TUPELOWINE.COM
Shared Attributes
Domain
liquordepotdixie.com liquordepotdixie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jun 2022 309 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
liquorjunction.com liquorjunction.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
luluislandliquor.com luluislandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Jan 2022 108 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 86 days
manhattanliquorsfl.com manhattanliquorsfl.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 57 days
UA UA-137994865 Nov 2021 Nov 2021 One Off
manorvilleliquor.com manorvilleliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 321 days
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
mybelairliquors.com mybelairliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
UA UA-137994865 Jul 2021 Aug 2021 17 days
newaceliquor.com newaceliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 193 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 97 days
nitro2gobev.com nitro2gobev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Apr 2023 1 year, 148 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 98 days
oldmiltonbeverages.com oldmiltonbeverages.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 203 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 98 days
peavinewineandspirit.com peavinewineandspirit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jan 2022 Apr 2023 1 year, 97 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 81 days
perrysstores.com perrysstores.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
planetofwine.com planetofwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2022 1 year, 47 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
renaissancelongmont.com renaissancelongmont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 315 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 73 days
rootsbeerdistributor.com rootsbeerdistributor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2022 1 year, 49 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 102 days
royalliquorstore.com royalliquorstore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2022 1 year, 91 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 102 days
gemcityws.com shop.gemcityws.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 93 days
shoreviewliquors.com shoreviewliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
americanspiritsaddison.com americanspiritsaddison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 140 days
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 35 days
sonsonliquor.com sonsonliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 261 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
spsliquor.com spsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 307 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 73 days
ssliquors.com ssliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
steinsandvines.com steinsandvines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 105 days
UA UA-137994865 Oct 2021 Dec 2021 52 days
suwaneetopshelf.com suwaneetopshelf.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 67 days
UA UA-137994865 Jul 2022 Jul 2022 One Off
sweetwaterpackagestore.com sweetwaterpackagestore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 263 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 67 days
antonswineandliquor.com antonswineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 126 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
tampaliquorz.com tampaliquorz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 263 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 105 days
thespiritshop.org thespiritshop.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2022 1 year, 55 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 68 days
barnbottleshop.com barnbottleshop.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 100 days
topshelfwinespiritlv.com topshelfwinespiritlv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2023 1 year, 175 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 69 days
beera2.com beera2.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2022 1 year, 22 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
beerworldpa.com beerworldpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Oct 2022 288 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
treecitywine.com treecitywine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 265 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
tsliquor.ca tsliquor.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 73 days
berwickbeverage.com berwickbeverage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
UA UA-137994865 May 2022 May 2022 One Off
turtlecreekwineandspirits.com turtlecreekwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
bigbearsliquor.com bigbearsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Feb 2023 219 days
GTM GTM-MMNJXZ8 Apr 2022 May 2022 29 days
bottlecapps.com bimspackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Dec 2021 128 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 100 days
ustopliquor.com ustopliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 134 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
vernsliquor.com vernsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 347 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
villagewineathens.com villagewineathens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
vipliquoratl.com vipliquoratl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
warehouseliquorlr.com warehouseliquorlr.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2022 1 year, 58 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
boozerusathens.com boozerusathens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
bottlecapps.com bottlesbeverage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 352 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
wedeliverstores.com wedeliverstores.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2022 1 year, 139 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
westvail.com westvail.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Nov 2022 1 year, 17 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
wlemporium.com wlemporium.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
worldbeverage400orders.com worldbeverage400orders.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
cabsandcrafts.com cabsandcrafts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 May 2022 295 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
calhounliquor.com calhounliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Mar 2023 1 year, 236 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 98 days
canalsofglassboro.com canalsofglassboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
yahotties.com yahotties.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 35 days
UA UA-137994865 Dec 2021 Dec 2021 One Off
cavediverssouth.com cavediverssouth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
cellarsliquor.com cellarsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
charlestownliquorsma.com charlestownliquorsma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Mar 2023 270 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 63 days
clocktowermn.com clocktowermn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
connectedbottleshop.com connectedbottleshop.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
bottlecapps.com cornhuskerbeverage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
cpsliquor.com cpsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 147 days
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 35 days
davidsonpackagestore.com davidsonpackagestore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Dec 2022 162 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 62 days
davidsonsliquors.com davidsonsliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Feb 2023 1 year, 192 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
bottlecapps.com dekalbbottlehouse.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
dialiquorwarehouse.com dialiquorwarehouse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
dorrsliquormart.com dorrsliquormart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Dec 2021 120 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
fultonstreetliquor.com fultonstreetliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2022 1 year, 33 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 72 days
gomesliquors.com gomesliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Apr 2023 1 year, 226 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
grapeleafstore.com grapeleafstore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
harvestliquors.com harvestliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
heritagemhk.com heritagemhk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
bottlecapps.com highspirits.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2022 156 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
hopsgrainandvine.com hopsgrainandvine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 89 days
ingloriouscaskers.com ingloriouscaskers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Apr 2023 1 year, 158 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 90 days
instantliquor.com instantliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 91 days
jaxspirits.com jaxspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 325 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 91 days
jerrysliquortx.com jerrysliquortx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Apr 2022 37 days
UA UA-137994865 Jun 2022 Jul 2022 33 days
bottlecapps.com kilroyspackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 143 days
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 34 days
bottlecapps.com kedronworldofbeverage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Dec 2021 127 days
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 34 days
kellylroy.com kellylroy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
UA UA-137994865 Jun 2022 Jun 2022 One Off
lalaliquor.com lalaliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 323 days
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
leisers.com leisers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
liquorbarnvaldosta.com liquorbarnvaldosta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2023 1 year, 161 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
liquorcity.com liquorcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
liquorland.us liquorland.us
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 74 days
liquorloftvaldosta.net liquorloftvaldosta.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2023 1 year, 161 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
liquornwine.com liquornwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
liquorplus.net liquorplus.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
UA UA-137994865 Aug 2021 Aug 2021 One Off
liquorwfl.com liquorwfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2022 1 year, 41 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
loadingdockliquors.com loadingdockliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
