DULEYPRACTICE.CO.UK
Shared Attributes
Domain
lcwealth.co.uk lcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
ldbwealth.co.uk ldbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2024 3 years, 74 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Jan 2021 13 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
lewiswealthmanagement.co.uk lewiswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lhfp.co.uk lhfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
llewellynfs.co.uk llewellynfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
lowesawyerfp.co.uk lowesawyerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 152 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
lsmwealth.co.uk lsmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
macleodandmaccallumwm.co.uk macleodandmaccallumwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 68 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
martenwm.co.uk martenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
michaeljcookwm.co.uk michaeljcookwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 95 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mitchellwm.co.uk mitchellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mktwealthmanagement.co.uk mktwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
moorgatefp.co.uk moorgatefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 39 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 144 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mwm-sjp.co.uk mwm-sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 93 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
napiersharpe.com napiersharpe.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jan 2022 104 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
naziahaquewm.co.uk naziahaquewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 112 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
northumbriafm.co.uk northumbriafm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
norwoodfp.com norwoodfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
nowfinancial.co.uk nowfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 311 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
oakroomwealth.co.uk oakroomwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
ocswealthmanagement.co.uk ocswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 20 days
UA UA-5583714 Jan 2021 Jan 2021 19 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
oliverwronski.co.uk oliverwronski.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2022 1 year, 56 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
orangetreewm.co.uk orangetreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 134 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rbawealthmanagement.com rbawealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
parkswm.co.uk parkswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 139 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
paulthorntonsjp.co.uk paulthorntonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 15 days
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pcfaltd.co.uk pcfaltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 337 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pcfinancialplanning.com pcfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-1258234 Dec 2019 Jan 2020 27 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
peterhardingwm.co.uk peterhardingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
petermulronefp.co.uk petermulronefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pfswm.co.uk pfswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 114 days
GTM GTM-58PXN8T Jan 2021 May 2021 120 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
poolegrahamwc.co.uk poolegrahamwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 80 days
UA UA-5583714 Jan 2021 Jan 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
portbrae.co.uk portbrae.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 80 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
reddingswm.co.uk reddingswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
renoufwmltd.co.uk renoufwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-1258234 Dec 2019 Jan 2020 31 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
bwfconsultants.com bwfconsultants.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
rmwmllp.co.uk rmwmllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
acsfinancialplanning.co.uk acsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
UA UA-5583714 Jan 2021 Feb 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
brightwm.co.uk brightwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
aflfinancial.co.uk aflfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 259 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
scharpwm.co.uk scharpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 21 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
afswm.co.uk afswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 112 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 107 days
HJ HJ-1258234 Dec 2019 Jan 2020 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
agfp.co.uk agfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
seifertdunk.co.uk seifertdunk.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 22 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sevenhillswealth.co.uk sevenhillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 22 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
argentwm.co.uk argentwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
albrightonwm.co.uk albrightonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
ambersmithwc.co.uk ambersmithwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
andrewcummingwm.co.uk andrewcummingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
srbwm.co.uk srbwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
stephendawsonfp.co.uk stephendawsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 45 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
stephensonfp.co.uk stephensonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 32 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
suepickeringwealth.co.uk suepickeringwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 29 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sycamorealliance.com sycamorealliance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 30 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
thetdp.co.uk thetdp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 99 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 7 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
thomashallwm.co.uk thomashallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2022 1 year, 66 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
barbaracopeland.co.uk barbaracopeland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
tinaowenfp.co.uk tinaowenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bderose.co.uk bderose.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
beechcroftwm.co.uk beechcroftwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
trowlockwm.co.uk trowlockwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 287 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-1258234 Dec 2019 Mar 2020 89 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bglwealth.co.uk bglwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 261 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
boardmanwealth.co.uk boardmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
boagenglandfp.co.uk boagenglandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
wbwealth.co.uk wbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wdwealth.co.uk wdwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Jan 2020 43 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
bpcwealth.co.uk bpcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
bracewealth.co.uk bracewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
wellsandcompanywm.co.uk wellsandcompanywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 317 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
whitehousefm.co.uk whitehousefm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 166 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wickenswealthmanagement.co.uk wickenswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
buchanwm.co.uk buchanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
wmcinvestment.com wmcinvestment.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
woodfallwealth.co.uk woodfallwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 146 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
yiotawilkinsonwm.co.uk yiotawilkinsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-1258234 Dec 2019 Mar 2020 92 days
UA UA-5583714 Jan 2021 Feb 2021 45 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
cedarfp.co.uk cedarfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 52 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
cfswp.co.uk cfswp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
chatsworthwm.co.uk chatsworthwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
collinswm.co.uk collinswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 68 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
dfsfinancialconsultancy.co.uk dfsfinancialconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
deanstevenswm.co.uk deanstevenswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
derekmillswealth.co.uk derekmillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
derekscott.co.uk derekscott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
dilasserprivateclients.co.uk dilasserprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
dmcwm.co.uk dmcwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
duncanwealth.co.uk duncanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
ecclesgreenwood.co.uk ecclesgreenwood.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-1258234 Dec 2019 Feb 2020 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
eswaranstone.com eswaranstone.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 159 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
executivewealth.co.uk executivewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 232 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
fawcettwm.co.uk fawcettwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 126 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
fowlerfp.co.uk fowlerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 124 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
gdtwealthmanagement.co.uk gdtwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
godridgewealth.co.uk godridgewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 156 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
gofp.co.uk gofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 121 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
goldbywealth.com goldbywealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
gpswealthmanagement.co.uk gpswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 121 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
harrisonjamesfp.co.uk harrisonjamesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
henshallwm.co.uk henshallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hfwealthplanning.co.uk hfwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hindleandjepsonfs.co.uk hindleandjepsonfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
hjwealthplanning.co.uk hjwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
honeycroftwm.co.uk honeycroftwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
huntminaswm.co.uk huntminaswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 280 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
hwmwealth.co.uk hwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 38 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hylandfp.co.uk hylandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
jenkinsandcofm.co.uk jenkinsandcofm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
jolyonroderickfp.co.uk jolyonroderickfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
jsawealthmanagement.co.uk jsawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 51 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kimgeorge.co.uk kimgeorge.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kmcwealthmanagement.co.uk kmcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 109 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Jan 2021 12 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
krfinancialplanning.co.uk krfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 146 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jwhwealth.co.uk jwhwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kcwealth.co.uk kcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
keithmarwick.co.uk keithmarwick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kenbinniefinancialltd.co.uk kenbinniefinancialltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
klafp.co.uk klafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2024 3 years, 93 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
ktwm.co.uk ktwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
leowealth.co.uk leowealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Jan 2021 13 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
lfp.co.uk lfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lyonsfinancialmanagement.co.uk lyonsfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 105 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mbjj.co.uk mbjj.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mckenzieandco.co.uk mckenzieandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2023 1 year, 172 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mlfinancialconsultants.co.uk mlfinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 85 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
moranwealthmanagement.co.uk moranwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 73 days
UA UA-5583714 Jan 2021 Jan 2021 17 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
neilloveitt.co.uk neilloveitt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 112 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
nigelwd.co.uk nigelwd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 113 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
odellwealth.com odellwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 20 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rectorygreenfs.co.uk rectorygreenfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
oundlewealthmanagement.co.uk oundlewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 283 days
GTM GTM-58PXN8T Jan 2021 May 2021 96 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
paulsamoilys.co.uk paulsamoilys.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
paulsmithwm.co.uk paulsmithwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pbfwm.co.uk pbfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 114 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
pdprivateclient.co.uk pdprivateclient.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 78 days
UA UA-5583714 Jan 2021 Jan 2021 20 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
pfpwealth.co.uk pfpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
pickeringandryefinancial.co.uk pickeringandryefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 120 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pjlwealthmanagement.com pjlwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 99 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pointtopointfm.co.uk pointtopointfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 123 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
perchardwealthmanagement.co.uk perchardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
prestfieldwm.co.uk prestfieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
pricefp.co.uk pricefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
prjfinancialplanning.co.uk prjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 81 days
UA UA-5583714 Jan 2021 Jan 2021 22 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
pswm.co.uk pswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 101 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 23 days
UA UA-5583714 Jan 2021 Jan 2021 22 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
pwmni.co.uk pwmni.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 114 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 23 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
richardsonhewittfp.co.uk richardsonhewittfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 25 days
UA UA-5583714 Jan 2021 Jan 2021 24 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
rjfinancialplanning.co.uk rjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
buttercrossfp.co.uk buttercrossfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
bpwealthmanagement.co.uk bpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
rogerswealthmanagement.co.uk rogerswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 344 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
rossmitchellwm.com rossmitchellwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
britannicfp.co.uk britannicfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
adwfinancialsolutions.co.uk adwfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 100 days
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
UA UA-5583714 Jan 2021 Feb 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
adrianwhitewm.co.uk adrianwhitewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 124 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
UA UA-5583714 Jan 2021 Feb 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
saragray.co.uk saragray.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
scottsymeswm.co.uk scottsymeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 21 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
akfm.co.uk akfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
sfwm.co.uk sfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jan 2025 3 years, 89 days
HJ HJ-1258234 Dec 2019 Jan 2020 34 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
alexanderdannwealthmanagementltd.co.uk alexanderdannwealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
sharpfs.co.uk sharpfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 87 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 41 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
sheebapadman.co.uk sheebapadman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 309 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 87 days
HJ HJ-1258234 Jan 2020 Feb 2020 52 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
cambriawealth.co.uk cambriawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
cameronjonesfm.com cameronjonesfm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
amandaredmanfp.co.uk amandaredmanfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
sjbettridgefp.co.uk sjbettridgefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 24 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
amberleyhulmewm.co.uk amberleyhulmewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 171 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
sldwealth.co.uk sldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sleightwm.co.uk sleightwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
anchorwmltd.co.uk anchorwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
solosywm.co.uk solosywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 26 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewdavid.co.uk andrewdavid.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
spwealth.co.uk spwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 215 days
HJ HJ-1258234 Dec 2019 Jan 2020 36 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 32 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
sterlingfa.co.uk sterlingfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 284 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
atlanticwc.co.uk atlanticwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
templewoodwealth.co.uk templewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 350 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 35 days
UA UA-5583714 Jan 2021 Feb 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
themjp.co.uk themjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
threehillswealth.co.uk threehillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bassantfs.co.uk bassantfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
beckwealth.co.uk beckwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
benchapmanwealth.co.uk benchapmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
berkleysquarepc.co.uk berkleysquarepc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
bffinancialplanning.co.uk bffinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
bfpwealthmanagement.co.uk bfpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
victoredmonds.co.uk victoredmonds.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 23 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Jan 2020 Mar 2020 48 days
UA UA-5583714 Jan 2021 Feb 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
vtwealth.co.uk vtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 42 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Dec 2019 Jan 2020 43 days
UA UA-5583714 Jan 2021 Feb 2021 42 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
walbrookfinancial.co.uk walbrookfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 42 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
wallwm.co.uk wallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 275 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 42 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wardwealthmanagement.co.uk wardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 42 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
watersdaywm.co.uk watersdaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Jan 2020 Mar 2020 48 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
bowcliffewm.co.uk bowcliffewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
wentworthwm.co.uk wentworthwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
calderwoodwm.co.uk calderwoodwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
chrisbuckland.co.uk chrisbuckland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
circlewealth.co.uk circlewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 80 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
cmpfinancial.co.uk cmpfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
coecapital.co.uk coecapital.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
cruddenfinancialplanning.co.uk cruddenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
davidmasonfp.com davidmasonfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
dmbwealthmanagement.co.uk dmbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
dpfinplan.com dpfinplan.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
eamonncassidy.co.uk eamonncassidy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
ellisonedwardswm.co.uk ellisonedwardswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 194 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
frcfinancialplanning.co.uk frcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2024 2 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 70 days
UA UA-5583714 Jan 2021 Jan 2021 4 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
garyshieldswealthmanagementllp.co.uk garyshieldswealthmanagementllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
gayworrow.co.uk gayworrow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 22 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
gbwealthmanagement.co.uk gbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 244 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
gravitaswm.co.uk gravitaswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Feb 2020 72 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
