountliquor.com metcalfdiscountliquor.com
midnightliquors.com midnightliquors.com
mrliquor3.com mrliquor3.com
northlakeliquors.com northlakeliquors.com
oldbridgeliquors.com oldbridgeliquors.com
onthewaypackage.com onthewaypackage.com
ostliquorstore.com ostliquorstore.com
pacific.alcoholdelivery.com pacific.alcoholdelivery.com
partytimerome.com partytimerome.com
peacockwineandspirits.com peacockwineandspirits.com
presswhore.com presswhore.com
prestobeer.com prestobeer.com
rallyliquor.com rallyliquor.com
SAFFRONROSEGOLD.COM
IP History

Click the IP addresses to see over domains using them.