luckysliquorfl.com luckysliquorfl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2021 114 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 95 days
lukesliquors.com lukesliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Oct 2022 139 days
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
bottlecapps.com macadoodles.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Mar 2023 1 year, 234 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
mcswineandliquors.com mcswineandliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jan 2022 Apr 2023 1 year, 102 days
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 35 days
megaliquorandsmoke.com megaliquorandsmoke.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
metroliquorstore.online metroliquorstore.online
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Apr 2023 1 year, 206 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 96 days
midtownwinemerchants.com midtownwinemerchants.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 96 days
montecristospirits.com montecristospirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 320 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 39 days
mrwineandliquor.com mrwineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 97 days
bottlecapps.com muncieliquors.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2022 1 year, 147 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
myredcarpetliquors.com myredcarpetliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2022 1 year, 44 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 97 days
bottlecapps.com noblewineandspirts.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
outletliquorga.com outletliquorga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
redrunliquors.com redrunliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 101 days
paulsfinewineandspirits.com paulsfinewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 202 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
regalwineliquor.com regalwineliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 198 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 101 days
peachtreeliquor.com peachtreeliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2021 121 days
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 61 days
pentictonliquor.com pentictonliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 202 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 81 days
pyramidfinewine.com pyramidfinewine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Apr 2023 1 year, 144 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 101 days
roosterspackage.com roosterspackage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 64 days
admicrotek.com admicrotek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 139 days
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
armadilloliquor.com armadilloliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Jan 2023 1 year, 171 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
alsbdl.com alsbdl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 140 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
shooterspg.com shooterspg.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 May 2022 77 days
UA UA-137994865 Dec 2021 Jan 2022 47 days
cornersfinewineandspirits.com shop.cornersfinewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Apr 2023 1 year, 241 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
pinawineandspirits.com shop.pinawineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Jan 2023 1 year, 45 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
fivepointsbottleshop.com shop.fivepointsbottleshop.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 72 days
shopatlanticwineandspirits.com shopatlanticwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 261 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 66 days
shopdlg.com shopdlg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
shopmoransliquor.com shopmoransliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
UA UA-137994865 Jul 2021 Sep 2021 38 days
starpackageonline.com starpackageonline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 128 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
107liquor.com 107liquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 69 days
UA UA-137994865 Oct 2021 Dec 2021 50 days
abliquor2.com abliquor2.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 138 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
aspen-liquor.com aspen-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
taliquorokc.com taliquorokc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 263 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 67 days
texascheerliquor.com texascheerliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Apr 2023 1 year, 196 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
thebeverageshoppe.com thebeverageshoppe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 May 2022 Mar 2023 299 days
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
thecellarbcs.com thecellarbcs.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 186 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
thejugliquors.com thejugliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 308 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
batch13wines.com batch13wines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
tomarsdiscountliquor.com tomarsdiscountliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 265 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 73 days
bearvalleyliquors.com bearvalleyliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 351 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
bottlecapps.com beverageworldpackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
UA UA-137994865 Oct 2021 Dec 2021 50 days
bigred-liquor.com bigred-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 142 days
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
warehousewineliquor.com warehousewineliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
watchguardone.com watchguardone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Dec 2021 51 days
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
boulevardnlr.com boulevardnlr.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
westvail.net westvail.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2022 1 year, 100 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
brother-liquors.com brother-liquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Apr 2023 1 year, 250 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
bsws.shop bsws.shop
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 76 days
buddysbooze.com buddysbooze.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Apr 2023 1 year, 250 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
butlerswineandspirits.com butlerswineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
campuswineandspirit.com campuswineandspirit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Aug 2022 1 year, 7 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
capitalwineandliquor.com capitalwineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
yesdrink.com yesdrink.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 181 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
chieftainliquors.com chieftainliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 98 days
cityliquorsdyersburg.com cityliquorsdyersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Apr 2023 1 year, 244 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
colonial-liquors.com colonial-liquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2022 1 year, 149 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
columbusbeverage.com columbusbeverage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Apr 2023 1 year, 170 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
consumersdiscountwine.com consumersdiscountwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 147 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
desotoliquor.com desotoliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Apr 2023 1 year, 238 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
enovar.solutions dev.tudo.enovar.solutions
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2022 Mar 2023 127 days
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
dixiebeverageliquor.com dixiebeverageliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Apr 2023 1 year, 168 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
drugcityliquors.com drugcityliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
eastsidewineandspirits.com eastsidewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
finewineseb.com finewineseb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 72 days
freemansliquormart.com freemansliquormart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2022 1 year, 116 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 72 days
gibbysbottleshop.com gibbysbottleshop.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 357 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
bottlecapps.com greens.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
houseofambrosestore.com houseofambrosestore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 245 days
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 52 days
hovercrossingwinespirits.com hovercrossingwinespirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 89 days
jayveeliquors.com jayveeliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Jan 2023 1 year, 109 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 91 days
jdsliquortown.com jdsliquortown.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 18 days
UA UA-137994865 Nov 2021 Nov 2021 One Off
royalbluepackage.com royalbluepackage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 196 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 102 days
savemoremrkt.com savemoremrkt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 141 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
sharpstownliquor.com sharpstownliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 194 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
shellliquors.com shellliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Dec 2021 54 days
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 30 days
liquor.studio shop.liquor.studio
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Apr 2023 267 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
northstarliquorsuperstore.com shop.northstarliquorsuperstore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Jul 2022 279 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 98 days
shopmidwayliquors.com shopmidwayliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 126 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 66 days
shopmikeskc.com shopmikeskc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
shopstocktonfinewines.com shopstocktonfinewines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2022 1 year, 7 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 73 days
shoresliquor.com shoresliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2022 1 year, 133 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
amherstwine.com amherstwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