guthriefps.co.uk guthriefps.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 114 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hackettwealth.co.uk hackettwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 119 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hamptonjamesfa.co.uk hamptonjamesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 119 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hawkinsthomas.co.uk hawkinsthomas.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hawwm.co.uk hawwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2024 3 years, 101 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-1258234 Feb 2020 Mar 2020 31 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
holleronwm.co.uk holleronwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 100 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
hutchinsonfinancialplanningltd.co.uk hutchinsonfinancialplanningltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
ianbellwm.co.uk ianbellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
ianrennardfp.co.uk ianrennardfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
ifswealth.co.uk ifswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 115 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
jbedwards.co.uk jbedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jenningsfp.co.uk jenningsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 273 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
rcawealth.co.uk rcawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
rcwealthmanagement.co.uk rcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
reedmanwm.co.uk reedmanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
reeffc.com reeffc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 82 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rollowm.co.uk rollowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
rozsimcockwealthmanagement.co.uk rozsimcockwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 84 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 39 days
UA UA-5583714 Jan 2021 Jan 2021 25 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
rsr-wm.co.uk rsr-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 117 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 84 days
UA UA-5583714 Jan 2021 Jan 2021 25 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
salterwm.co.uk salterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
samuelcroudacewm.co.uk samuelcroudacewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 27 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
samuellukeswm.co.uk samuellukeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
ajwwealth.co.uk ajwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
ajtwealth.co.uk ajtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 111 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
ajgwealthmanagement.co.uk ajgwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
ajbarnesfinancial.co.uk ajbarnesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
campbellcainwm.co.uk campbellcainwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
alwealthmanagement.co.uk alwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 39 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
aleksjeromel.co.uk aleksjeromel.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
shireswm.co.uk shireswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 23 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
shubhokunduwm.co.uk shubhokunduwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 24 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 87 days
HJ HJ-1258234 Dec 2019 Jan 2020 34 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
annegibsonsjp.co.uk annegibsonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
southdownsfp.co.uk southdownsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 254 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
arw-wm.com arw-wm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
abacuswm.co.uk abacuswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adambentonwm.co.uk adambentonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 124 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
UA UA-5583714 Jan 2021 Feb 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
tailoredsolutionswm.co.uk tailoredsolutionswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 311 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
aswealthmanagement.co.uk aswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
thomas-rigg.co.uk thomas-rigg.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 286 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
bathwealth.co.uk bathwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 40 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
uwmwealth.co.uk uwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 40 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
HJ HJ-1258234 Dec 2019 Mar 2020 90 days
UA UA-5583714 Feb 2021 Mar 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
blenheimwealthmanagement.co.uk blenheimwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
vibrantwealthmanagement.co.uk vibrantwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 41 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Dec 2019 Mar 2020 90 days
UA UA-5583714 Jan 2021 Feb 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
vswealth.co.uk vswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 42 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Dec 2019 Mar 2020 90 days
UA UA-5583714 Jan 2021 Feb 2021 42 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
watchhousewm.co.uk watchhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 105 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 52 days
UA UA-5583714 Feb 2021 Mar 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
westerhamfs.co.uk westerhamfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Feb 2021 Mar 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
whitepeakwm.co.uk whitepeakwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wiltshirewm.co.uk wiltshirewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
burfieldshousewm.co.uk burfieldshousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
cedarswm.co.uk cedarswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
christianjohnwm.co.uk christianjohnwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
chronoswm.co.uk chronoswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
cooksonwm.co.uk cooksonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
countrysidefs.co.uk countrysidefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
cranwellws.co.uk cranwellws.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 69 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
curzonwm.com curzonwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
cyrpaillard.co.uk cyrpaillard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
davidmelrosewm.co.uk davidmelrosewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
dbsfinancial.co.uk dbsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
ddlwealthmanagement.co.uk ddlwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-1258234 Dec 2019 Feb 2020 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
denmanfp.co.uk denmanfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
doreewm.co.uk doreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 266 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
duncannunnwm.co.uk duncannunnwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 46 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
dwjwealth.co.uk dwjwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
dyerandcowm.co.uk dyerandcowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
eawealth.co.uk eawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
enverwm.co.uk enverwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
flavellwm.co.uk flavellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
forbesfinancial.co.uk forbesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
haycockandgricefp.co.uk haycockandgricefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
garymorrisonwm.co.uk garymorrisonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
gcadurham.co.uk gcadurham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Feb 2020 71 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
ginderswm.co.uk ginderswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 57 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Feb 2020 71 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
godfreywealthmanagement.co.uk godfreywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 126 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
guthriewealthconsultancy.co.uk guthriewealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
hadlowedwards.co.uk hadlowedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-1258234 Dec 2019 Feb 2020 65 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
hartleywm.co.uk hartleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 39 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
heritagefc.co.uk heritagefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hesslewoodwm.co.uk hesslewoodwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 74 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hillandcofa.co.uk hillandcofa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
houghtonwm.co.uk houghtonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 153 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hutchinsonwealthmanagement.co.uk hutchinsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
hwlwm.co.uk hwlwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2024 3 years, 99 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
igwm.co.uk igwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 115 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Dec 2019 Dec 2019 10 days
jeanlamb.co.uk jeanlamb.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2023 1 year, 320 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Dec 2019 Dec 2019 12 days
jennerwm.co.uk jennerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
jmswealthmanagement.co.uk jmswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
johncummingswm.co.uk johncummingswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 126 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jopottsfinancialplanning.co.uk jopottsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jpnfinancial.co.uk jpnfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 296 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
julianspencerwm.co.uk julianspencerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
kevindavieswm.co.uk kevindavieswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 311 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kirbyknott.co.uk kirbyknott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 148 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
kudoswealth.com kudoswealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 182 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
lehmannfinancialmanagement.co.uk lehmannfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
lfhwealthmanagement.co.uk lfhwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
lisaleewealthmanagement.co.uk lisaleewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
lukecarless.co.uk lukecarless.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 352 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
marknieldwm.co.uk marknieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
marsonwm.co.uk marsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
meadwm.co.uk meadwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Dec 2019 Dec 2019 20 days
mercianwm.co.uk mercianwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mglwealthmanagement.co.uk mglwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 72 days
UA UA-5583714 Jan 2021 Jan 2021 16 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
mjbfp.co.uk mjbfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 114 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 109 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mkm-wealth.co.uk mkm-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 109 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mountstuartwm.co.uk mountstuartwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 302 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mwcarefeesadvice.co.uk mwcarefeesadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2022 245 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
oakmerewealth.co.uk oakmerewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2024 2 years, 150 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
paularodriguez.co.uk paularodriguez.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
paulbutlerwm.co.uk paulbutlerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
paulmkavanagh.co.uk paulmkavanagh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 345 days
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
peterallensjp.co.uk peterallensjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 22 days
UA UA-5583714 Jan 2021 Jan 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
petermooresjp.co.uk petermooresjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 226 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
portburywealth.co.uk portburywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 127 days
GTM GTM-58PXN8T Jan 2021 May 2021 99 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
UA UA-5583714 Jan 2021 Mar 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
prudentfpa.co.uk prudentfpa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
ptrembeth.co.uk ptrembeth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 81 days
UA UA-5583714 Jan 2021 Jan 2021 22 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
puxleypartnership.co.uk puxleypartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
pwandpartners.co.uk pwandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 339 days
GTM GTM-58PXN8T Jan 2021 May 2021 123 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
UA UA-5583714 Jan 2021 Mar 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
rachaelbellwealthmanagement.co.uk rachaelbellwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 281 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
randallwm.co.uk randallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 15 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 81 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
abbeywealthmanagement.co.uk abbeywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
rodneyspillerwm.co.uk rodneyspillerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
roseassociatesfp.co.uk roseassociatesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rtwwealth.co.uk rtwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
ryleywm.co.uk ryleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 18 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
samrawm.co.uk samrawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
alanhillfp.co.uk alanhillfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
alpewealthmanagement.co.uk alpewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 106 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alisongregorywm.co.uk alisongregorywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
almavalewealthmanagement.co.uk almavalewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
silvertreewm.co.uk silvertreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 24 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
sneddonfp.co.uk sneddonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 348 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
anderson-wealthmanagement.co.uk anderson-wealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
stilgoefm.co.uk stilgoefm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
atlanticwealth.co.uk atlanticwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 120 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 104 days
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
aagwealthmanagement.co.uk aagwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Jan 2020 52 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
thindwealthadvisory.co.uk thindwealthadvisory.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 235 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 1 day
treskelionfp.co.uk treskelionfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2024 2 years, 188 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-1258234 Dec 2019 Mar 2020 89 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
twomeywm.co.uk twomeywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 287 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-1258234 Dec 2019 Mar 2020 89 days
UA UA-5583714 Feb 2021 Mar 2021 35 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
valantineassociates.co.uk valantineassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-1258234 Dec 2019 Mar 2020 90 days
UA UA-5583714 Feb 2021 Mar 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
villageestatesfc.co.uk villageestatesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 41 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-1258234 Dec 2019 Mar 2020 90 days
UA UA-5583714 Jan 2021 Feb 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
watchoakpw.co.uk watchoakpw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Feb 2021 Mar 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
bowaterwealth.co.uk bowaterwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 236 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
westbrookfs.co.uk westbrookfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wharfebank.co.uk wharfebank.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
brianemslie.co.uk brianemslie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
whitewm.co.uk whitewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wilkinsonfinancialmgt.co.uk wilkinsonfinancialmgt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
wjpickering.co.uk wjpickering.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
wolfewealth.co.uk wolfewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
wyefieldwm.co.uk wyefieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 26 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
castellwm.co.uk castellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
claytondenefp.co.uk claytondenefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2022 1 year, 37 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-1258234 Dec 2019 Feb 2020 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
colinjessopp.co.uk colinjessopp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 54 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
colinrexwm.co.uk colinrexwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2022 1 year, 37 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
cotswoldwealth.co.uk cotswoldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
ctpwm.co.uk ctpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 113 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
dalejohnsonwealthmanagement.co.uk dalejohnsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 126 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
daleycroft.co.uk daleycroft.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 264 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
danielburnswm.co.uk danielburnswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 119 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
davidgallagherwm.com davidgallagherwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2024 2 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
djbrewsterfcs.co.uk djbrewsterfcs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
dwbwealth.co.uk dwbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
dwmfp.co.uk dwmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
eadenwm.co.uk eadenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
fisherwealthconsultancy.co.uk fisherwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 125 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
fortemfm.co.uk fortemfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 125 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-1258234 Dec 2019 Feb 2020 70 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
heraldwealth.co.uk heraldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
fyldewealthmanagement.co.uk fyldewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 33 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Feb 2020 71 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
goldsmithwm.co.uk goldsmithwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 121 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
goodallsmith.co.uk goodallsmith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 121 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
gregorywm.co.uk gregorywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2023 2 years, 77 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Dec 2019 Dec 2019 7 days
griersonwm.co.uk griersonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
havenwealthmanagement.co.uk havenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 281 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-1258234 Dec 2019 Feb 2020 64 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
hetalpatelwealth.co.uk hetalpatelwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
ianhuntwm.co.uk ianhuntwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
islinwm.co.uk islinwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 114 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 74 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
jfwealth.co.uk jfwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
johnclementswealthmanagement.co.uk johnclementswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 71 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kearsleyfinancialmanagement.co.uk kearsleyfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kevinmunrofp.co.uk kevinmunrofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
kevinprobertwealthmanagement.co.uk kevinprobertwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 311 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kmosbyfinancial.co.uk kmosbyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 183 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
las-wealth.co.uk las-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2023 2 years, 70 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
leeswm.co.uk leeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2024 2 years, 348 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
liztuccy.co.uk liztuccy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
matrixwp.co.uk matrixwp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
napierlane.com napierlane.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
navigationwm.co.uk navigationwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 112 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
networkventuresfs.co.uk networkventuresfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2024 2 years, 288 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
nicholsonwm.co.uk nicholsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 113 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
nickclarkwm.co.uk nickclarkwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 14 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
osmanwealth.co.uk osmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 12 days
GTM GTM-58PXN8T Jan 2021 May 2021 96 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
paulabicknellwealth.co.uk paulabicknellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 78 days
UA UA-5583714 Jan 2021 Jan 2021 20 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
paulasherlock-cross.co.uk paulasherlock-cross.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
paulgeddeswm.co.uk paulgeddeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pfpswm.com pfpswm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 117 days
HJ HJ-1258234 Dec 2019 Jan 2020 27 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