skylinebroadway.com skylinebroadway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
angel-liquor.com angel-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2022 1 year, 143 days
GTM GTM-MMNJXZ8 Mar 2022 Apr 2022 35 days
angkorwine.com angkorwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 102 days
spadesliquor.com spadesliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 40 days
UA UA-137994865 Oct 2021 Oct 2021 One Off
spiritsofnatchez.com spiritsofnatchez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 187 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
sportsmanliquor.com sportsmanliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 128 days
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
gryphonog.com spotfire.gryphonog.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
UA UA-137994865 Jan 2022 Jan 2022 One Off
adams-liquor.com adams-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Mar 2023 1 year, 230 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
airportdiscountws.com airportdiscountws.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 69 days
swigthis.com swigthis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 105 days
taskersbeerbarn.com taskersbeerbarn.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 105 days
UA UA-137994865 Dec 2021 Dec 2021 One Off
terraceliquordepot.com terraceliquordepot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
thecellars.com thecellars.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2022 1 year, 9 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
theridgewineandspirits.com theridgewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 265 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
timberlanewine.com timberlanewine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 186 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 68 days
bartowliquors.com bartowliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2022 1 year, 106 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
topshelfmilton.com topshelfmilton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 131 days
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 33 days
beerwineworld.com beerwineworld.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
travisheightswine.com travisheightswine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2021 50 days
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
tykesliquor.com tykesliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 69 days
beveragecity2.com beveragecity2.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2022 1 year, 22 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
bigsspiritsandwine.shop bigsspiritsandwine.shop
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 142 days
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
unionwineandliquor.com unionwineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Aug 2022 53 days
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
usabevco.com usabevco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
warehousepackage.com warehousepackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 69 days
UA UA-137994865 Jul 2021 Aug 2021 1 day
bottlehousect.com bottlehousect.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Dec 2021 127 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
boulevardwine.com boulevardwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 143 days
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 34 days
weststwine.com weststwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 183 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
wildduckboston.com wildduckboston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
burlingameliquors.com burlingameliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 144 days
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
candcliquor.com candcliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 299 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 64 days
xpressliquor.net xpressliquor.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 135 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
captainjacksbev.com captainjacksbev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 144 days
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
cellarnorman.com cellarnorman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2022 1 year, 109 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 98 days
zeesdws.com zeesdws.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jun 2022 325 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 69 days
alcoholdelivery.com central.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 139 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
colmarbeerstore.com colmarbeerstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 May 2022 97 days
UA UA-137994865 Dec 2021 Dec 2021 One Off
corkrunner.com corkrunner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
crestliquors.com crestliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Apr 2023 1 year, 169 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 97 days
bottlecapps.com decatur.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
deepdiscounttulsa.com deepdiscounttulsa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2022 1 year, 70 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
alcoholdelivery.com eastern.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 139 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
edwinswine.com edwinswine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 151 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 95 days
elitebeverages.net elitebeverages.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 354 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 72 days
everestliquoraustintx.com everestliquoraustintx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 May 2022 Feb 2023 257 days
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
ezpackagestore.com ezpackagestore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 May 2022 Apr 2023 330 days
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
foremostlakeview.com foremostlakeview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2022 1 year, 73 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 72 days
fredsavalonliquors.com fredsavalonliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 153 days
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
fridgeliquormhk.com fridgeliquormhk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2021 103 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 72 days
friendlyfrankiesbottleshop.com friendlyfrankiesbottleshop.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2022 154 days
GTM GTM-MMNJXZ8 Mar 2022 Apr 2022 37 days
bottlecapps.com gomers.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 143 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
jcwob.com jcwob.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Apr 2023 208 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
jerrysimcoebeverage.com jerrysimcoebeverage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Apr 2023 1 year, 217 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 91 days
jimmysliquorstore.com jimmysliquorstore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 339 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 92 days
justsignal.com justsignal.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
UA UA-137994865 Jun 2022 Jun 2022 One Off
kenyonsmarket.com kenyonsmarket.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 93 days
kwikandconvenient.com kwikandconvenient.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Apr 2023 1 year, 214 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 93 days
liquorexpressathens.com liquorexpressathens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
liquorstopfountain.com liquorstopfountain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
maplewoodwineliquor.com maplewoodwineliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 95 days
maxsliquors.com maxsliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2023 1 year, 162 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 95 days
mcaloons-liquors.com mcaloons-liquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Feb 2023 258 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 39 days
bottlecapps.com megapackagestore.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Apr 2023 1 year, 250 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
meritfinewines.com meritfinewines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2021 115 days
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 57 days
midwest-wine.com midwest-wine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 38 days
alcoholdelivery.com mountain.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 139 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
napavalleybeverageco.com napavalleybeverageco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 204 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 97 days
northridgeliquor.com northridgeliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 342 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 98 days
outerbridgeliquor.com outerbridgeliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
oxfordws.com oxfordws.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2023 1 year, 166 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
partybeverage.net partybeverage.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2022 Apr 2023 178 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 46 days
rickersbeerandwine.com rickersbeerandwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 102 days
pearlandfinewineandspirits.com pearlandfinewineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2023 1 year, 166 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
rightturnliquors.com rightturnliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 307 days
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
platinumbws.com platinumbws.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 316 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 72 days
popatopwine.com popatopwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2022 1 year, 89 days
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 62 days
purdyswine.com purdyswine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 315 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 45 days
royalatlanticwines.com royalatlanticwines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 102 days
rumsonwineandspirits.com rumsonwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 102 days
scottsmarket.com scottsmarket.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
brownbagliquor.com shop.brownbagliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
alcoholdelivery.com shop.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2022 177 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
shopbottlestexas.com shopbottlestexas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 261 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
shopliquorlineup.com shopliquorlineup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
shopthecork.com shopthecork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Apr 2023 259 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 73 days