poundburywealth.co.uk poundburywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
psgwealth.co.uk psgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
queenssquarewealth.co.uk queenssquarewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 227 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 24 days
UA UA-5583714 Jan 2021 Jan 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
rebeccapope.co.uk rebeccapope.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 24 days
UA UA-5583714 Jan 2021 Jan 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
laurencewilkinson.co.uk laurencewilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 310 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
leeblissettwealthmanagement.co.uk leeblissettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
linleyblack.com linleyblack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 148 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lisawickenswm.co.uk lisawickenswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 28 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Dec 2019 Dec 2019 18 days
lmcfinancialplanning.co.uk lmcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lochviewfinancialplanning.co.uk lochviewfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 108 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lombardwealthassociates.co.uk lombardwealthassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lpwealth.co.uk lpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
macintyrewealth.co.uk macintyrewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 105 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mainewealth.co.uk mainewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 47 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
mandersfinancialservices.co.uk mandersfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
marclbennett.co.uk marclbennett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
marcsmelt.co.uk marcsmelt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 20 days
UA UA-5583714 Jan 2021 Jan 2021 15 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
marionsiddall.co.uk marionsiddall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 205 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
maskerywealthmanagement.com maskerywealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 8 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
masonswealthassociates.co.uk masonswealthassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2024 2 years, 198 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
mastersfinancial.co.uk mastersfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
mathieson-financial-services.co.uk mathieson-financial-services.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
melluter.co.uk melluter.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 107 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
merlinwealthmanagement.co.uk merlinwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
michellesheppard.co.uk michellesheppard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 101 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
narwalwm.co.uk narwalwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
nathanind.co.uk nathanind.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
neathercoat.com neathercoat.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
niceassociates.co.uk niceassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
norfolkwealthmanagement.co.uk norfolkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
npfc.co.uk npfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 14 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
oakdalefinancialservices.co.uk oakdalefinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
olcotelappin.co.uk olcotelappin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Jan 2021 19 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
patmclaughlin.co.uk patmclaughlin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
paton-feaver.com paton-feaver.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 118 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
paulwardwealth.co.uk paulwardwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
pentelow-wealth-management.co.uk pentelow-wealth-management.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
pettengellwealth.co.uk pettengellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 120 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
philiphamilton.co.uk philiphamilton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
pollardwealthmanagement.co.uk pollardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 100 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
priteshpankhania.co.uk priteshpankhania.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 24 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
chapel-wealth.co.uk chapel-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
ridlandwealth.co.uk ridlandwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
roburwm.co.uk roburwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
robinson-porteous.co.uk robinson-porteous.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
brownlow.co.uk brownlow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
robinsonwealth.co.uk robinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
broadhurstfm.co.uk broadhurstfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
sandafinancialservice.com sandafinancialservice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 85 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
admitchellfinancialplanning.co.uk admitchellfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
seandownswealthmanagement.co.uk seandownswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 21 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 28 days
UA UA-5583714 Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
alanrutherfordwealth.co.uk alanrutherfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
alexanderswm.co.uk alexanderswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
shenleyprivatewealth.co.uk shenleyprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 23 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
shiptonwealth.co.uk shiptonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 23 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
armstrongswealth.co.uk armstrongswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 281 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
snwfinancialplanning.co.uk snwfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 30 days
UA UA-5583714 Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
andersonwealthplanning.co.uk andersonwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jan 2025 3 years, 71 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
andrewswealth.co.uk andrewswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
stephenpitcher.co.uk stephenpitcher.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 32 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
sullivanwealthmanagement.co.uk sullivanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 141 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
ashleyjai.co.uk ashleyjai.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
taffetsaufferwm.co.uk taffetsaufferwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 31 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
atkinsfinancialmanagement.co.uk atkinsfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 173 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
thederouetpartnership.co.uk thederouetpartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 350 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 8 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
thestrainpractice.co.uk thestrainpractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 33 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 35 days
UA UA-5583714 Jan 2021 Feb 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
timmswealthmanagement.co.uk timmswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 286 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
barneswealthmanagement.co.uk barneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
beauchampwealth.co.uk beauchampwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
tpcwealth.co.uk tpcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2023 1 year, 189 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bedfordwm.co.uk bedfordwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 105 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
trbarbour.co.uk trbarbour.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bellamywealthmanagement.co.uk bellamywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
benningfm.com benningfm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
vcpc.co.uk vcpc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-1258234 Dec 2019 Mar 2020 90 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
blancowealthmanagement.co.uk blancowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 243 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
walkerwm.co.uk walkerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 42 days
wealthandfinancematterslimited.co.uk wealthandfinancematterslimited.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
whitelockfinancialplanning.co.uk whitelockfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 103 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
bullwm.co.uk bullwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
cadmanandco.co.uk cadmanandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 244 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
chasebridgewm.co.uk chasebridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2024 2 years, 338 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
chrisjwilkinson.co.uk chrisjwilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
cliftonwealthmanagement.co.uk cliftonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
colyerassociates.co.uk colyerassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 65 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
coronationwealth.co.uk coronationwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidbeanwealth.co.uk davidbeanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2024 2 years, 344 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
davidhannonwealthmanagement.co.uk davidhannonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
davidmccollwealthmanagement.co.uk davidmccollwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2024 3 years, 78 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
douglasrowefs.co.uk douglasrowefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
easternwealth.co.uk easternwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
eatlywm.co.uk eatlywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 330 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
experiumfinancialservices.co.uk experiumfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
firstchoicefinancial.co.uk firstchoicefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 126 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
franciswealth.co.uk franciswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 124 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
gainsboroughwealthmanagement.co.uk gainsboroughwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
garyhewett.co.uk garyhewett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
gibsonlaingwealth.co.uk gibsonlaingwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
gillespiefinancial.com gillespiefinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
grahamtiney.co.uk grahamtiney.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
grovewealthmanagement.info grovewealthmanagement.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
gsqwealth.co.uk gsqwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
harmansmith.co.uk harmansmith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
hartyltd.co.uk hartyltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
hfinancialplanning.co.uk hfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
hugocraggs.co.uk hugocraggs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
iccwealthmanagement.co.uk iccwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Apr 2023 1 year, 138 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 108 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
irpwealth.co.uk irpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
iwmwealth.co.uk iwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 52 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 106 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
janineedwards.co.uk janineedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
jennymoloney.co.uk jennymoloney.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Jan 2021 10 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
jenybeardsley.co.uk jenybeardsley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
johnsherlock.co.uk johnsherlock.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 79 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
johntavender.co.uk johntavender.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
kanishkswarup.co.uk kanishkswarup.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 312 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
kdmurraywm.co.uk kdmurraywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 12 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
kimdevinefp.co.uk kimdevinefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 35 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
klcfinancial.co.uk klcfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 109 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
joybarden.co.uk joybarden.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jpprivateclients.co.uk jpprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jsfinancialplanning.co.uk jsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
juliantrumper.co.uk juliantrumper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
justinredwards.co.uk justinredwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
kevinwhite.co.uk kevinwhite.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
kingsforestwealth.co.uk kingsforestwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Jan 2021 11 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
kpfinancialwellbeing.co.uk kpfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 109 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
langleyparkwealth.co.uk langleyparkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
leemerrettwealthmanagement.co.uk leemerrettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 181 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
leonardwealthsolutions.co.uk leonardwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lettswealthmanagement.co.uk lettswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
leversedgewm.co.uk leversedgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 109 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lockwoodwealth.co.uk lockwoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 47 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
mandyknox.co.uk mandyknox.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 46 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 5 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
markingarfield.co.uk markingarfield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
marktimmins.com marktimmins.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
martinjonesfinancialservices.co.uk martinjonesfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
matthewwilkeswealthmanagement.co.uk matthewwilkeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mcknightassociates.co.uk mcknightassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
mercuryfinancial.co.uk mercuryfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
moifc.co.uk moifc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
moranprivateclientpractice.co.uk moranprivateclientpractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
murrowwealthmanagement.co.uk murrowwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 151 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
newforestwealthmanagement.co.uk newforestwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
newsomewealthmanagement.co.uk newsomewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
oliverreeve.co.uk oliverreeve.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
redoakwealth.co.uk redoakwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2022 1 year, 59 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 82 days
UA UA-5583714 Jan 2021 Jan 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
patrickwardconsulting.co.uk patrickwardconsulting.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
penrosewealthmanagement.co.uk penrosewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 119 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
penvearnwealthmanagement.co.uk penvearnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 119 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
reliancewealth.co.uk reliancewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 25 days
UA UA-5583714 Jan 2021 Jan 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
petersimonsfinancialservices.co.uk petersimonsfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
phillipsparham.co.uk phillipsparham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 264 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
provestfs.co.uk provestfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 285 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rhodesbrook.co.uk rhodesbrook.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 83 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
castlerockwealth.co.uk castlerockwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
buchananfp.co.uk buchananfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
russellfairbrass.co.uk russellfairbrass.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
ruthhomberger.co.uk ruthhomberger.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 85 days
UA UA-5583714 Jan 2021 Jan 2021 25 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
samuelsfinancial.co.uk samuelsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 2 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adamsonross.co.uk adamsonross.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
sarahquirkassociates.co.uk sarahquirkassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
sarahsiddons.co.uk sarahsiddons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 97 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
alanfilsell.co.uk alanfilsell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 319 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
altonwealth.co.uk altonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
alexcaulder.co.uk alexcaulder.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 336 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
alistairblack.com alistairblack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jan 2025 3 years, 71 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
silverthornwealth.co.uk silverthornwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 24 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
simonroffey.co.uk simonroffey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 24 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
amgwealthmanagement.com amgwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 14 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
smithhobbswealth.co.uk smithhobbswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 30 days
UA UA-5583714 Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
anglianwealthmanagement.co.uk anglianwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
solentwealth.co.uk solentwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2022 179 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
andrewskinnerwealth.co.uk andrewskinnerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
andrewvrettos.co.uk andrewvrettos.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
stevejoyce.co.uk stevejoyce.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 32 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
sussexwealthmanagement.com sussexwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 30 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
swannfinancial.co.uk swannfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
swiftsurewealthmanagement.co.uk swiftsurewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 30 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Feb 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
templemewswm.co.uk templemewswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2024 2 years, 126 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 140 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
avantiwm.co.uk avantiwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
theplattpartnership.com theplattpartnership.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 33 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
UA UA-5583714 Jan 2021 Feb 2021 35 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
thompsonfinancialplanning.co.uk thompsonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 286 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
thompstonewm.co.uk thompstonewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2022 1 year, 66 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
berkeleystjames-wm.co.uk berkeleystjames-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 105 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
blackdownwealthmanagement.co.uk blackdownwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
vinitmehta.co.uk vinitmehta.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 41 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
UA UA-5583714 Feb 2021 Mar 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
bloomerwealth.co.uk bloomerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
welshandtaylorwealth.co.uk welshandtaylorwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 139 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
brittonassociates.co.uk brittonassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
bromileyandpartners.co.uk bromileyandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 116 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
brooksfinancialplanning.co.uk brooksfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
willsfinancial.co.uk willsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
williamsonwm.co.uk williamsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
williamswealthmanagement.co.uk williamswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
willingalewealthmanagement.co.uk willingalewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
wronskiwealthmanagement.co.uk wronskiwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
carlcrossfield.co.uk carlcrossfield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
chalkfarmfinancial.co.uk chalkfarmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
chapman-associates.co.uk chapman-associates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 15 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
chromaticwealth.co.uk chromaticwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
clarenceplace.co.uk clarenceplace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
claywarden.co.uk claywarden.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2023 1 year, 157 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
comfortfinancial.co.uk comfortfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
constantiawealthandfinance.co.uk constantiawealthandfinance.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2024 2 years, 229 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
copperrock.co.uk copperrock.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 246 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