sigmanbottle.com sigmanbottle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 126 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
southsideliquor.net southsideliquor.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 186 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
southacademyliquormart.com southacademyliquormart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Feb 2023 1 year, 194 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
spankysliquor.com spankysliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Nov 2022 1 year, 19 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
spacitywine.com spacitywine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2023 1 year, 171 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
bottlecapps.com spiritofharwichport.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 143 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
starwestbankliquor.com starwestbankliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 262 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
bottlecapps.com stockbridgebottle.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Mar 2023 1 year, 234 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 105 days
streamwoodliquor.com streamwoodliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2022 1 year, 106 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
bottlecapps.com superiorliquor.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Mar 2023 1 year, 218 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
swliquors.com swliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 137 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 105 days
taphouseliquor.com taphouseliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 263 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 67 days
thebottleshoppememphis.com thebottleshoppememphis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 May 2022 285 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 68 days
batavialiquorwine.com batavialiquorwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Dec 2021 129 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
tradingpostliquor.com tradingpostliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 131 days
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 34 days
bethanydiscountliquor.com bethanydiscountliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2023 1 year, 184 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
unclejackspirits.com unclejackspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 308 days
GTM GTM-MMNJXZ8 Apr 2022 May 2022 38 days
bigliquorwestminster.com bigliquorwestminster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 124 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
bottlecapps.com urbanwineshop.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
bishopswineandspirits.com bishopswineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 123 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
vikingliquor.com vikingliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 308 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
bnnfoodmart.com bnnfoodmart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Mar 2023 1 year, 234 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
walnutliquors.com walnutliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 134 days
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
boozerusathens.net boozerusathens.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jun 2022 331 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
bossliquors.com bossliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 May 2022 Apr 2023 336 days
GTM GTM-MMNJXZ8 Mar 2022 Apr 2022 36 days
bottlecapps.com bottleshopathens.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
bottomsupbevs.com bottomsupbevs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
UA UA-137994865 Dec 2021 Dec 2021 One Off
winebinofokc.com winebinofokc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 132 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
zekesliquor.com zekesliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
UA UA-137994865 Dec 2022 Jan 2023 38 days
cjsliquor.com cjsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
colonialwine.shop colonialwine.shop
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Feb 2023 1 year, 42 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 80 days
corknbottlelr.com corknbottlelr.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 353 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
bottlecapps.com crazybruces.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
crossroadsar.com crossroadsar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
cubanliquor.com cubanliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
destinationwineandliquor.com destinationwineandliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2022 1 year, 70 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
bottlecapps.com dixiepackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 150 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
dunbarbottling.com dunbarbottling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Nov 2022 328 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 95 days
dylansliquor.net dylansliquor.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 115 days
GTM GTM-MMNJXZ8 Mar 2022 May 2022 60 days
eastaveliquor.com eastaveliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
elegantwineandliquors.com elegantwineandliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 35 days
frontierliquors.com frontierliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2022 1 year, 127 days
GTM GTM-MMNJXZ8 Mar 2022 Apr 2022 37 days
highpeakswineandspirits.com highpeakswineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
hopsscotchvinery.com hopsscotchvinery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jul 2022 359 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 89 days
liquidcourage.us liquidcourage.us
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Apr 2023 291 days
GTM GTM-MMNJXZ8 Apr 2022 May 2022 13 days
bottlecapps.com liquorcab.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 143 days
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
liquorcabinetks.com liquorcabinetks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 306 days
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
localvinestore.com localvinestore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 9 days
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
loyaltyliquor.com loyaltyliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 95 days
lukescapecod.com lukescapecod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Apr 2023 291 days
GTM GTM-MMNJXZ8 May 2022 May 2022 12 days
mdlwineandspirits.com mdlwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 96 days
metcalfdiscountliquor.com metcalfdiscountliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
midnightliquors.com midnightliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Apr 2023 1 year, 206 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 96 days
mrliquor3.com mrliquor3.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 97 days
natalie-roy.ws natalie-roy.ws
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 May 2022 38 days
UA UA-137994865 Jun 2022 Jun 2022 One Off
northlakeliquors.com northlakeliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 203 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 98 days
oldbridgeliquors.com oldbridgeliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 98 days
onthewaypackage.com onthewaypackage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 318 days
GTM GTM-MMNJXZ8 Feb 2022 May 2022 73 days
ostliquorstore.com ostliquorstore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2022 1 year, 88 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
alcoholdelivery.com pacific.alcoholdelivery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 139 days
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
partytimerome.com partytimerome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2021 121 days
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
peacockwineandspirits.com peacockwineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 202 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 99 days
prestobeer.com prestobeer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 316 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 100 days
rallyliquor.com rallyliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
GTM GTM-MMNJXZ8 Jan 2022 May 2022 101 days
launchintenselyquickthefile.vip launchintenselyquickthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchprogressiveintenselythefile.vip launchprogressiveintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchrefinedintenselythefile.vip launchrefinedintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
liquorstorevegas.com liquorstorevegas.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 94 days
mkmxprojects.com mkmxprojects.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
ordn.in ordn.in
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
ostliquorstore.net ostliquorstore.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
rcp-ag.com rcp-ag.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
proofsomerville.com proofsomerville.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 62 days
silversaucellc.com silversaucellc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
springsliquor.com springsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
helloit.tech unifi2.helloit.tech
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
vacantexposures.com vacantexposures.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
vacantpropertyhelp.com vacantpropertyhelp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
vineyardliquors.com vineyardliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
bradyswine.com bradyswine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
bottlecapps.com buckheadwineshop.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 May 2022 29 days
candcliquorfortcollins.com candcliquorfortcollins.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 79 days
chartertextbook.com chartertextbook.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 35 days
chartertextbooks.com chartertextbooks.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 35 days
creeksidebeer.com creeksidebeer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
davidandginny.co.uk davidandginny.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
houseofkindredspiritsandwine.com houseofkindredspiritsandwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
ordermate.online int.ordermate.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
lexfides.gt lexfides.gt
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Jun 2022 One Off
iwsbrazil.io livestore-poc.iwsbrazil.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Jul 2022 One Off
max-beverage.com max-beverage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Apr 2023 1 year, 207 days
mktetc.net mktetc.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Nov 2021 56 days