cordata.co.uk cordata.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 69 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
cormackwealthmanagement.co.uk cormackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 May 2024 2 years, 199 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
cornerstonewealthmanagement.co.uk cornerstonewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidsonpert.co.uk davidsonpert.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 193 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
denhamwm.co.uk denhamwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
djswealthadviser.co.uk djswealthadviser.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
flackwellfs.com flackwellfs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 156 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
frazerwealth.co.uk frazerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 124 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
gallimorewealthmanagement.co.uk gallimorewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
goldingandpartners.co.uk goldingandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 359 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
goldwealthmanagement.co.uk goldwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 121 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
greenwealthplanning.co.uk greenwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
greenwoodwealthsolutions.co.uk greenwoodwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
hargreaveswealth.co.uk hargreaveswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
ingramwealthmanagement.co.uk ingramwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 115 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
iqandco.com iqandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 307 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 106 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jamieweller.co.uk jamieweller.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 113 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jlwealthconsultancy.co.uk jlwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
joethomas.info joethomas.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2023 2 years, 102 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Jan 2021 10 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
johnpigott.co.uk johnpigott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2024 2 years, 122 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jolyonhankinson.co.uk jolyonhankinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2022 222 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jonathanjgibbons.co.uk jonathanjgibbons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
reasonwilliamspartnership.co.uk reasonwilliamspartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 228 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
robertapugh.co.uk robertapugh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 282 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
robertpilnick.co.uk robertpilnick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
rosspenman.co.uk rosspenman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 253 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
rwafp.com rwafp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 142 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
adhwealthmanagement.co.uk adhwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
sarahbuckwealthmanagement.co.uk sarahbuckwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 282 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 27 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
scottwallace.co.uk scottwallace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 19 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 128 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
scrivenerfinancial.co.uk scrivenerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 21 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 86 days
UA UA-5583714 Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
sedgwickwm.co.uk sedgwickwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 65 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 28 days
UA UA-5583714 Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
selectinvestors.sg selectinvestors.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 347 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 2 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alisonwright.co.uk alisonwright.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jan 2025 3 years, 71 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
macfarlanewealthpartners.com macfarlanewealthpartners.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
antlerwealth.co.uk antlerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
antonyearley.co.uk antonyearley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
GTM GTM-W2ZFB5N Aug 2021 Jan 2022 153 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
andrewclarey.co.uk andrewclarey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
andrewoliverfinancial.co.uk andrewoliverfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
andrewrogerswm.co.uk andrewrogerswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
andybarrettsjp.co.uk andybarrettsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 125 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
sterlingwealthmanagement.co.uk sterlingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 289 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
stevenheyes.co.uk stevenheyes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 284 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
stevereeswealthmanagement.co.uk stevereeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 32 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
storercfp.co.uk storercfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
carpenterwealthmanagement.co.uk carpenterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 102 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
athertonandassociates.co.uk athertonandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
terencegoddardassociates.co.uk terencegoddardassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 35 days
UA UA-5583714 Jan 2021 Feb 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
avonwoodfinancial.co.uk avonwoodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 77 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
thegrahamharmspractice.co.uk thegrahamharmspractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 33 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 35 days
UA UA-5583714 Jan 2021 Feb 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
ballantinewm.co.uk ballantinewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
throgmortonassociates.co.uk throgmortonassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
batchworthwealth.co.uk batchworthwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
beckfordandlewis.co.uk beckfordandlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
bennisonyates.co.uk bennisonyates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 49 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
bhtwealthmanagement.co.uk bhtwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
blackwaterwealthmanagement.co.uk blackwaterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
blossomwealth.co.uk blossomwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
vittyalexander.co.uk vittyalexander.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 305 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 112 days
UA UA-5583714 Feb 2021 Mar 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
bootefinancial.co.uk bootefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
breretonjacksonfinancial.co.uk breretonjacksonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
wilcoxday.co.uk wilcoxday.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Feb 2021 Mar 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
bryantassociates.co.uk bryantassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
wilkinsonwealth.co.uk wilkinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 108 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
callumleachwm.co.uk callumleachwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 245 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
cedarvalegroup.co.uk cedarvalegroup.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
cmjfinancialplanning.co.uk cmjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 286 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
cockbainassociates.co.uk cockbainassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
coenandclark.co.uk coenandclark.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
corneliuswealth.co.uk corneliuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
crawforddean.co.uk crawforddean.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
davewalkerwealthmanagement.co.uk davewalkerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 193 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
davidhillwealth.co.uk davidhillwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
davidmakin.co.uk davidmakin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
deltawealth.co.uk deltawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
doweswealthmanagement.co.uk doweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2024 2 years, 347 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
drewharperfinancialconsultants.co.uk drewharperfinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
edenwoodwealth.com edenwoodwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
edmundwilson.co.uk edmundwilson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
elliottwealthmanagement.co.uk elliottwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
financialwealthsolutions.co.uk financialwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
firmitasfs.co.uk firmitasfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
florastamato.co.uk florastamato.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 125 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
frankmcmillan.co.uk frankmcmillan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 124 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
garryjohnsonwealthmanagement.co.uk garryjohnsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
hayesfinancialplanning.com hayesfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
hayeswealthmanagement.co.uk hayeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 80 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
gildedwealth.co.uk gildedwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
gillisfinancial.co.uk gillisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2023 1 year, 204 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
grahamwealthmanagement.co.uk grahamwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2024 2 years, 260 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
greavesfinancialservices.co.uk greavesfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
gregjmiddleton.co.uk gregjmiddleton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Jan 2021 6 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
harnhill.com harnhill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
harriesfinancial.co.uk harriesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
hartfordwealth.co.uk hartfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
horizonwealthconsultancy.co.uk horizonwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
howardfinancialplanning.co.uk howardfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 54 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
iancrookwm.co.uk iancrookwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 12 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
impactwm.co.uk impactwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2024 2 years, 350 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
GTM GTM-58PXN8T May 2021 Jun 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
investasure.co.im investasure.co.im
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 114 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
jamielewington.co.uk jamielewington.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2022 50 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 11 days
UA UA-5583714 Jan 2021 Jan 2021 10 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
jeremybarrett.co.uk jeremybarrett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
jerimeattah.co.uk jerimeattah.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 257 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jon-paulhardy.co.uk jon-paulhardy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jonathangrantwealth.co.uk jonathangrantwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
jonpittey.co.uk jonpittey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 238 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
juliedaweswealthmanagement.co.uk juliedaweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
juliehowiesonwealthmanagement.co.uk juliehowiesonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2024 2 years, 174 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kathwilkinson.co.uk kathwilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
kennettwealthmanagement.co.uk kennettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
keystonefinancial.co.uk keystonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
kineticwealthmanagement.co.uk kineticwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lenwalters.co.uk lenwalters.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 310 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lesterbrunt.co.uk lesterbrunt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 321 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
lisaeveritt.co.uk lisaeveritt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
littlepebbles.co.uk littlepebbles.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lockingtonfinancial.co.uk lockingtonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
louisewoollardfinancial.co.uk louisewoollardfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 106 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lynnanderson.co.uk lynnanderson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2023 2 years, 68 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
malcolmfrost.co.uk malcolmfrost.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
marquewealth.co.uk marquewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
martellowealth.co.uk martellowealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jan 2025 2 years, 363 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
masperoassociates.co.uk masperoassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
matthewgreenhalgh.co.uk matthewgreenhalgh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
maylamfinancial.co.uk maylamfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 102 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
mbarclay.co.uk mbarclay.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Jan 2021 15 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
mbwwealthmanagement.co.uk mbwwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
HJ HJ-1258234 Dec 2019 Dec 2019 20 days
mellingfp.co.uk mellingfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
michaelkiener.co.uk michaelkiener.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 108 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
myerswealthmanagement.co.uk myerswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 111 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
neilforeman.co.uk neilforeman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 207 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 21 days
UA UA-5583714 Jan 2021 Jan 2021 18 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
newmanrea.com newmanrea.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 278 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
nickspence.co.uk nickspence.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
nigelcookewm.co.uk nigelcookewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
njwealthplanning.co.uk njwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
oreillywealthmanagement.co.uk oreillywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 12 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T May 2021 May 2021 One Off
paulmorganwealthmanagement.co.uk paulmorganwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
rickettsfp.co.uk rickettsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
pdfinancialmanagement.co.uk pdfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 119 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
penninewealthmanagement.co.uk penninewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
peter-walmsley.co.uk peter-walmsley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 79 days
UA UA-5583714 Jan 2021 Jan 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
peterwildwealth.co.uk peterwildwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 16 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
pjwwealth.co.uk pjwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 148 days
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
primusfinancial.co.uk primusfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
priorywealthmanagement.co.uk priorywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 227 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 148 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
prosperawealth.co.uk prosperawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rajivprabhakar.co.uk rajivprabhakar.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 154 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
richardbrewster.co.uk richardbrewster.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
richardcbooth.co.uk richardcbooth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 25 days
richardjkbrown.co.uk richardjkbrown.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 25 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
rmbfc.co.uk rmbfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
lorrainecoaton.co.uk lorrainecoaton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 106 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
rsrobertsonfp.co.uk rsrobertsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 229 days
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
lucialangella.co.uk lucialangella.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 106 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
accessionrwm.co.uk accessionrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
adamsandbowleswm.co.uk adamsandbowleswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
sarahmhughes.co.uk sarahmhughes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 229 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sarahspraguewealthmanagement.co.uk sarahspraguewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Jan 2020 Feb 2020 52 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
savvideswealthmanagement.co.uk savvideswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 346 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
scottjamesandassociates.co.uk scottjamesandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 21 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
shaunajhappan.co.uk shaunajhappan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 22 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
alexziff.com alexziff.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Feb 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
simonbraywm.co.uk simonbraywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
simonlipp.co.uk simonlipp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 24 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
smartinfinancialplanning.co.uk smartinfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 230 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 30 days
UA UA-5583714 Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
smithjackson.co.uk smithjackson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
askwealthmanagement.co.uk askwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
andersonfinancial.co.uk andersonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
andrewconnolly.co.uk andrewconnolly.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
spillaneandcompany.co.uk spillaneandcompany.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
carterlegrand.co.uk carterlegrand.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
casewealth.co.uk casewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
stanleyfinancial.co.uk stanleyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 144 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
stevenswealthmanagement.co.uk stevenswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 32 days
UA UA-5583714 Jan 2021 Feb 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
stwwealth.co.uk stwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 231 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
swindonfinancialservices.com swindonfinancialservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 31 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 33 days
UA UA-5583714 Jan 2021 Feb 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
taitfinancialservices.co.uk taitfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 31 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 34 days
UA UA-5583714 Jan 2021 Feb 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
tarnwealthmanagement.co.uk tarnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 31 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
UA UA-5583714 Jan 2021 Feb 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
tcolleyassociates.co.uk tcolleyassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 31 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
UA UA-5583714 Jan 2021 Feb 2021 33 days
taylorfinancial.co.uk taylorfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 31 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 34 days
UA UA-5583714 Jan 2021 Feb 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
thomaswealthadvisory.co.uk thomaswealthadvisory.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 286 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
thomlinsonwealthmanagement.co.uk thomlinsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bathandwestwealth.co.uk bathandwestwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 99 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
trevorngraham.co.uk trevorngraham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 287 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 114 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
twelvewm.co.uk twelvewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
UA UA-5583714 Feb 2021 Mar 2021 35 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
bhwml.co.uk bhwml.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
virtuewealthsolutions.co.uk virtuewealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 41 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
westgatewealth.co.uk westgatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
bricknellwealth.co.uk bricknellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 262 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
bridgesandco.co.uk bridgesandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
broadcharepartners.co.uk broadcharepartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
willgcunningham.co.uk willgcunningham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 289 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
willowbrooklfp.co.uk willowbrooklfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
wilsonwealthmanagement.co.uk wilsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
woodheadwm.co.uk woodheadwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 96 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