mullingtime.com mullingtime.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Apr 2023 Apr 2023 One Off
nyxtend.com nyxtend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Nov 2021 One Off
pexium-tools.com pexium-tools.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Apr 2023 Apr 2023 9 days
rockhardspirits.com rockhardspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Apr 2023 1 year, 142 days
grapevinewines.com shop.grapevinewines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Apr 2023 Apr 2023 22 days
uclueletliquorstore.ca shop.uclueletliquorstore.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Apr 2023 255 days
sidedoorliquors.com sidedoorliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2021 73 days
siennawine.com siennawine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 126 days
bottlecapps.com 1010wws.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Feb 2023 Feb 2023 One Off
suelivingston.com suelivingston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Apr 2023 Apr 2023 One Off
swsokc.com swsokc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 129 days
tatcan.com tatcan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Oct 2021 One Off
atlpackage.com atlpackage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Apr 2022 Apr 2023 1 year, 11 days
atrmywizard360.com atrmywizard360.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 12 days
beerandbevlancaster.com beerandbevlancaster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2021 92 days
unclejacksspirits.com unclejacksspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 132 days
victorywineliquors.com victorywineliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 1 day
bonzawordpuzzle.com bonzawordpuzzle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Jun 2022 One Off
bradleysliquor.com bradleysliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2021 93 days
westhillsbeer.com westhillsbeer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Nov 2022 331 days
bottlecapps.com westsidebs.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Feb 2023 Apr 2023 80 days
willowgrovebeerstore.com willowgrovebeerstore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2021 Dec 2021 One Off
shopbottles.com buy.shopbottles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 308 days
cheerspackage.com cheerspackage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 20 days
crestviewliquors.com crestviewliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jan 2023 Mar 2023 46 days
39dn.com egis.39dn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 May 2022 May 2022 One Off
fakemytweet.com fakemytweet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Feb 2022 Mar 2022 35 days
friendshipwine.com friendshipwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 May 2022 302 days
igt2000.com igt2000.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2022 Nov 2022 42 days
illuminate.today illuminate.today
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Feb 2023 Apr 2023 68 days
institutoprogetins.net institutoprogetins.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Sep 2021 One Off
bottlecapps.com jcwb.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Nov 2021 One Off
kaplanindex.com kaplanindex.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 19 days
bottlecapps.com kennesawwineliquorbeer.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 May 2022 53 days
launchdevelopedintenselythefile.vip launchdevelopedintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchfreemostthefile.vip launchfreemostthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchintenselyrefinedthefile.vip launchintenselyrefinedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchintenselysophisticatedthefile.vip launchintenselysophisticatedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchmostfreethefile.vip launchmostfreethefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchrenewedmostthefile.vip launchrenewedmostthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
bottlecapps.com ledgebrookspiritshop.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 May 2022 99 days
liquorlockerclub.com liquorlockerclub.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 103 days
michaelkenduck.com michaelkenduck.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
mikekenduck.com mikekenduck.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
mtcaerosystems.com mtcuat-nv-utility.mtcaerosystems.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
namewhale.co namewhale.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
nubohelp.com nubohelp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
nubohelp.net nubohelp.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
parkmobileusa.com parkmobileusa.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
plazapackage.com plazapackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
scopusengenharia.com.br projetos.scopusengenharia.com.br
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
abcpackage.com abcpackage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
saffronrosegold.com saffronrosegold.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 29 days
six-rating.com six-rating.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
124package.com 124package.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 69 days
suwaneetopshelfbeverage.com suwaneetopshelfbeverage.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 42 days
termooriginal.se termooriginal.se
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
tracykenduck.com tracykenduck.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
bigbarrelliquors.com bigbarrelliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Apr 2022 37 days
drinksonustx.com drinksonustx.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 70 days
goodspiritsliquor.com goodspiritsliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
goodtimeswsb.com goodtimeswsb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 81 days
greatwinesmemphis.com greatwinesmemphis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
gtownwine.com gtownwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Mar 2022 42 days
helencellar.com helencellar.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
khaynerphoto.com khaynerphoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Jul 2022 One Off
gtntechsol.com lenoir-rebuildnc.gtntechsol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Sep 2022 One Off
liquorworld.ca liquorworld.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Aug 2022 66 days
lukaskc.com lukaskc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 10 days
gtntechsol.com lumberton-rebuildnc.gtntechsol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Sep 2022 One Off
medianation.ca morreygroup.nissan.medianation.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2022 Mar 2022 One Off
medianation.ca openroad.lexusrx350l.medianation.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2022 Mar 2022 One Off
orbitalinsightt.com orbitalinsightt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Nov 2021 One Off
portofinowinebank.com portofinowinebank.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 266 days
quickstopliquors.com quickstopliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Nov 2021 One Off
alberniliquorstore.ca shop.alberniliquorstore.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Apr 2023 249 days
beveragesuperstoreofgrayson.com shop.beveragesuperstoreofgrayson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 May 2022 Mar 2023 304 days
buckheadwineshop.com shop.buckheadwineshop.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 May 2022 Apr 2023 336 days
liquorworld.ca shop.liquorworld.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Apr 2023 225 days
kennesawwineliquorbeer.com shop.kennesawwineliquorbeer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Apr 2023 292 days
smittys-liquor.com smittys-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 261 days
autopay.com api.autopay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2022 Nov 2022 One Off
asibms.net asibms.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Aug 2022 One Off
tabwareonline.com tablinkclone.tabwareonline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2022 Dec 2022 One Off
gtntechsol.com tarboro-rebuildnc.gtntechsol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Sep 2022 One Off
breezeriteinliquor.com breezeriteinliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Mar 2023 267 days
wildbillspartyshop.com wildbillspartyshop.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 2 days
bottlecapps.com cellardoor.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2023 Apr 2023 32 days
dori.io dori.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2023 Apr 2023 26 days
drsordersliquor.com drsordersliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 31 days
ejasupletivo.com.br ejasupletivo.com.br
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Sep 2021 One Off
emeraldip.com emeraldip.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Sep 2021 One Off
farwestliquor.com farwestliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Apr 2023 296 days
follothru.com follothru.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2022 Feb 2023 121 days
kilobit.ch fugue.kilobit.ch
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Apr 2023 Apr 2023 One Off
ginnyswineliquor.com ginnyswineliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2022 155 days
bottlecapps.com guesswho.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Feb 2023 Apr 2023 80 days
bottlecapps.com habersham.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Apr 2023 273 days
healthcareusability.org healthcareusability.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jan 2023 Jan 2023 One Off
jelmd.com jelmd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Jul 2022 One Off
robertburnswines.com robertburnswines.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 May 2022 44 days
allbankhomes.com allbankhomes.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
anjoliquors.com anjoliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 70 days
stockbridgebottleshoppe.com stockbridgebottleshoppe.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 May 2022 75 days
postnetnc103.com store.postnetnc103.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
strategicedgerealty.com strategicedgerealty.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
theliquorstore5.com theliquorstore5.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
theupsstorepitchoff.com theupsstorepitchoff.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
triveniethnics.com triveniethnics.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
ordermate.online usatest.ordermate.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
bradyswinewarehouse.com bradyswinewarehouse.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
squerb.com widgets.squerb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
readportal.info client.readportal.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
drinktuscany.com drinktuscany.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
greenmanmilwich.com greenmanmilwich.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
imgans.com imgans.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 90 days