woodstockwealthmanagement.co.uk woodstockwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
wrightshadwell.co.uk wrightshadwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 25 days
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
burn-joneswealthmanagement.co.uk burn-joneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
burtonhills.co.uk burtonhills.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
capitalplanningpartners.co.uk capitalplanningpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
cathedralgreenfinancialplanning.co.uk cathedralgreenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
clearwaterwealthmanagement.co.uk clearwaterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2022 265 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
coldfairwealthmanagement.co.uk coldfairwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 44 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
colefinancial.co.uk colefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
corinthianwealthmanagement.co.uk corinthianwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
craigjameswm.co.uk craigjameswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 69 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
dalviwealth.co.uk dalviwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 60 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
darronchildspractice.co.uk darronchildspractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 4 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
davidkeddie.co.uk davidkeddie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
daviswealth.co.uk daviswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
deltachelmsford.co.uk deltachelmsford.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
educate-financial.co.uk educate-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
edwardjowilson.co.uk edwardjowilson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
ejwm.co.uk ejwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 95 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
equinoxfinancialplanning.co.uk equinoxfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 128 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Jan 2021 2 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
farrowwealth.co.uk farrowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
flynnwealthmanagement.co.uk flynnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 125 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
garywalker.co.uk garywalker.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
genoawealthmanagement.co.uk genoawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2024 2 years, 179 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
gregthomsonwealth.co.uk gregthomsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
grovewoodwealth.co.uk grovewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
hallandcostellowealthmanagement.co.uk hallandcostellowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 114 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
hamesassociates.co.uk hamesassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 119 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
hamwicwealth.co.uk hamwicwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 119 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
highhousewealth.co.uk highhousewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
hilljohnstone.co.uk hilljohnstone.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
howefinancialadvisers.co.uk howefinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
invictuswealth.co.uk invictuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 114 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
iptucker.co.uk iptucker.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 114 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
jameselliottwealthmanagement.co.uk jameselliottwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2024 3 years, 94 days
GTM GTM-58PXN8T Jan 2021 May 2021 121 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jpswealthmanagement.co.uk jpswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 197 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kgrwealth.co.uk kgrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 248 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 97 days
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
kpwoodandassociates.co.uk kpwoodandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 109 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
lambert-wealth.co.uk lambert-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2024 2 years, 348 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 103 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
latorrewealthmanagement.co.uk latorrewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
leedowdall.com leedowdall.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
littlewickwealthmanagement.co.uk littlewickwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 69 days
UA UA-5583714 Jan 2021 Jan 2021 13 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
ljwealthmanagement.co.uk ljwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
GTM GTM-58PXN8T May 2021 Jun 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
louisewarland.co.uk louisewarland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2024 2 years, 173 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
magorwealthmanagement.co.uk magorwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 191 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mardons.co.uk mardons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Feb 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
markkidd.co.uk markkidd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
GTM GTM-58PXN8T Mar 2021 May 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
marshallwealthmanagement.co.uk marshallwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
martinkeyte.co.uk martinkeyte.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
matthewjohnrowland.co.uk matthewjohnrowland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2022 132 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
matthewwykes.co.uk matthewwykes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
mccuewealthmanagement.co.uk mccuewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
mcleanandpartnerswm.co.uk mcleanandpartnerswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Feb 2020 58 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
mercerandassociates.co.uk mercerandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
metcalfewealth.co.uk metcalfewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
michaelmacauley.co.uk michaelmacauley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 17 days
UA UA-5583714 Jan 2021 Jan 2021 16 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
murraywealthmanagement.co.uk murraywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 93 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
newmanlangley.co.uk newmanlangley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 141 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
nickcumminswealthmanagement.co.uk nickcumminswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
oloughlinandco.co.uk oloughlinandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
UA UA-5583714 Jan 2021 Jan 2021 19 days
palmerwealth.co.uk palmerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 279 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 78 days
UA UA-5583714 Jan 2021 Jan 2021 20 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
papewealthmanagement.co.uk papewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 118 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pdavisfinancial.co.uk pdavisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 119 days
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
persellewart.co.uk persellewart.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 24 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
plummerandassociates.co.uk plummerandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 99 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
pritchardwm.co.uk pritchardwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 24 days
UA UA-5583714 Jan 2021 Jan 2021 22 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
probertwealthmanagement.co.uk probertwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 14 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 81 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
quaysidewealthmanagement.co.uk quaysidewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 15 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 81 days
UA UA-5583714 Jan 2021 Jan 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
reeswealthmanagement.co.uk reeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 24 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
legacywealth.sg legacywealth.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lifeandlegacywm.co.uk lifeandlegacywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
lifetimeconnections.co.uk lifetimeconnections.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
mansionhousefp.co.uk mansionhousefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
minsterwealthmanagement.co.uk minsterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 136 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
moorewealth.co.uk moorewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 93 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
one-wealth.co.uk one-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 282 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 77 days
UA UA-5583714 Jan 2021 Jan 2021 19 days
paulgschofield.co.uk paulgschofield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
petergavin.net petergavin.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
rhiannongoghfp.co.uk rhiannongoghfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
robertshawsidlow-wealth.co.uk robertshawsidlow-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
rppw.co.uk rppw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
mgwealth.co.uk mgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
silverdomefinancial.co.uk silverdomefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 104 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
sjp.co.uk sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
smtwealth.co.uk smtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 271 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
andrewwhiting.co.uk andrewwhiting.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 15 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 13 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
stroudwm.co.uk stroudwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 311 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
templecloudwm.co.uk templecloudwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2022 254 days
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
barnesrobertson.com barnesrobertson.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
walfordwealth.co.uk walfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Feb 2021 42 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
willgrace.co.uk willgrace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 347 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
coulterweir.co.uk coulterweir.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
frizzellandpartners.co.uk frizzellandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
graywealth.co.uk graywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 79 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
hallwealth.co.uk hallwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
jamiecalder.co.uk jamiecalder.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
johncharper.co.uk johncharper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
keithwilliamsfinancial.co.uk keithwilliamsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
miwealth.co.uk miwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
regencywealthltd.co.uk regencywealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 211 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
pinnaclewealth.co.uk pinnaclewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
polarisfp.co.uk polarisfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2023 1 year, 179 days
GTM GTM-58PXN8T Mar 2021 May 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
rherbert.co.uk rherbert.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
richardpaddle.com richardpaddle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
ridley-jones.co.uk ridley-jones.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 286 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
robertcompton.co.uk robertcompton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
sjpp.asia sjpp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 May 2021 107 days
UA UA-5583714 Feb 2021 Mar 2021 45 days
andrewspillane.co.uk andrewspillane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
andrewtodd-sjp.co.uk andrewtodd-sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
speightwealthmanagement.co.uk speightwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sterlingsolutionsltd.co.uk sterlingsolutionsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
stowwm.co.uk stowwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 117 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
swhfp.co.uk swhfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Dec 2024 2 years, 10 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
tandhfinancialplanning.co.uk tandhfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 142 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
ayeshakhanfinancialplanning.co.uk ayeshakhanfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
victoria-lawson.co.uk victoria-lawson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 80 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Feb 2021 41 days
williamsandassociatesfa.co.uk williamsandassociatesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 166 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 135 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
woodruffhill.co.uk woodruffhill.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Feb 2021 45 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
cassidyfinancial.co.uk cassidyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
crusewealth.com crusewealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
darrenford.co.uk darrenford.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 126 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
hawthornewealthmanagement.com hawthornewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 111 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
hillcrestwm.co.uk hillcrestwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2024 3 years, 97 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 110 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
illingworthseddon.co.uk illingworthseddon.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 81 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
jayramfinancialservices.co.uk jayramfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 24 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 6 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rjvaughanwealth.co.uk rjvaughanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 84 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
russellpikefinancial.co.uk russellpikefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 85 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
schoolfeessolutions.co.uk schoolfeessolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
simplicityfp.co.uk simplicityfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 24 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
sjpfoundation.co.uk sjpfoundation.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 38 days
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
apwealth.co.uk apwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
srjwm.co.uk srjwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 114 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
stefaniepricewealth.co.uk stefaniepricewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
thegroveprivatewealthltd.co.uk thegroveprivatewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 286 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
davidjwalsh.co.uk davidjwalsh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
demellowandco.com demellowandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
dominicmarcus.co.uk dominicmarcus.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
dsmcdermottfinancialplanning.co.uk dsmcdermottfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 170 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
foremostfinancial.net foremostfinancial.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 125 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 89 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
gardnerwealthmanagement.co.uk gardnerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
glencastlefs.co.uk glencastlefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 122 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
gqwm.co.uk gqwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 121 days
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
guildfordfinancial.co.uk guildfordfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 111 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
hampshirefinancialplanning.co.uk hampshirefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 79 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jacquinorman.co.uk jacquinorman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 113 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 106 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
lizmaudsleyfinancialplanning.co.uk lizmaudsleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 107 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 102 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
ltcsolutionsltd.co.uk ltcsolutionsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
GTM GTM-W2ZFB5N Mar 2022 Jun 2022 74 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
meridianadvice.co.uk meridianadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
mooreforwealth.co.uk mooreforwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 30 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
nbwealthmanagement.co.uk nbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
oakridge-partners.co.uk oakridge-partners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
richardjdavies.co.uk richardjdavies.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 83 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
richardmarshall.co.uk richardmarshall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
perowealthmanagement.co.uk perowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
placidgonzales.co.uk placidgonzales.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jan 2021 23 days
UA UA-5583714 Jan 2021 Jan 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
rppw.sg rppw.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 122 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
allenfinancial.co.uk allenfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
alfristonwealth.co.uk alfristonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jan 2025 2 years, 363 days
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
apexfinancialservices.co.uk apexfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
carterlane.co.uk carterlane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Mar 2021 Mar 2021 11 days
stevensonwealthplanning.co.uk stevensonwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 105 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 5 days
stuartdavieswealthconsultancy.co.uk stuartdavieswealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 29 days
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
sunflowerfinancialplanning.co.uk sunflowerfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 29 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 33 days
UA UA-5583714 Jan 2021 Feb 2021 32 days
sutherlandmayfairwm.co.uk sutherlandmayfairwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
GTM GTM-W2ZFB5N Dec 2021 Dec 2021 One Off
baggermanwm.co.uk baggermanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
whittowwilliamswalkerllp.co.uk whittowwilliamswalkerllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
williamsbirley.co.uk williamsbirley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Feb 2021 43 days
capitolfinancial.co.uk capitolfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 102 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
capstone-financial.co.uk capstone-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
coleridgewm.co.uk coleridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Feb 2020 Mar 2020 38 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
consiliumwmltd.co.uk consiliumwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 99 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
gdcfinancialadvisers.co.uk gdcfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 87 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
germainfinancial.co.uk germainfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 114 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
gilsongrayfinancial.co.uk gilsongrayfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 122 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 112 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
hearndenandwestonwm.co.uk hearndenandwestonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-1258234 Dec 2019 Feb 2020 72 days
hemmensfinancial.co.uk hemmensfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 39 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 110 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
hydewealthmanagement.co.uk hydewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
jamesbarnett.co.uk jamesbarnett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2024 2 years, 122 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
jamescurriefinancialsolutions.co.uk jamescurriefinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 121 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jamestrickett.co.uk jamestrickett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
lombardprivateclients.co.uk lombardprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
maclennanwealth.co.uk maclennanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 105 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
mandyrodgers.co.uk mandyrodgers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 104 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 171 days
UA UA-5583714 Jan 2021 Jan 2021 14 days
mayflowerfinancialplanning.co.uk mayflowerfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 220 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mikestarkeywealthmanagement.co.uk mikestarkeywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
milesnovotny.co.uk milesnovotny.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 22 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 3 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
millfieldwm.com millfieldwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
modus-wealth.co.uk modus-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
nigelhelen.co.uk nigelhelen.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pathwaywealthmanagement.co.uk pathwaywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Mar 2021 May 2021 40 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
pellegriniandbarlowassociates.co.uk pellegriniandbarlowassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
GTM GTM-58PXN8T Jan 2021 May 2021 119 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
pineapplefp.co.uk pineapplefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
quantumprivateclients.co.uk quantumprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 306 days
GTM GTM-58PXN8T Mar 2021 May 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
regencywm.co.uk regencywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
lwcwealthmanagement.co.uk lwcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
middletonfp.co.uk middletonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
mjwsjp.co.uk mjwsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
neavewealth.co.uk neavewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
opawealthmanagement.co.uk opawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
pricewhitinghodgson.co.uk pricewhitinghodgson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2023 1 year, 182 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
richardtidy.co.uk richardtidy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2024 2 years, 96 days
HJ HJ-1258234 Dec 2019 Jan 2020 31 days
bruceandassociates.co.uk bruceandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sdhandawealthmanagement.co.uk sdhandawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2024 2 years, 292 days
HJ HJ-1258234 Dec 2019 Jan 2020 33 days
selectinvestors.hk selectinvestors.hk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Apr 2022 173 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
amwm.co.uk amwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 119 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
spillaneassociates.co.uk spillaneassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
srmfinancial.co.uk srmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2024 2 years, 78 days
HJ HJ-1258234 Dec 2019 Jan 2020 36 days
aswwm.co.uk aswwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
tempuswealth.co.uk tempuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
thompsonnorburyfinancialplanning.co.uk thompsonnorburyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Oct 2023 1 year, 53 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
tim-watts.co.uk tim-watts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 286 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
timramptonwealthmanagement.com timramptonwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 291 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
tmpwealthmanagement.co.uk tmpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 36 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
ubuntuwealthmanagement.co.uk ubuntuwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 May 2023 296 days
HJ HJ-1258234 Dec 2019 Mar 2020 89 days
beyondwm.co.uk beyondwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
unaking.co.uk unaking.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 256 days
HJ HJ-1258234 Dec 2019 Jan 2020 41 days
blakebrooke.co.uk blakebrooke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
vickykleboe.co.uk vickykleboe.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 102 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
brecklandfinancialmanagement.co.uk brecklandfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
brewsterfinancialplanning.co.uk brewsterfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
westwealthmanagement.co.uk westwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 301 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
whitfieldwealth.co.uk whitfieldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 112 days
bsjfinancialplanning.co.uk bsjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 358 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 2 days
calderwealthmanagement.co.uk calderwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 321 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 77 days
charlottepoolegraham.co.uk charlottepoolegraham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 43 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
clearwaterwm.co.uk clearwaterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
drpwm.com drpwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
drsaqibkarim.co.uk drsaqibkarim.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
duncanmaw.co.uk duncanmaw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Aug 2022 133 days
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
farisnori.co.uk farisnori.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
frizzellwm.co.uk frizzellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 124 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 88 days
gpfp.co.uk gpfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
kaplan-planwell.co.uk kaplan-planwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
krc-wealth-management.co.uk krc-wealth-management.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
marklowewm.co.uk marklowewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
martastonesfm.co.uk martastonesfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 43 days
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
mjonesandco.co.uk mjonesandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
msestatesandfinancialservices.co.uk msestatesandfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
ninewealth.co.uk ninewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 37 days
oakridgewealth.co.uk oakridgewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
rnpwealth.co.uk rnpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2024 2 years, 290 days
HJ HJ-1258234 Dec 2019 Jan 2020 31 days
bowbrookfp.co.uk bowbrookfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
adeptiowm.co.uk adeptiowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
adamjameswm.co.uk adamjameswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 124 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
allardwhiteley.co.uk allardwhiteley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jul 2023 1 year, 261 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
allensykeswm.com allensykeswm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
mimigom.co.uk mimigom.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 221 days
HJ HJ-1258234 Dec 2019 Dec 2019 21 days
deptagency.com sjp-partner-nginx-prd-asia.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
anthonyanderson.co.uk anthonyanderson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 39 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sophiederouet.co.uk sophiederouet.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 44 days
HJ HJ-1258234 Dec 2019 Jan 2020 35 days
andrewhugheswm.co.uk andrewhugheswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
stringermann.com stringermann.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 29 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
suffolkfp.co.uk suffolkfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
GTM GTM-W2ZFB5N Sep 2022 Sep 2022 One Off
tedreesltd.co.uk tedreesltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
avocetwealth.co.uk avocetwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 9 days
avonwoodfinancialplanning.co.uk avonwoodfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 320 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
tywm.co.uk tywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 70 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
wandco-fp.co.uk wandco-fp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
btmwealth.co.uk btmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
willgrasscornishwealthmanagement.co.uk willgrasscornishwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
willgrasswealthmanagement.co.uk willgrasswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
carringtonbond.co.uk carringtonbond.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 358 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
zenithfinancial.co.uk zenithfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cooperassociateswm.com cooperassociateswm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
danielgreenwm.co.uk danielgreenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 126 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
davidjohnsonfp.co.uk davidjohnsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
denmanwealthmanagement.co.uk denmanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 45 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
eatonwealthmanagement.co.uk eatonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Jan 2025 2 years, 227 days
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
ellisonwealth.co.uk ellisonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 129 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
integralwm.co.uk integralwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 114 days
HJ HJ-1258234 Dec 2019 Feb 2020 74 days
ivanhoefp.co.uk ivanhoefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 240 days
HJ HJ-1258234 Dec 2019 Feb 2020 74 days
jamesbournewm.com jamesbournewm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 113 days
HJ HJ-1258234 Dec 2019 Feb 2020 74 days
acwwealthmanagement.co.uk acwwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 95 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
sandgatewealth.co.uk sandgatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 156 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
advisorycube.co.uk advisorycube.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 170 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
shearwoodfinancialmanagement.co.uk shearwoodfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 23 days
HJ HJ-1258234 Dec 2019 Jan 2020 34 days
deptagency.com sjp-partner-nginx-prd.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
antlerwealth.com antlerwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 256 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
stephenhopewealthmanagement.com stephenhopewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
strategicwealthsolutions.co.uk strategicwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 7 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
avonwoodfinancialplanning.com avonwoodfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 320 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
awwealth.co.uk awwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 1 day
thinkfinancialwealthmanagement.co.uk thinkfinancialwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 268 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
tomricketts.co.uk tomricketts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 216 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
waymarkerfinancial.co.uk waymarkerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
bridgegatewm.co.uk bridgegatewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
westwellwm.co.uk westwellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 91 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
whitepeakwm.uk whitepeakwm.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 53 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
calderwoodswm.co.uk calderwoodswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 42 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
catherinerichardson.co.uk catherinerichardson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 11 days
cgafinancial.co.uk cgafinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
chartsmorewealthltd.co.uk chartsmorewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cheshirelifestyle.com cheshirelifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2025 1 year, 127 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
clachanviewwm.co.uk clachanviewwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
claremont-financial.co.uk claremont-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cogentfinancial.co.uk cogentfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cowgillwealthmanagement.co.uk cowgillwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Jan 2025 2 years, 337 days
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
cpfc.org.uk cpfc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
crossleythompson.co.uk crossleythompson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
dalemurtenwealthmanagement.co.uk dalemurtenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
edwardsandpringle.co.uk edwardsandpringle.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
majoroakwm.co.uk majoroakwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Jan 2025 2 years, 37 days
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
hsprivatewealth.co.uk hsprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 64 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
innoviawm.co.uk innoviawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 77 days
HJ HJ-1258234 Dec 2019 Dec 2019 11 days
isaacwealth.co.uk isaacwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jacksonfinancial.co.uk jacksonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2024 2 years, 230 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jasonbellissimo.co.uk jasonbellissimo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 184 days
HJ HJ-1258234 Dec 2019 Feb 2020 74 days
joejoblingwealthmanagement.co.uk joejoblingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
johngoldiewm.co.uk johngoldiewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
johnpeoples.co.uk johnpeoples.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Feb 2022 37 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
libertywm.co.uk libertywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 77 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
lionbridgewealth.co.uk lionbridgewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2023 2 years, 69 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
markbeverley.co.uk markbeverley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 103 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
mendipwm.co.uk mendipwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jan 2025 2 years, 362 days
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
oakwaywm.co.uk oakwaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
rabeyaislam.co.uk rabeyaislam.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 241 days
HJ HJ-1258234 Dec 2019 Jan 2020 30 days
richardjhewlett.co.uk richardjhewlett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
acjordanwealthmanagement.co.uk acjordanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 222 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sharpwm.co.uk sharpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 283 days
HJ HJ-1258234 Dec 2019 Jan 2020 34 days
steggleswm.co.uk steggleswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
stricklandwealthmanagement.co.uk stricklandwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 20 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
avonwoodfinancial.com avonwoodfinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 40 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
tilikumwealth.co.uk tilikumwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 88 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
towerhousewm.co.uk towerhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 36 days
GTM GTM-58PXN8T May 2021 Jun 2021 9 days
trbeardwealth.co.uk trbeardwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 89 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
wadewealthmanagement.co.uk wadewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 112 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
waltierwealthmanagement.co.uk waltierwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
boundstonewm.co.uk boundstonewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 19 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
whcfp.co.uk whcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 115 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
brightsidewealthmanagement.co.uk brightsidewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
chrishillsfc.co.uk chrishillsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cotterell-wilkie.co.uk cotterell-wilkie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
crownwealth.co.uk crownwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2024 2 years, 242 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cuthbertsonwealthmanagement.com cuthbertsonwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidwilkinsonsjp.co.uk davidwilkinsonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
debenprivatewealth.co.uk debenprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 127 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
denmanfp.com denmanfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 5 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
hexafinancialplanning.co.uk hexafinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jonathanstorrwm.co.uk jonathanstorrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
kbruce.co.uk kbruce.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2022 50 days
HJ HJ-1258234 Dec 2019 Dec 2019 14 days
markproberts.co.uk markproberts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
mphwealthmanagement.co.uk mphwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
ovieo.co.uk ovieo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
sjp.asia partnership.sjp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 123 days
sjp.co.uk partnership.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
qafp.co.uk qafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Jan 2025 342 days
HJ HJ-1258234 Dec 2019 Jan 2020 29 days
ksfinancialadvisers.co.uk ksfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jan 2025 2 years, 292 days
kwmfp.co.uk kwmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2024 2 years, 129 days
lansdownplace.co.uk lansdownplace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
lauriefp.co.uk lauriefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2023 175 days
legatumwealthmanagement.co.uk legatumwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 May 2024 2 years, 6 days
lewingtonwealth.co.uk lewingtonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Jan 2025 2 years, 329 days
linkswealthmanagement.co.uk linkswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 124 days
malcolmgibsonwealthmanagement.co.uk malcolmgibsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Jan 2025 1 year, 323 days
lochranzawealth.co.uk lochranzawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2024 Dec 2024 188 days
loswealth.co.uk loswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 106 days
mackiewealthmanagement.co.uk mackiewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 22 days
macphail-kennedy.co.uk macphail-kennedy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Jan 2025 2 years, 217 days
malikzadafp.co.uk malikzadafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Jan 2025 2 years, 147 days
markedwardswm.co.uk markedwardswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
markgolesworthy.co.uk markgolesworthy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 103 days
mbfinancial-planning.co.uk mbfinancial-planning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jun 2023 One Off
mcgrathwm.co.uk mcgrathwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
mdslackwealthmanagement.co.uk mdslackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Jan 2025 2 years, 118 days
michaeldaywm.co.uk michaeldaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 20 days
milnewealth.co.uk milnewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Jan 2025 1 year, 46 days
mkkwealthmanagement.co.uk mkkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
rajrayarel.com rajrayarel.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
monteaglewm.co.uk monteaglewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Jan 2025 2 years, 76 days
morgancfp.co.uk morgancfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
mrfinancial.info mrfinancial.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
mulberrytreewealth.co.uk mulberrytreewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 120 days
municipalfp.co.uk municipalfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 120 days
nbwealth.co.uk nbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 23 days
neilmitchellfm.com neilmitchellfm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 23 days
neilmorrisfinancial.co.uk neilmorrisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 240 days
centurywealthmanagement.co.uk centurywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 96 days
nickcarterwm.co.uk nickcarterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
nicolamanfrediwm.co.uk nicolamanfrediwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
njholmeswealth.co.uk njholmeswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
maplewoodwealth.co.uk maplewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jan 2025 1 year, 276 days
northwealthmanagement.co.uk northwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2024 2 years, 286 days
npswealth.co.uk npswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
marcnorris.co.uk marcnorris.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
oaktreefinancial.asia oaktreefinancial.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
ockendenfp.co.uk ockendenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 125 days
ofarrellwealth.co.uk ofarrellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 25 days
oliverwm.co.uk oliverwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Feb 2023 1 year, 145 days
markeldor.co.uk markeldor.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Jan 2025 1 year, 323 days
orchardfinancialassociates.co.uk orchardfinancialassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2024 1 year, 7 days
orestonewealth.co.uk orestonewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 81 days
paulmwilliams.co.uk paulmwilliams.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
peakfifteenfp.co.uk peakfifteenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2024 1 year, 200 days
peakpf.co.uk peakpf.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Dec 2024 1 year, 93 days
pennygatefinancialassociates.co.uk pennygatefinancialassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2024 1 year, 321 days
philippotterwealth.co.uk philippotterwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 344 days
markpattersonfp.co.uk markpattersonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Jan 2025 2 years, 37 days
ptpwealthmanagement.co.uk ptpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
quartzfinancialplanning.co.uk quartzfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Sep 2024 279 days
quaylifewm.co.uk quaylifewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2024 2 years, 217 days
reignwm.co.uk reignwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 31 days
rhodianwm.co.uk rhodianwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
richardpearsonwealth.co.uk richardpearsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Jan 2020 Feb 2020 53 days
rickardsfinancialplanning.com rickardsfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 1 day
abacuswealthservices.co.uk abacuswealthservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jan 2025 1 year, 133 days
robinsonfp.co.uk robinsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
rodgersfamilywealth.co.uk rodgersfamilywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2024 1 year, 211 days
abfinancialplanning.co.uk abfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 101 days
rossingtonwm.co.uk rossingtonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 32 days
bwfinancialplanning.co.uk bwfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Jan 2025 2 years, 94 days
rubywealth.co.uk rubywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
bullferguson.co.uk bullferguson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Jan 2025 1 year, 53 days
adnfp.co.uk adnfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Jan 2025 2 years, 20 days
agilepensions.uk agilepensions.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 May 2024 305 days
schofieldassociatesfp.co.uk schofieldassociatesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 21 days