launchintenselydevelopedthefile.vip launchintenselydevelopedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchintenselyrenewedthefile.vip launchintenselyrenewedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
mgmdigitallibrary.com mgmdigitallibrary.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
hopcitybeer.com orderonline.hopcitybeer.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
overstreetmarket.com overstreetmarket.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 May 2022 81 days
paidup.com paidup.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 26 days
paircoach.com paircoach.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
palmwinespirits.com palmwinespirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
paradisecoveliquor.com paradisecoveliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 May 2022 81 days
parkwaywineliquor.com parkwaywineliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 May 2022 51 days
poplarwine-spirits.com poplarwine-spirits.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 100 days
reidcardwell.net reidcardwell.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jan 2023 Feb 2023 43 days
ryansliquors.com ryansliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 314 days
selvangal.com selvangal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Jun 2022 One Off
arythmies.com arythmies.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2022 Mar 2023 168 days
stoneys-liquor.com stoneys-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 262 days
as3.io aws.as3.io
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Dec 2022 181 days
towncenterwine.com towncenterwine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2021 80 days
gtntechsol.com bertie-rebuildnc.gtntechsol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Sep 2022 One Off
villagewestliquors.com villagewestliquors.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 308 days
boomliquor.com boomliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2021 93 days
bottlecapps.com bootleggerspackage.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Feb 2023 Apr 2023 80 days
whitehorsepapers.net whitehorsepapers.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2023 Apr 2023 43 days
bearcreekspirits.com wholesale.bearcreekspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 300 days
yzliu.com yzliu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Dec 2022 Jan 2023 38 days
gtntechsol.com columbus-rebuildnc.gtntechsol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Sep 2022 One Off
corksandbottles.com corksandbottles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 May 2022 May 2022 One Off
crj200.com crj200.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Aug 2021 One Off
dandyliquor.com dandyliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 27 days
emguarda.com emguarda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Nov 2022 145 days
bottlecapps.com flamingo-liquor.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 May 2022 266 days
goodtechllc.com goodtechllc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Sep 2022 62 days
hilltopchulavista.com hilltopchulavista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Jan 2022 156 days
jollykingfinewines.com jollykingfinewines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Nov 2021 110 days
kimstella.com kimstella.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2022 Sep 2022 43 days
bottlecapps.com monarchliquor.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2023 Apr 2023 32 days
bottlecapps.com nstreet.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2023 Apr 2023 32 days
medianation.ca openroad.lexusis300awd.medianation.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2022 Mar 2022 One Off
shopbarnesliquor.com shopbarnesliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 66 days
skoahjobs.com skoahjobs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
andreasgrosphotography.com andreasgrosphotography.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Jan 2022 One Off
squerb-staging.com squerb-staging.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 41 days
starliquorsbottlecapps.net starliquorsbottlecapps.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 104 days
tamdeen.com.kw tamdeen.com.kw
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
squerb.com auth.squerb.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 31 days
thevineyard.com thevineyard.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 68 days
trinityspiritsandwine.com trinityspiritsandwine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 34 days
biggameliquors.com biggameliquors.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 71 days
vacantexposure.com vacantexposure.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
walherbookstore.com walherbookstore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 35 days
walkerbookstores.com walkerbookstores.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Mar 2022 35 days
wandwcellars.com wandwcellars.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Apr 2022 69 days
hostingcontrolpanel.net web05.hostingcontrolpanel.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
whiskeycentral.com whiskeycentral.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 106 days
ordermate.online us.ordermate.online
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
dylansliquor.com dylansliquor.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 May 2022 107 days
hologine.com emm.hologine.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
grapevineliquorsnj.com grapevineliquorsnj.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Apr 2022 73 days
hdsports.co.uk hdsports.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 Mar 2022 One Off
launchcompletelyadvancedthefile.vip launchcompletelyadvancedthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchintenselyswiftthefile.vip launchintenselyswiftthefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchrenewedintenselythefile.vip launchrenewedintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
launchswiftintenselythefile.vip launchswiftintenselythefile.vip
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Feb 2022 Feb 2022 One Off
licita.mx licita.mx
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Apr 2022 Apr 2022 One Off
bottlecapps.com mariettawineliquorbeer.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Mar 2022 May 2022 50 days
mssnapplications.com minecraft.mssnapplications.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
postnetnc103.com postnetnc103.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 May 2022 May 2022 One Off
presswhore.com presswhore.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-MMNJXZ8 Jan 2022 Feb 2022 27 days
sandbox-cces.com sandbox-cces.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Aug 2022 One Off
grapesandgrains.com shop.grapesandgrains.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Mar 2023 1 year, 231 days
whistlerliquorstore.ca shop.whistlerliquorstore.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Apr 2023 253 days
mariettawineliquorbeer.com shop.mariettawineliquorbeer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 321 days
shtrakker.org shtrakker.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Aug 2022 One Off
zapraxia.com sigmage.zapraxia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Aug 2022 One Off
snappiesips.com snappiesips.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Dec 2021 127 days
steves-liquor.com steves-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Apr 2023 1 year, 262 days
1464liquor.com 1464liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Oct 2021 81 days
topshelf-liquor.com topshelf-liquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2021 Apr 2023 1 year, 186 days
beerbrotherswineandspirits.com beerbrotherswineandspirits.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Aug 2021 14 days
tzgapsystems.com tzgapsystems.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jan 2023 Apr 2023 91 days
jmtechnologygroup.net unms.jmtechnologygroup.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Apr 2023 Apr 2023 19 days
valswinedelivery.com valswinedelivery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Oct 2021 82 days
blacktab.net blacktab.net
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Mar 2023 211 days
bottlecapps.com bottleshopga.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2023 Mar 2023 One Off
bottlecapps.com bottomsup.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2021 Nov 2021 1 day
worththepour.com worththepour.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2021 Dec 2021 133 days
zapraxia.com zapraxia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Aug 2022 One Off
chcollabspace.org chcollabspace.org
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Aug 2022 One Off
smgdigitaldev.com elk.smgdigitaldev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Nov 2022 Mar 2023 121 days
ifoodfight.com ifoodfight.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Sep 2022 One Off
zapraxia.com ineedhelp.zapraxia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Aug 2022 Aug 2022 One Off
lonsdalews.com lonsdalews.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jul 2021 Sep 2021 55 days
mktetc.com mktetc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2021 Nov 2021 56 days
medianation.ca morrey.leadgen.medianation.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2022 Mar 2022 One Off
medianation.ca morreygroup.infiniti.medianation.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2022 Mar 2022 One Off
mulberryliquor.com mulberryliquor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Jun 2022 Apr 2023 308 days
nbriel.xyz nbriel.xyz
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Sep 2022 Sep 2022 One Off
bottlecapps.com northsidebs.bottlecapps.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Feb 2023 Apr 2023 80 days
medianation.ca orlexus.leadgen.medianation.ca
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Mar 2022 Mar 2022 One Off
podglo.com podglo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-137994865 Oct 2022 Dec 2022 40 days
TUPELOWINE.COM
Non IP Attributes
Attribute First Last
UA UA-137994865 Jul 2021 Apr 2023
GTM GTM-MMNJXZ8 Jan 2022 May 2022
TUPELOWINE.COM
Overlap Attribute Domains
liquordepotdixie.com liquordepotdixie.com
liquorjunction.com liquorjunction.com
luluislandliquor.com luluislandliquor.com
manhattanliquorsfl.com manhattanliquorsfl.com
manorvilleliquor.com manorvilleliquor.com
mybelairliquors.com mybelairliquors.com
newaceliquor.com newaceliquor.com
nitro2gobev.com nitro2gobev.com
oldmiltonbeverages.com oldmiltonbeverages.com
peavinewineandspirit.com peavinewineandspirit.com
perrysstores.com perrysstores.com
planetofwine.com planetofwine.com
renaissancelongmont.com renaissancelongmont.com
rootsbeerdistributor.com rootsbeerdistributor.com
royalliquorstore.com royalliquorstore.com
shop.gemcityws.com shop.gemcityws.com
shoreviewliquors.com shoreviewliquors.com
americanspiritsaddison.com americanspiritsaddison.com
sonsonliquor.com sonsonliquor.com
spsliquor.com spsliquor.com
ssliquors.com ssliquors.com
steinsandvines.com steinsandvines.com
suwaneetopshelf.com suwaneetopshelf.com
sweetwaterpackagestore.com sweetwaterpackagestore.com