ahwm.co.uk ahwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Jan 2025 1 year, 12 days
searlesfinancial.co.uk searlesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 20 days
selectinvestors.asia selectinvestors.asia
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 20 days
sjp.co.uk alumni.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2022 1 year, 62 days
machanwealthmanagement.co.uk machanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 123 days
simonlunnwm.co.uk simonlunnwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 34 days
skeltons.co.uk skeltons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 158 days
deptagency.com sjp-partner-nginx-stg.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Dec 2024 263 days
deptagency.com sjp-partner-nginx-uat.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Apr 2024 One Off
antaris.asia antaris.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2024 Jan 2025 180 days
capriwealth.co.uk capriwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 267 days
angelamillarwm.co.uk angelamillarwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 96 days
smithsonwm.co.uk smithsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 35 days
smjwealth.co.uk smjwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 35 days
annikagwm.co.uk annikagwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
solastawm.co.uk solastawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2024 1 year, 82 days
somersetwealthmanagement.co.uk somersetwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
solebayfp.co.uk solebayfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Sep 2024 324 days
andrewdaldrywm.co.uk andrewdaldrywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jan 2025 2 years, 307 days
andrewpaynewm.co.uk andrewpaynewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 15 days
andrewvarleyfinancialplanning.co.uk andrewvarleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 15 days
spirewealth.co.uk spirewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
springwealth.co.uk springwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2024 2 years, 272 days
stanfordwealth.co.uk stanfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2024 363 days
stathamwm.co.uk stathamwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 36 days
steeleaspire.co.uk steeleaspire.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2024 1 year, 253 days
steelewealthmanagement.co.uk steelewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
stephenkingwealthmanagement.co.uk stephenkingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
stevejamespfp.co.uk stevejamespfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 36 days
stevenjerath.co.uk stevenjerath.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 6 days
stoneacrefp.co.uk stoneacrefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Jan 2020 Mar 2020 51 days
swanwealthmanagement.co.uk swanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2024 1 year, 209 days
careyandcofinancialsolutions.co.uk careyandcofinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 267 days
swindonfinancialadvisers.uk swindonfinancialadvisers.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 31 days
swindonfinancialservices.co.uk swindonfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 30 days
swindonfinancialservices.uk swindonfinancialservices.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 31 days
tarporleywealth.co.uk tarporleywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2024 2 years, 181 days
aureliaprivatewealth.co.uk aureliaprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 269 days
templemewsfp.co.uk templemewsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 236 days
terryhartley.co.uk terryhartley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 32 days
averywealthmanagement.co.uk averywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
tfsni.com tfsni.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 38 days
awfwm.co.uk awfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2024 3 years, 112 days
bainfa.co.uk bainfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 286 days
thwm.co.uk thwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 39 days
tmcfc.co.uk tmcfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Jun 2024 1 year, 262 days
beaconfp.co.uk beaconfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 May 2024 261 days
towcester-fp.co.uk towcester-fp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Jun 2024 218 days
trinityfp.co.uk trinityfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 40 days
benhiles.co.uk benhiles.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 293 days
truitywealth.co.uk truitywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jun 2024 2 years, 70 days
tsfinancialplanning.co.uk tsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 48 days
bessellfp.co.uk bessellfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
beverleyfinancialmanagement.co.uk beverleyfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
bhwml.com bhwml.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2022 155 days
vfcwealthmanagement.co.uk vfcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 188 days
vinewealth.co.uk vinewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 222 days
blythswood.com blythswood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Jan 2025 2 years, 182 days
wangwm.co.uk wangwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Dec 2024 70 days
bradnickwealth.co.uk bradnickwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 97 days
bredonhillwm.co.uk bredonhillwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Jan 2025 320 days
whistonwealth.com whistonwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 225 days
willcoxwealthmanagement.co.uk willcoxwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jul 2023 1 year, 96 days
rafflesplaceprivatewealth.com rafflesplaceprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
wylliewealth.co.uk wylliewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 134 days
calderwoodfinancial.co.uk calderwoodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 290 days
cfwealth.asia cfwealth.asia
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
zohulmalikzada.co.uk zohulmalikzada.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
cheshirewealthconsultancy.co.uk cheshirewealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
clareclarkson.co.uk clareclarkson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Jan 2025 3 years, 15 days
clarityfinancialplanningsjp.co.uk clarityfinancialplanningsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
clhwm.co.uk clhwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Feb 2020 Mar 2020 38 days
colewealthmanagement.co.uk colewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2025 2 years, 50 days
concordiafp.co.uk concordiafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2024 Jan 2025 28 days
corcilliumwm.co.uk corcilliumwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
cormackwealth.co.uk cormackwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 153 days
danrmayo.com danrmayo.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
darcyfp.co.uk darcyfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2024 2 years, 62 days
davidagg.co.uk davidagg.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
dfwealthmanagement.co.uk dfwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Jan 2025 2 years, 130 days
dlwm.co.uk dlwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 120 days
dowdallwealthmanagement.co.uk dowdallwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 25 days
dwightmorreywm.co.uk dwightmorreywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
eastgatewealthmanagementltd.co.uk eastgatewealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
eastpointwm.co.uk eastpointwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
edgintonstanley.co.uk edgintonstanley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Jan 2025 2 years, 192 days
edmondsfinancialplanning.co.uk edmondsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
elaineford.co.uk elaineford.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 1 day
elainemilne.co.uk elainemilne.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 1 day
eltonfinancialconsultants.co.uk eltonfinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 1 day
emmadandy.co.uk emmadandy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 1 day
ennveefinancial.co.uk ennveefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 128 days
eonegreen.com eonegreen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
ericahaywealth.co.uk ericahaywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 2 days
evermore.financial evermore.financial
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Nov 2024 360 days
excavationexcavate.com excavationexcavate.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
fgjfinancialservices.co.uk fgjfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 3 days
fifteenfinancialplanning.co.uk fifteenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Jan 2025 1 year, 163 days
firmstonewealth.co.uk firmstonewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Jan 2025 1 year, 332 days
foresightfs.co.uk foresightfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 284 days
forte-financial.co.uk forte-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 125 days
fortisfinancial.co.uk fortisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Jan 2025 310 days
fortresswealthpartnership.com fortresswealthpartnership.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
fortveritaswealth.co.uk fortveritaswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2024 84 days
fossewayfs.co.uk fossewayfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 4 days
freddieansah.co.uk freddieansah.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 25 days
freearwm.co.uk freearwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Feb 2020 Mar 2020 33 days
futureperfectwealthmanagement.co.uk futureperfectwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jun 2022 203 days
georgeshippam.co.uk georgeshippam.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 1 day
gewealthmanagement.co.uk gewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Jan 2025 361 days
gibsonfinancialmanagement.co.uk gibsonfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 6 days
gkbfinancialplanning.co.uk gkbfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 122 days
goldenacornfp.co.uk goldenacornfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Jan 2025 1 year, 330 days
grahamlavinwealthmanagement.co.uk grahamlavinwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
graysonlewis.co.uk graysonlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jun 2023 79 days
grazianolongo.co.uk grazianolongo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 63 days
greenfortpw.com greenfortpw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
gritstone-fp.co.uk gritstone-fp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Jan 2025 3 years, 33 days
hallamwealth.co.uk hallamwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 85 days
hannonfinancialplanning.co.uk hannonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 136 days
hayatfp.co.uk hayatfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 8 days
haydnlewis.co.uk haydnlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 118 days
hayekwm.com hayekwm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
heideswiftfinancialplanning.co.uk heideswiftfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Jan 2025 1 year, 63 days
hendredfinancialpartners.co.uk hendredfinancialpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
heyesassociates.co.uk heyesassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 88 days
hipstagram.com hipstagram.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
hoadley-financial.co.uk hoadley-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jan 2025 3 years, 5 days
holmesfinancialplanning.co.uk holmesfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
hudsonandrogersfinancial.co.uk hudsonandrogersfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jan 2025 1 year, 158 days
hudsonwealthmanagement.co.uk hudsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 73 days
hummingbirdprivateclients.co.uk hummingbirdprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Jan 2025 305 days
ipswichfs.co.uk ipswichfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 114 days
isabellastepkowska-fellows.co.uk isabellastepkowska-fellows.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 11 days
ithacafinancial.co.uk ithacafinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 45 days
jameshendersonwm.co.uk jameshendersonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 12 days
jameshunwickewealthmanagement.co.uk jameshunwickewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jcrwealth.co.uk jcrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 199 days
jensenwealth.co.uk jensenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
jgriverwealth.co.uk jgriverwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 76 days
jhwm.co.uk jhwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
jillyoungwealthmanagement.co.uk jillyoungwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
joebointon.co.uk joebointon.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jonathannugentwm.co.uk jonathannugentwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
jonesregan.co.uk jonesregan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 51 days
jopowis.co.uk jopowis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Jan 2025 2 years, 187 days
jtwealthmanagementltd.co.uk jtwealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 14 days
julianhoweswealthmanagement.co.uk julianhoweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
justicewealth.co.uk justicewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jan 2025 3 years, 1 day
karlbadrick.co.uk karlbadrick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 75 days
kathrynshearsfinancialplanning.co.uk kathrynshearsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Jan 2025 301 days
kempbarnesfp.co.uk kempbarnesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 61 days
kfhwm.co.uk kfhwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Dec 2024 2 years, 238 days
kieranfowley.co.uk kieranfowley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Jan 2025 2 years, 328 days
kinlifetimeplanning.co.uk kinlifetimeplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 247 days
kirstywilsonwm.co.uk kirstywilsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 15 days
klcwealth.co.uk klcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
mentmorefp.co.uk mentmorefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 290 days
michellegermain.co.uk michellegermain.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 72 days
monriewm.co.uk monriewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jan 2025 1 year, 274 days
josephineblythe.co.uk josephineblythe.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 75 days
jwfinancialadvice.co.uk jwfinancialadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 14 days
jwoodward-sjp.co.uk jwoodward-sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 14 days
kainewm.co.uk kainewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 14 days
kdswealth.co.uk kdswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 14 days
keyhavenwealth.co.uk keyhavenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 28 days
keyplanwealth.co.uk keyplanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Jan 2025 2 years, 82 days
keysolutionswm.co.uk keysolutionswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 15 days
klara-wealth.co.uk klara-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 69 days
kmwm.co.uk kmwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
kneefinancialplanning.co.uk kneefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Jan 2025 353 days
knightturnerprivateclients.co.uk knightturnerprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 276 days
knightwealthmanagement.co.uk knightwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Jan 2025 353 days
lafirmasantana.com lafirmasantana.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
lawcapitalwealth.co.uk lawcapitalwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
lclaytonfm.co.uk lclaytonfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
leonnasalmon.co.uk leonnasalmon.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Jan 2025 299 days
lisacalvertfw.com lisacalvertfw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 124 days
litterickwm.co.uk litterickwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 18 days
lokmanwm.co.uk lokmanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 18 days
louisemoorewealthmanagement.co.uk louisemoorewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2023 One Off
lpfinancial.co.uk lpfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2024 2 years, 194 days
lucernawealth.com lucernawealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 226 days
lundwm.co.uk lundwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
lwmwealth.co.uk lwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
maggieralph.co.uk maggieralph.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
malcolmodonovan.co.uk malcolmodonovan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 57 days
mansionhousefinancialplanning.co.uk mansionhousefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 One Off
marginsfinancialsolutions.co.uk marginsfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 23 days
markbowenwm.co.uk markbowenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
markhollandwm.co.uk markhollandwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
markwheatleywealth.co.uk markwheatleywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 84 days
mcgintywealthmanagement.co.uk mcgintywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 20 days
melvillewm.co.uk melvillewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
michaelkylewm.co.uk michaelkylewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
midlandswealthmanagement.co.uk midlandswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 249 days
minsterfinancialplanning.co.uk minsterfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Jan 2025 2 years, 36 days
miwealthmanagement.co.uk miwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
mjashleywm.co.uk mjashleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 21 days
mjcwealthmanagement.co.uk mjcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
moorefinancialwellbeing.co.uk moorefinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 221 days
morriswm.co.uk morriswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
murfittwealth.co.uk murfittwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Jan 2025 2 years, 160 days
myleschurchill.com myleschurchill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2024 2 years, 201 days
nandsfp.co.uk nandsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2022 One Off
ncfa.uk ncfa.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 245 days
neilmccann.co.uk neilmccann.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 23 days
neptunefinancialmanagement.co.uk neptunefinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
niamwealth.co.uk niamwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
nigelgreenwm.com nigelgreenwm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 80 days
nighatali.co.uk nighatali.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
nightingalewealth.co.uk nightingalewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
noblewealth.co.uk noblewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
marathonwm.co.uk marathonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 246 days
oakwood-capital.co.uk oakwood-capital.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 125 days
oconnorwm.co.uk oconnorwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Sep 2024 173 days
onewealthltd.co.uk onewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2024 2 years, 64 days
markcosgrave.co.uk markcosgrave.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jan 2025 1 year, 275 days
orangetreefs.co.uk orangetreefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2024 1 year, 200 days
osbornewm.co.uk osbornewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 26 days
paulbryantonwm.co.uk paulbryantonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 27 days
paulmageewealthmanagement.co.uk paulmageewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
powerfinancialmanagement.co.uk powerfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2024 1 year, 200 days
primaryfinancialplanning.co.uk primaryfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 127 days
priteshpankhania.com priteshpankhania.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2023 1 year, 349 days
marlowwealth.co.uk marlowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Jan 2025 2 years, 325 days
richardbroughtonwealthmanagement.co.uk richardbroughtonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 31 days
richardburchnall.co.uk richardburchnall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
charterededgefp.co.uk charterededgefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 96 days
robertbutler-sjp.com robertbutler-sjp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Sep 2024 228 days
rossonwyewm.co.uk rossonwyewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 32 days
roxburghonline.co.uk roxburghonline.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 155 days
rsfinancial.co.uk rsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 32 days
rpwealthmanagement.co.uk rpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 32 days
rsmwm.co.uk rsmwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 32 days
russellgreer.co.uk russellgreer.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 19 days
bradbyswm.co.uk bradbyswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 292 days
ryanmcguinnesswm.co.uk ryanmcguinnesswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 243 days
sjp-cloud.info accelerator.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 66 days
saltandlightfs.co.uk saltandlightfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Feb 2024 292 days
sapphirefp.co.uk sapphirefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
sarahmcgurkwealthmanagement.co.uk sarahmcgurkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Dec 2023 2 years, 62 days
scholeswm.co.uk scholeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 33 days
arkioswealth.co.uk arkioswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2024 Jan 2025 33 days
searlewm.co.uk searlewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 33 days
seekerfinancial.co.uk seekerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2024 1 year, 34 days
shanehukewm.co.uk shanehukewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 34 days
shandandburnsfinancial.co.uk shandandburnsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2024 1 year, 285 days
sherpawealth.uk sherpawealth.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 250 days
allensalterwm.co.uk allensalterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 55 days
albionhousewm.co.uk albionhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Jan 2025 2 years, 197 days
siddonsand.co siddonsand.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 248 days
sigmafp.co.uk sigmafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2024 2 years, 101 days
silverlinewealth.co.uk silverlinewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 6 days
sjp-cloud.info sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Sep 2024 175 days
sjpinsights.co.uk sjpinsights.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
sjwalkerwm.co.uk sjwalkerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 35 days
skylarkwealth.co.uk skylarkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 283 days
andrewgrayafp.co.uk andrewgrayafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Jan 2025 2 years, 200 days