antonswineandliquor.com antonswineandliquor.com
tampaliquorz.com tampaliquorz.com
thespiritshop.org thespiritshop.org
barnbottleshop.com barnbottleshop.com
topshelfwinespiritlv.com topshelfwinespiritlv.com
beera2.com beera2.com
beerworldpa.com beerworldpa.com
treecitywine.com treecitywine.com
tsliquor.ca tsliquor.ca
berwickbeverage.com berwickbeverage.com
tupelowine.com tupelowine.com
turtlecreekwineandspirits.com turtlecreekwineandspirits.com
bigbearsliquor.com bigbearsliquor.com
bimspackage.bottlecapps.com bimspackage.bottlecapps.com
ustopliquor.com ustopliquor.com
vernsliquor.com vernsliquor.com
villagewineathens.com villagewineathens.com
vipliquoratl.com vipliquoratl.com
warehouseliquorlr.com warehouseliquorlr.com
boozerusathens.com boozerusathens.com
bottlesbeverage.bottlecapps.com bottlesbeverage.bottlecapps.com
wedeliverstores.com wedeliverstores.com
westvail.com westvail.com
wlemporium.com wlemporium.com
worldbeverage400orders.com worldbeverage400orders.com
cabsandcrafts.com cabsandcrafts.com
calhounliquor.com calhounliquor.com
canalsofglassboro.com canalsofglassboro.com
yahotties.com yahotties.com
cavediverssouth.com cavediverssouth.com
cellarsliquor.com cellarsliquor.com
charlestownliquorsma.com charlestownliquorsma.com
clocktowermn.com clocktowermn.com
connectedbottleshop.com connectedbottleshop.com
cornhuskerbeverage.bottlecapps.com cornhuskerbeverage.bottlecapps.com
cpsliquor.com cpsliquor.com
davidsonpackagestore.com davidsonpackagestore.com
davidsonsliquors.com davidsonsliquors.com
dekalbbottlehouse.bottlecapps.com dekalbbottlehouse.bottlecapps.com
dialiquorwarehouse.com dialiquorwarehouse.com
dorrsliquormart.com dorrsliquormart.com
fultonstreetliquor.com fultonstreetliquor.com
gomesliquors.com gomesliquors.com
grapeleafstore.com grapeleafstore.com
harvestliquors.com harvestliquors.com
heritagemhk.com heritagemhk.com
highspirits.bottlecapps.com highspirits.bottlecapps.com
hopsgrainandvine.com hopsgrainandvine.com
ingloriouscaskers.com ingloriouscaskers.com
instantliquor.com instantliquor.com
jaxspirits.com jaxspirits.com
jerrysliquortx.com jerrysliquortx.com
kilroyspackage.bottlecapps.com kilroyspackage.bottlecapps.com
kedronworldofbeverage.bottlecapps.com kedronworldofbeverage.bottlecapps.com
kellylroy.com kellylroy.com
lalaliquor.com lalaliquor.com
leisers.com leisers.com
liquorbarnvaldosta.com liquorbarnvaldosta.com
liquorcity.com liquorcity.com
liquorland.us liquorland.us
liquorloftvaldosta.net liquorloftvaldosta.net
liquornwine.com liquornwine.com
liquorplus.net liquorplus.net
liquorwfl.com liquorwfl.com
loadingdockliquors.com loadingdockliquors.com
luckysliquorfl.com luckysliquorfl.com
lukesliquors.com lukesliquors.com
macadoodles.bottlecapps.com macadoodles.bottlecapps.com
mcswineandliquors.com mcswineandliquors.com
megaliquorandsmoke.com megaliquorandsmoke.com
metroliquorstore.online metroliquorstore.online
midtownwinemerchants.com midtownwinemerchants.com
montecristospirits.com montecristospirits.com
mrwineandliquor.com mrwineandliquor.com
muncieliquors.bottlecapps.com muncieliquors.bottlecapps.com
myredcarpetliquors.com myredcarpetliquors.com
noblewineandspirts.bottlecapps.com noblewineandspirts.bottlecapps.com
outletliquorga.com outletliquorga.com
redrunliquors.com redrunliquors.com
paulsfinewineandspirits.com paulsfinewineandspirits.com
regalwineliquor.com regalwineliquor.com
peachtreeliquor.com peachtreeliquor.com
pentictonliquor.com pentictonliquor.com
pyramidfinewine.com pyramidfinewine.com
roosterspackage.com roosterspackage.com
admicrotek.com admicrotek.com
armadilloliquor.com armadilloliquor.com
alsbdl.com alsbdl.com
shooterspg.com shooterspg.com
shop.cornersfinewineandspirits.com shop.cornersfinewineandspirits.com
shop.pinawineandspirits.com shop.pinawineandspirits.com
shop.fivepointsbottleshop.com shop.fivepointsbottleshop.com
shopatlanticwineandspirits.com shopatlanticwineandspirits.com
shopdlg.com shopdlg.com
shopmoransliquor.com shopmoransliquor.com
starpackageonline.com starpackageonline.com
107liquor.com 107liquor.com
abliquor2.com abliquor2.com
aspen-liquor.com aspen-liquor.com
taliquorokc.com taliquorokc.com
texascheerliquor.com texascheerliquor.com
thebeverageshoppe.com thebeverageshoppe.com
thecellarbcs.com thecellarbcs.com
thejugliquors.com thejugliquors.com
batch13wines.com batch13wines.com
tomarsdiscountliquor.com tomarsdiscountliquor.com
bearvalleyliquors.com bearvalleyliquors.com
beverageworldpackage.bottlecapps.com beverageworldpackage.bottlecapps.com
bigred-liquor.com bigred-liquor.com
warehousewineliquor.com warehousewineliquor.com
watchguardone.com watchguardone.com
boulevardnlr.com boulevardnlr.com
westvail.net westvail.net
brother-liquors.com brother-liquors.com
bsws.shop bsws.shop
buddysbooze.com buddysbooze.com
butlerswineandspirits.com butlerswineandspirits.com
campuswineandspirit.com campuswineandspirit.com
capitalwineandliquor.com capitalwineandliquor.com
yesdrink.com yesdrink.com
chieftainliquors.com chieftainliquors.com
cityliquorsdyersburg.com cityliquorsdyersburg.com
colonial-liquors.com colonial-liquors.com
columbusbeverage.com columbusbeverage.com
consumersdiscountwine.com consumersdiscountwine.com
desotoliquor.com desotoliquor.com
dev.tudo.enovar.solutions dev.tudo.enovar.solutions
dixiebeverageliquor.com dixiebeverageliquor.com
drugcityliquors.com drugcityliquors.com
eastsidewineandspirits.com eastsidewineandspirits.com
finewineseb.com finewineseb.com
freemansliquormart.com freemansliquormart.com
gibbysbottleshop.com gibbysbottleshop.com
greens.bottlecapps.com greens.bottlecapps.com
houseofambrosestore.com houseofambrosestore.com
hovercrossingwinespirits.com hovercrossingwinespirits.com
jayveeliquors.com jayveeliquors.com
jdsliquortown.com jdsliquortown.com
royalbluepackage.com royalbluepackage.com
savemoremrkt.com savemoremrkt.com
sharpstownliquor.com sharpstownliquor.com
shellliquors.com shellliquors.com
shop.liquor.studio shop.liquor.studio
shop.northstarliquorsuperstore.com shop.northstarliquorsuperstore.com
shopmidwayliquors.com shopmidwayliquors.com
shopmikeskc.com shopmikeskc.com
shopstocktonfinewines.com shopstocktonfinewines.com
shoresliquor.com shoresliquor.com
amherstwine.com amherstwine.com
skylinebroadway.com skylinebroadway.com
angel-liquor.com angel-liquor.com
angkorwine.com angkorwine.com
spadesliquor.com spadesliquor.com
spiritsofnatchez.com spiritsofnatchez.com
sportsmanliquor.com sportsmanliquor.com
spotfire.gryphonog.com spotfire.gryphonog.com
adams-liquor.com adams-liquor.com
airportdiscountws.com airportdiscountws.com
swigthis.com swigthis.com
taskersbeerbarn.com taskersbeerbarn.com
terraceliquordepot.com terraceliquordepot.com
thecellars.com thecellars.com
theridgewineandspirits.com theridgewineandspirits.com
timberlanewine.com timberlanewine.com
bartowliquors.com bartowliquors.com
topshelfmilton.com topshelfmilton.com
beerwineworld.com beerwineworld.com
travisheightswine.com travisheightswine.com
tykesliquor.com tykesliquor.com
beveragecity2.com beveragecity2.com
bigsspiritsandwine.shop bigsspiritsandwine.shop
unionwineandliquor.com unionwineandliquor.com
usabevco.com usabevco.com
warehousepackage.com warehousepackage.com
bottlehousect.com bottlehousect.com
boulevardwine.com boulevardwine.com
weststwine.com weststwine.com
wildduckboston.com wildduckboston.com
burlingameliquors.com burlingameliquors.com
candcliquor.com candcliquor.com
xpressliquor.net xpressliquor.net
captainjacksbev.com captainjacksbev.com
cellarnorman.com cellarnorman.com
zeesdws.com zeesdws.com
central.alcoholdelivery.com central.alcoholdelivery.com
colmarbeerstore.com colmarbeerstore.com
corkrunner.com corkrunner.com
crestliquors.com crestliquors.com
decatur.bottlecapps.com decatur.bottlecapps.com
deepdiscounttulsa.com deepdiscounttulsa.com
eastern.alcoholdelivery.com eastern.alcoholdelivery.com
edwinswine.com edwinswine.com
elitebeverages.net elitebeverages.net
everestliquoraustintx.com everestliquoraustintx.com
ezpackagestore.com ezpackagestore.com
foremostlakeview.com foremostlakeview.com
fredsavalonliquors.com fredsavalonliquors.com
fridgeliquormhk.com fridgeliquormhk.com
friendlyfrankiesbottleshop.com friendlyfrankiesbottleshop.com
gomers.bottlecapps.com gomers.bottlecapps.com
jcwob.com jcwob.com
jerrysimcoebeverage.com jerrysimcoebeverage.com
jimmysliquorstore.com jimmysliquorstore.com
justsignal.com justsignal.com
kenyonsmarket.com kenyonsmarket.com
kwikandconvenient.com kwikandconvenient.com
liquorexpressathens.com liquorexpressathens.com
liquorstopfountain.com liquorstopfountain.com
maplewoodwineliquor.com maplewoodwineliquor.com
maxsliquors.com maxsliquors.com
mcaloons-liquors.com mcaloons-liquors.com
megapackagestore.bottlecapps.com megapackagestore.bottlecapps.com
meritfinewines.com meritfinewines.com
midwest-wine.com midwest-wine.com
mountain.alcoholdelivery.com mountain.alcoholdelivery.com
napavalleybeverageco.com napavalleybeverageco.com
northridgeliquor.com northridgeliquor.com
outerbridgeliquor.com outerbridgeliquor.com
oxfordws.com oxfordws.com
partybeverage.net partybeverage.net
rickersbeerandwine.com rickersbeerandwine.com
pearlandfinewineandspirits.com pearlandfinewineandspirits.com
rightturnliquors.com rightturnliquors.com
platinumbws.com platinumbws.com
popatopwine.com popatopwine.com
purdyswine.com purdyswine.com
royalatlanticwines.com royalatlanticwines.com
rumsonwineandspirits.com rumsonwineandspirits.com
scottsmarket.com scottsmarket.com
shop.brownbagliquor.com shop.brownbagliquor.com
shop.alcoholdelivery.com shop.alcoholdelivery.com
shopbottlestexas.com shopbottlestexas.com
shopliquorlineup.com shopliquorlineup.com
shopthecork.com shopthecork.com
sigmanbottle.com sigmanbottle.com
southsideliquor.net southsideliquor.net
southacademyliquormart.com southacademyliquormart.com
spankysliquor.com spankysliquor.com
spacitywine.com spacitywine.com
spiritofharwichport.bottlecapps.com spiritofharwichport.bottlecapps.com
starwestbankliquor.com starwestbankliquor.com
stockbridgebottle.bottlecapps.com stockbridgebottle.bottlecapps.com
streamwoodliquor.com streamwoodliquor.com
superiorliquor.bottlecapps.com superiorliquor.bottlecapps.com
swliquors.com swliquors.com
taphouseliquor.com taphouseliquor.com
thebottleshoppememphis.com thebottleshoppememphis.com
batavialiquorwine.com batavialiquorwine.com
tradingpostliquor.com tradingpostliquor.com
bethanydiscountliquor.com bethanydiscountliquor.com
unclejackspirits.com unclejackspirits.com
bigliquorwestminster.com bigliquorwestminster.com
urbanwineshop.bottlecapps.com urbanwineshop.bottlecapps.com
bishopswineandspirits.com bishopswineandspirits.com
vikingliquor.com vikingliquor.com
bnnfoodmart.com bnnfoodmart.com
walnutliquors.com walnutliquors.com
boozerusathens.net boozerusathens.net
bossliquors.com bossliquors.com
bottleshopathens.bottlecapps.com bottleshopathens.bottlecapps.com
bottomsupbevs.com bottomsupbevs.com
winebinofokc.com winebinofokc.com
zekesliquor.com zekesliquor.com
cjsliquor.com cjsliquor.com
colonialwine.shop colonialwine.shop
corknbottlelr.com corknbottlelr.com
crazybruces.bottlecapps.com crazybruces.bottlecapps.com
crossroadsar.com crossroadsar.com
cubanliquor.com cubanliquor.com
destinationwineandliquor.com destinationwineandliquor.com
dixiepackage.bottlecapps.com dixiepackage.bottlecapps.com
dunbarbottling.com dunbarbottling.com
dylansliquor.net dylansliquor.net
eastaveliquor.com eastaveliquor.com
elegantwineandliquors.com elegantwineandliquors.com
frontierliquors.com frontierliquors.com
highpeakswineandspirits.com highpeakswineandspirits.com
hopsscotchvinery.com hopsscotchvinery.com
liquidcourage.us liquidcourage.us
liquorcab.bottlecapps.com liquorcab.bottlecapps.com
liquorcabinetks.com liquorcabinetks.com
localvinestore.com localvinestore.com
loyaltyliquor.com loyaltyliquor.com
lukescapecod.com lukescapecod.com
mdlwineandspirits.com mdlwineandspirits.com
metcalfdiscountliquor.com metcalfdiscountliquor.com
midnightliquors.com midnightliquors.com
mrliquor3.com mrliquor3.com
natalie-roy.ws natalie-roy.ws
northlakeliquors.com northlakeliquors.com
oldbridgeliquors.com oldbridgeliquors.com
onthewaypackage.com onthewaypackage.com
ostliquorstore.com ostliquorstore.com
pacific.alcoholdelivery.com pacific.alcoholdelivery.com
partytimerome.com partytimerome.com
peacockwineandspirits.com peacockwineandspirits.com
prestobeer.com prestobeer.com
rallyliquor.com rallyliquor.com
launchintenselyquickthefile.vip launchintenselyquickthefile.vip
launchprogressiveintenselythefile.vip launchprogressiveintenselythefile.vip
launchrefinedintenselythefile.vip launchrefinedintenselythefile.vip
liquorstorevegas.com liquorstorevegas.com
mkmxprojects.com mkmxprojects.com
ordn.in ordn.in
ostliquorstore.net ostliquorstore.net
rcp-ag.com rcp-ag.com
proofsomerville.com proofsomerville.com
silversaucellc.com silversaucellc.com
springsliquor.com springsliquor.com
unifi2.helloit.tech unifi2.helloit.tech
vacantexposures.com vacantexposures.com
vacantpropertyhelp.com vacantpropertyhelp.com
vineyardliquors.com vineyardliquors.com
bradyswine.com bradyswine.com
buckheadwineshop.bottlecapps.com buckheadwineshop.bottlecapps.com
candcliquorfortcollins.com candcliquorfortcollins.com
chartertextbook.com chartertextbook.com
chartertextbooks.com chartertextbooks.com
creeksidebeer.com creeksidebeer.com
davidandginny.co.uk davidandginny.co.uk
houseofkindredspiritsandwine.com houseofkindredspiritsandwine.com
int.ordermate.online int.ordermate.online
lexfides.gt lexfides.gt
livestore-poc.iwsbrazil.io livestore-poc.iwsbrazil.io
max-beverage.com max-beverage.com
mktetc.net mktetc.net
mullingtime.com mullingtime.com
nyxtend.com nyxtend.com
pexium-tools.com pexium-tools.com
rockhardspirits.com rockhardspirits.com
shop.grapevinewines.com shop.grapevinewines.com
shop.uclueletliquorstore.ca shop.uclueletliquorstore.ca
sidedoorliquors.com sidedoorliquors.com
siennawine.com siennawine.com
1010wws.bottlecapps.com 1010wws.bottlecapps.com
suelivingston.com suelivingston.com
swsokc.com swsokc.com
tatcan.com tatcan.com
atlpackage.com atlpackage.com
atrmywizard360.com atrmywizard360.com
beerandbevlancaster.com beerandbevlancaster.com
unclejacksspirits.com unclejacksspirits.com
victorywineliquors.com victorywineliquors.com
bonzawordpuzzle.com bonzawordpuzzle.com
bradleysliquor.com bradleysliquor.com
westhillsbeer.com westhillsbeer.com
westsidebs.bottlecapps.com westsidebs.bottlecapps.com
willowgrovebeerstore.com willowgrovebeerstore.com
buy.shopbottles.com buy.shopbottles.com
cheerspackage.com cheerspackage.com
crestviewliquors.com crestviewliquors.com
egis.39dn.com egis.39dn.com
fakemytweet.com fakemytweet.com
friendshipwine.com friendshipwine.com
igt2000.com igt2000.com
illuminate.today illuminate.today
institutoprogetins.net institutoprogetins.net
jcwb.bottlecapps.com jcwb.bottlecapps.com
kaplanindex.com kaplanindex.com
kennesawwineliquorbeer.bottlecapps.com kennesawwineliquorbeer.bottlecapps.com
launchdevelopedintenselythefile.vip launchdevelopedintenselythefile.vip
launchfreemostthefile.vip launchfreemostthefile.vip
launchintenselyrefinedthefile.vip launchintenselyrefinedthefile.vip
launchintenselysophisticatedthefile.vip launchintenselysophisticatedthefile.vip
launchmostfreethefile.vip launchmostfreethefile.vip
launchrenewedmostthefile.vip launchrenewedmostthefile.vip
ledgebrookspiritshop.bottlecapps.com ledgebrookspiritshop.bottlecapps.com
liquorlockerclub.com liquorlockerclub.com
michaelkenduck.com michaelkenduck.com
mikekenduck.com mikekenduck.com
mtcuat-nv-utility.mtcaerosystems.com mtcuat-nv-utility.mtcaerosystems.com
namewhale.co namewhale.co
nubohelp.com nubohelp.com
nubohelp.net nubohelp.net
parkmobileusa.com parkmobileusa.com
plazapackage.com plazapackage.com
projetos.scopusengenharia.com.br projetos.scopusengenharia.com.br
abcpackage.com abcpackage.com
saffronrosegold.com saffronrosegold.com
six-rating.com six-rating.com
124package.com 124package.com
suwaneetopshelfbeverage.com suwaneetopshelfbeverage.com
termooriginal.se termooriginal.se
tracykenduck.com tracykenduck.com
bigbarrelliquors.com bigbarrelliquors.com
drinksonustx.com drinksonustx.com
goodspiritsliquor.com goodspiritsliquor.com
goodtimeswsb.com goodtimeswsb.com
greatwinesmemphis.com greatwinesmemphis.com
gtownwine.com gtownwine.com
helencellar.com helencellar.com
khaynerphoto.com khaynerphoto.com
lenoir-rebuildnc.gtntechsol.com lenoir-rebuildnc.gtntechsol.com
liquorworld.ca liquorworld.ca
lukaskc.com lukaskc.com
lumberton-rebuildnc.gtntechsol.com lumberton-rebuildnc.gtntechsol.com
morreygroup.nissan.medianation.ca morreygroup.nissan.medianation.ca
openroad.lexusrx350l.medianation.ca openroad.lexusrx350l.medianation.ca
orbitalinsightt.com orbitalinsightt.com
portofinowinebank.com portofinowinebank.com
quickstopliquors.com quickstopliquors.com
shop.alberniliquorstore.ca shop.alberniliquorstore.ca
shop.beveragesuperstoreofgrayson.com shop.beveragesuperstoreofgrayson.com
shop.buckheadwineshop.com shop.buckheadwineshop.com
shop.liquorworld.ca shop.liquorworld.ca
shop.kennesawwineliquorbeer.com shop.kennesawwineliquorbeer.com
smittys-liquor.com smittys-liquor.com
api.autopay.com api.autopay.com
asibms.net asibms.net
tablinkclone.tabwareonline.com tablinkclone.tabwareonline.com
tarboro-rebuildnc.gtntechsol.com tarboro-rebuildnc.gtntechsol.com
breezeriteinliquor.com breezeriteinliquor.com
wildbillspartyshop.com wildbillspartyshop.com
cellardoor.bottlecapps.com cellardoor.bottlecapps.com
dori.io dori.io
drsordersliquor.com drsordersliquor.com
ejasupletivo.com.br ejasupletivo.com.br
emeraldip.com emeraldip.com
farwestliquor.com farwestliquor.com
follothru.com follothru.com
fugue.kilobit.ch fugue.kilobit.ch
ginnyswineliquor.com ginnyswineliquor.com
guesswho.bottlecapps.com guesswho.bottlecapps.com
habersham.bottlecapps.com habersham.bottlecapps.com
healthcareusability.org healthcareusability.org
jelmd.com jelmd.com
robertburnswines.com robertburnswines.com
allbankhomes.com allbankhomes.com
anjoliquors.com anjoliquors.com
stockbridgebottleshoppe.com stockbridgebottleshoppe.com
store.postnetnc103.com store.postnetnc103.com
strategicedgerealty.com strategicedgerealty.com
theliquorstore5.com theliquorstore5.com
theupsstorepitchoff.com theupsstorepitchoff.com
triveniethnics.com triveniethnics.com
usatest.ordermate.online usatest.ordermate.online
bradyswinewarehouse.com bradyswinewarehouse.com
widgets.squerb.com widgets.squerb.com
client.readportal.info client.readportal.info
drinktuscany.com drinktuscany.com
greenmanmilwich.com greenmanmilwich.com
imgans.com imgans.com
launchintenselydevelopedthefile.vip launchintenselydevelopedthefile.vip
launchintenselyrenewedthefile.vip launchintenselyrenewedthefile.vip
mgmdigitallibrary.com mgmdigitallibrary.com
orderonline.hopcitybeer.com orderonline.hopcitybeer.com
overstreetmarket.com overstreetmarket.com
paidup.com paidup.com
paircoach.com paircoach.com
palmwinespirits.com palmwinespirits.com
paradisecoveliquor.com paradisecoveliquor.com
parkwaywineliquor.com parkwaywineliquor.com
poplarwine-spirits.com poplarwine-spirits.com
reidcardwell.net reidcardwell.net
ryansliquors.com ryansliquors.com
selvangal.com selvangal.com
arythmies.com arythmies.com
stoneys-liquor.com stoneys-liquor.com
aws.as3.io aws.as3.io
towncenterwine.com towncenterwine.com
bertie-rebuildnc.gtntechsol.com bertie-rebuildnc.gtntechsol.com
villagewestliquors.com villagewestliquors.com
boomliquor.com boomliquor.com
bootleggerspackage.bottlecapps.com bootleggerspackage.bottlecapps.com
whitehorsepapers.net whitehorsepapers.net
wholesale.bearcreekspirits.com wholesale.bearcreekspirits.com
yzliu.com yzliu.com
columbus-rebuildnc.gtntechsol.com columbus-rebuildnc.gtntechsol.com
corksandbottles.com corksandbottles.com
crj200.com crj200.com
dandyliquor.com dandyliquor.com
emguarda.com emguarda.com
flamingo-liquor.bottlecapps.com flamingo-liquor.bottlecapps.com
goodtechllc.com goodtechllc.com
hilltopchulavista.com hilltopchulavista.com
jollykingfinewines.com jollykingfinewines.com
kimstella.com kimstella.com
monarchliquor.bottlecapps.com monarchliquor.bottlecapps.com
nstreet.bottlecapps.com nstreet.bottlecapps.com
openroad.lexusis300awd.medianation.ca openroad.lexusis300awd.medianation.ca
shopbarnesliquor.com shopbarnesliquor.com
skoahjobs.com skoahjobs.com
andreasgrosphotography.com andreasgrosphotography.com
squerb-staging.com squerb-staging.com
starliquorsbottlecapps.net starliquorsbottlecapps.net
tamdeen.com.kw tamdeen.com.kw
auth.squerb.com auth.squerb.com
thevineyard.com thevineyard.com
trinityspiritsandwine.com trinityspiritsandwine.com
biggameliquors.com biggameliquors.com
vacantexposure.com vacantexposure.com
walherbookstore.com walherbookstore.com
walkerbookstores.com walkerbookstores.com
wandwcellars.com wandwcellars.com
web05.hostingcontrolpanel.net web05.hostingcontrolpanel.net
whiskeycentral.com whiskeycentral.com
us.ordermate.online us.ordermate.online
dylansliquor.com dylansliquor.com
emm.hologine.com emm.hologine.com
grapevineliquorsnj.com grapevineliquorsnj.com
hdsports.co.uk hdsports.co.uk
launchcompletelyadvancedthefile.vip launchcompletelyadvancedthefile.vip
launchintenselyswiftthefile.vip launchintenselyswiftthefile.vip
launchrenewedintenselythefile.vip launchrenewedintenselythefile.vip
launchswiftintenselythefile.vip launchswiftintenselythefile.vip
licita.mx licita.mx
mariettawineliquorbeer.bottlecapps.com mariettawineliquorbeer.bottlecapps.com
minecraft.mssnapplications.com minecraft.mssnapplications.com
postnetnc103.com postnetnc103.com
presswhore.com presswhore.com
sandbox-cces.com sandbox-cces.com
shop.grapesandgrains.com shop.grapesandgrains.com
shop.whistlerliquorstore.ca shop.whistlerliquorstore.ca
shop.mariettawineliquorbeer.com shop.mariettawineliquorbeer.com
shtrakker.org shtrakker.org
sigmage.zapraxia.com sigmage.zapraxia.com
snappiesips.com snappiesips.com
steves-liquor.com steves-liquor.com
1464liquor.com 1464liquor.com
topshelf-liquor.com topshelf-liquor.com
beerbrotherswineandspirits.com beerbrotherswineandspirits.com
tzgapsystems.com tzgapsystems.com
unms.jmtechnologygroup.net unms.jmtechnologygroup.net
valswinedelivery.com valswinedelivery.com
blacktab.net blacktab.net
bottleshopga.bottlecapps.com bottleshopga.bottlecapps.com
bottomsup.bottlecapps.com bottomsup.bottlecapps.com
worththepour.com worththepour.com
zapraxia.com zapraxia.com
chcollabspace.org chcollabspace.org
elk.smgdigitaldev.com elk.smgdigitaldev.com
ifoodfight.com ifoodfight.com
ineedhelp.zapraxia.com ineedhelp.zapraxia.com
lonsdalews.com lonsdalews.com
mktetc.com mktetc.com
morrey.leadgen.medianation.ca morrey.leadgen.medianation.ca
morreygroup.infiniti.medianation.ca morreygroup.infiniti.medianation.ca
mulberryliquor.com mulberryliquor.com
nbriel.xyz nbriel.xyz
northsidebs.bottlecapps.com northsidebs.bottlecapps.com
orlexus.leadgen.medianation.ca orlexus.leadgen.medianation.ca
podglo.com podglo.com
TUPELOWINE.COM
IP History

Click the IP addresses to see over domains using them.