southgatewm.co.uk southgatewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Sep 2024 177 days
spco.co.uk spco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
viewcreative.agency spillane.viewcreative.agency
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Sep 2024 318 days
srgwealthmanagement.co.uk srgwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2024 1 year, 82 days
arvanwealth.co.uk arvanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Jan 2025 1 year, 10 days
steadfastwm.co.uk steadfastwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 247 days
stoneswealth.co.uk stoneswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
stpetersfinancialplanning.co.uk stpetersfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
adamlordwm.co.uk adamlordwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 272 days
summitfinancial.asia summitfinancial.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jun 2024 2 years, 139 days
agilelife.uk agilelife.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Jan 2025 1 year, 176 days
asmwealth.com asmwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
availfinancialplanning.co.uk availfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Dec 2023 1 year, 186 days
thamesvalleyfinancialplanning.co.uk thamesvalleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 236 days
thelockyerpartnership.co.uk thelockyerpartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Jun 2024 1 year, 143 days
tjpwealthmanagement.co.uk tjpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 39 days
tomworley.co.uk tomworley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
torweybridge.co.uk torweybridge.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 23 days
beaconswealth.co.uk beaconswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 269 days
tridentwm.co.uk tridentwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 40 days
truenorthfp.co.uk truenorthfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 296 days
twmfinancialplanning.co.uk twmfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 3 days
valkyriefinancialadvice.co.uk valkyriefinancialadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 295 days
vantagewm.co.uk vantagewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 303 days
vaughanwealth.co.uk vaughanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 346 days
vinetreefinancialservices.co.uk vinetreefinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 18 days
virtusfp.co.uk virtusfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 41 days
vividfp.co.uk vividfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 242 days
blueoceanwm.co.uk blueoceanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Jan 2025 286 days
walmsleyfinancialplanning.co.uk walmsleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 356 days
whfinancialwellbeing.co.uk whfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
whitehousecapital.co.uk whitehousecapital.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 189 days
wholewealth.com wholewealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 296 days
whrwealthmanagement.co.uk whrwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 337 days
brwm.org.uk brwm.org.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 211 days
woodmitchellfp.com woodmitchellfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 153 days
calderdaviswealthmanagement.co.uk calderdaviswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Jul 2024 1 year, 342 days
cambridgefinancialadvisers.co.uk cambridgefinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 125 days
carefeeadvice.co.uk carefeeadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
carrfinancialplanning.co.uk carrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 66 days
charlesjoneswealthmanagement.co.uk charlesjoneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 66 days
chwwealth.co.uk chwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 232 days
clarkwm.co.uk clarkwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Jan 2025 2 years, 75 days
claytonprofessionalwealth.co.uk claytonprofessionalwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 154 days
covewealth.co.uk covewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Jan 2025 1 year, 20 days
cphanburywealthmanagement.co.uk cphanburywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
ctwealthmanagement.co.uk ctwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
danmorganfinancialassociates.co.uk danmorganfinancialassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 257 days
darienwilliams.co.uk darienwilliams.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 147 days
darrenknibbwealthmanagement.co.uk darrenknibbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 262 days
davesouthbyfp.co.uk davesouthbyfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jan 2025 1 year, 261 days
davidbilantzwm.co.uk davidbilantzwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 81 days
davidsonfinancialplanning.co.uk davidsonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jan 2025 2 years, 299 days
dhfinancial.co.uk dhfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Feb 2020 Mar 2020 37 days
dianacooper.co.uk dianacooper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Nov 2024 200 days
doweswealth.co.uk doweswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 93 days
doyleleighfs.co.uk doyleleighfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 102 days
dragonwealth.co.uk dragonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 52 days
dynamicws.co.uk dynamicws.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Jan 2025 1 year, 1 day
earleywm.co.uk earleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jan 2025 2 years, 307 days
edwardswealth.co.uk edwardswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Jan 2025 313 days
edwardtrehearne.co.uk edwardtrehearne.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Jan 2025 2 years, 130 days
ejstapleywm.co.uk ejstapleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 1 day
ellorawealth.co.uk ellorawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Jan 2025 313 days
emeraldassociates.co.uk emeraldassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 60 days
emmarallswealthmanagement.co.uk emmarallswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 1 day
evolvefinancialplanning.co.uk evolvefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 251 days
ewartandbridgemanadvisers.co.uk ewartandbridgemanadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 83 days
ewenharris.co.uk ewenharris.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 127 days
excaliburwm.co.uk excaliburwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 246 days
familytreewealthmanagement.co.uk familytreewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Jan 2025 2 years, 334 days
farrierrose.co.uk farrierrose.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Jan 2025 2 years, 8 days
fayarrundale.co.uk fayarrundale.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 3 days
fearndalewealth.co.uk fearndalewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 91 days
fehufp.co.uk fehufp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 3 days
fernbankwealth.co.uk fernbankwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
financialmerrett.co.uk financialmerrett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 253 days
finessefinancialplanning.co.uk finessefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 143 days
fisherfm.co.uk fisherfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 4 days
formanwealthmanagement.co.uk formanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 125 days
formfinancialclarity.co.uk formfinancialclarity.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
macaulaywm.co.uk macaulaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 105 days
francefinancial.co.uk francefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Jan 2025 3 years, 8 days
frontierwealth.co.uk frontierwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 245 days
ftalk.co.uk ftalk.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 4 days
futurumfa.co.uk futurumfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 266 days
gallacherwealth.co.uk gallacherwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
gapstowwealth.co.uk gapstowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
gardnerwealthmanagement.com gardnerwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 51 days
ghfinancialsolutions.co.uk ghfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 123 days
gillespiefinancialconsultancy.com gillespiefinancialconsultancy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
glamorganwm.co.uk glamorganwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 6 days
greatoakfp.co.uk greatoakfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Jan 2025 2 years, 127 days
greenparkwm.com greenparkwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 139 days
greenswardfp.co.uk greenswardfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 250 days
gregorhowitt.co.uk gregorhowitt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 57 days
hamiltonpullenfp.co.uk hamiltonpullenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 85 days
hightowerwealthmanagementltd.co.uk hightowerwealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
hillsidefinancialplanning.co.uk hillsidefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 117 days
hjpcfp.com hjpcfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 209 days
hodgewealthmanagement.co.uk hodgewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jan 2025 2 years, 296 days
horshamfinancial.co.uk horshamfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Jan 2025 2 years, 222 days
hudsonwm.co.uk hudsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2024 Jan 2025 20 days
huntminasfinancial.co.uk huntminasfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jan 2025 1 year, 158 days
iaincampbellwm.co.uk iaincampbellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 10 days
iwplanning.com iwplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 130 days
janetgee.co.uk janetgee.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 12 days
jckfinancialeducation.co.uk jckfinancialeducation.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 One Off
jenkinsfinancialpartnership.co.uk jenkinsfinancialpartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 128 days
jgriver.co jgriver.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jan 2025 1 year, 156 days
jjfm.co.uk jjfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
jmbwealth.co.uk jmbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
jmkwealthmanagement.co.uk jmkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2025 1 year, 115 days
cordnerwealthmanagement.co.uk cordnerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 249 days
middletonwealth.co.uk middletonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 45 days
gnkwealthmanagement.co.uk gnkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Jan 2025 2 years, 87 days
raynhamhendersonwm.co.uk raynhamhendersonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 30 days
rebeccabailey.co.uk rebeccabailey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 281 days
reflectfp.co.uk reflectfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 16 days
repositorywealth.co.uk repositorywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jun 2024 1 year, 53 days
brownandcofp.co.uk brownandcofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Jan 2025 320 days
rmcfp.co.uk rmcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
aresfinancialplanning.co.uk aresfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 61 days
robingram.co.uk robingram.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Sep 2024 228 days
rowlandwealthmanagement.co.uk rowlandwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 32 days
rwmfinance.co.uk rwmfinance.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
bywaterwealth.co.uk bywaterwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Jan 2025 319 days
hauxwellwealthmanagement.co.uk hauxwellwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Jan 2025 2 years, 126 days
sagewm.co.uk sagewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Dec 2024 1 year, 89 days
saxtonfp.co.uk saxtonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2024 2 years, 228 days
scottjameswealthmanagement.co.uk scottjameswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2024 2 years, 292 days
scrimgerandoakes.co.uk scrimgerandoakes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 21 days
sebastienzamora.co.uk sebastienzamora.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 33 days
seven-wealth.co.uk seven-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 346 days
allardwealth.co.uk allardwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jan 2025 1 year, 132 days
shawfieldwealthmanagement.co.uk shawfieldwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2024 1 year, 327 days
silveroakfs.co.uk silveroakfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 24 days
skentelberyfinancial.co.uk skentelberyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 35 days
sjmfinancial.co.uk sjmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 347 days
sjp.asia sjp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 283 days
sjpinsights.asia sjpinsights.asia
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 86 days
skwealthsolutions.co.uk skwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 136 days
autuswealth.co.uk autuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jul 2024 2 years, 94 days
antlerwealth.asia antlerwealth.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Jan 2025 2 years, 199 days
andersonbellfinancial.co.uk andersonbellfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Jan 2025 1 year, 11 days
sovereign-marketharborough.co.uk sovereign-marketharborough.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
srmfs.co.uk srmfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Dec 2024 3 years, 75 days
appartnerswealth.co.uk appartnerswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jan 2025 1 year, 254 days
stagwealthmanagement.co.uk stagwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Sep 2024 234 days
stanfieldfp.co.uk stanfieldfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
stellenboschfp.co.uk stellenboschfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Nov 2024 179 days
stephenboylewealthmanagement.co.uk stephenboylewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2024 1 year, 38 days
stephenhydewealthmanagement.co.uk stephenhydewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 30 days
sterlingadvice.co.uk sterlingadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 28 days
strakerfp.co.uk strakerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Nov 2023 1 year, 89 days
aspirelane.co.uk aspirelane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 271 days
stuartthom.co.uk stuartthom.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 19 days
sullivanandcofp.co.uk sullivanandcofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2024 1 year, 208 days
swannfinancial.com swannfinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 31 days
swtwealth.co.uk swtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Jan 2020 Mar 2020 50 days
swindonfinancialadvisers.co.uk swindonfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 285 days
angieaddisonfinancial.co.uk angieaddisonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 272 days
athelisfinancial.co.uk athelisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Jan 2025 2 years, 134 days
aureliaprivatewealth.com aureliaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 May 2024 34 days
aurorafinancialservices.co.uk aurorafinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
avonwoodfinancialplanning.uk avonwoodfinancialplanning.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
thameswealth.co.uk thameswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2024 1 year, 283 days
axtruwealth.co.uk axtruwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2024 Jan 2025 175 days
bardenwealthmanagement.co.uk bardenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2023 1 year, 303 days
baxterfinancial.co.uk baxterfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
baybluewealth.co.uk baybluewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 98 days
beaglefinancialadvice.co.uk beaglefinancialadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 98 days
trueselfwealth.co.uk trueselfwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jun 2024 2 years, 105 days
berryfinancial.co.uk berryfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
turnerwm.co.uk turnerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 40 days
birchwealthmanagement.co.uk birchwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
vanderweelewm.co.uk vanderweelewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 42 days
vffm.co.uk vffm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 90 days
watchhousefp.co.uk watchhousefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 311 days
wellbankwm.co.uk wellbankwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 357 days
bridgewaterwm.co.uk bridgewaterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
whittinghamprivateclients.com whittinghamprivateclients.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 190 days
wokingfinancialadviser.co.uk wokingfinancialadviser.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2024 1 year, 30 days
bullivantwealth.co.uk bullivantwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 191 days
woodwealth.co.uk woodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 One Off
wpwfinancial.co.uk wpwfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 One Off
calverwm.co.uk calverwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 99 days
chapmansfinancial.co.uk chapmansfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 87 days
christopherpughwealthmanagement.co.uk christopherpughwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 65 days
clairereadwm.co.uk clairereadwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 100 days
claywealth.co.uk claywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 289 days
cleevefinancialplanning.co.uk cleevefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2024 1 year, 46 days
cliffordcharleswm.co.uk cliffordcharleswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 62 days
colebridgefs.co.uk colebridgefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2025 1 year, 127 days
compoundwealth.uk compoundwealth.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Dec 2024 2 years, 93 days
coralfp.co.uk coralfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2025 2 years, 50 days
craigcrawfordfinancial.co.uk craigcrawfordfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 May 2023 39 days
craigsaxtonwm.co.uk craigsaxtonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 116 days
creativelp.co.uk creativelp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 151 days
sjp-cloud.info custom.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 66 days
declankiely.co.uk declankiely.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2025 2 years, 46 days
destinationwealth.co.uk destinationwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 148 days
dmcfp.co.uk dmcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 247 days
dtbwealthmanagement.co.uk dtbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
dunnewealthmanagement.co.uk dunnewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Jan 2025 2 years, 227 days
dwwealthplanning.co.uk dwwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 266 days
eastlakewm.co.uk eastlakewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Jan 2025 2 years, 227 days
ecwealthmanagement.co.uk ecwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 67 days
emilyman.com emilyman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 206 days
euanmacfarlane.co.uk euanmacfarlane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 2 days
fardiniwm.co.uk fardiniwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 3 days
farrfinancialplanning.co.uk farrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 284 days
fenlandfinancialplanning.co.uk fenlandfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Jan 2025 311 days
filsellwealth.co.uk filsellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Jan 2025 2 years, 129 days
financialplanningformedics.co.uk financialplanningformedics.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 25 days
finlaywealth.co.uk finlaywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 284 days
fisherwealthmanagementltd.co.uk fisherwealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 4 days
fmwealth.co.uk fmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 4 days
forethoughtfinancial.co.uk forethoughtfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 58 days
fortitudewealthmanagement.co.uk fortitudewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 261 days
fskfinancialplanning.co.uk fskfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Jan 2025 1 year, 332 days
gandhiwealth.co.uk gandhiwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 5 days
gillespiefinancial.co.uk gillespiefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 122 days
gillespiefinancialconsultancy.co.uk gillespiefinancialconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
gillespiefinancialconsultants.com gillespiefinancialconsultants.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
gittinsandco.com gittinsandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 122 days
glencairnfp.co.uk glencairnfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 6 days
goldenacornfp.com goldenacornfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Jan 2025 1 year, 330 days
goldreflectwm.co.uk goldreflectwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Jan 2025 308 days
grantcharlesfp.co.uk grantcharlesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 139 days
hartfp.co.uk hartfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
herfinancialplanning.co.uk herfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 134 days
hfkwealth.co.uk hfkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jan 2022 One Off
highfieldwealth.co.uk highfieldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Jan 2025 358 days
hinaziawm.co.uk hinaziawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 8 days
hmhwealth.co.uk hmhwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 9 days
hoylandwm.co.uk hoylandwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 9 days
hrwilsonassociates.co.uk hrwilsonassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 9 days
ironbarkwm.co.uk ironbarkwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2025 1 year, 115 days
isherwoodfinancialservices.co.uk isherwoodfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 249 days
jamesdrowley.co.uk jamesdrowley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 24 days
jamesonwealthmanagement.co.uk jamesonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
jdcfinancialplanning.co.uk jdcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jan 2025 2 years, 293 days
jenkinsonwealth.co.uk jenkinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Jan 2025 2 years, 165 days
jimbondwm.co.uk jimbondwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
jkb-wealth.co.uk jkb-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 255 days
jmfp.co.uk jmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
joannefogowm.co.uk joannefogowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
johnhomewealthmanagement.co.uk johnhomewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 24 days
jpwealthmanagement.co.uk jpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
kellypardoewm.co.uk kellypardoewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
kenwoodwealthmanagement.co.uk kenwoodwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
kevinbassett.co.uk kevinbassett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 15 days
kevinhepworth.co.uk kevinhepworth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 76 days
kevinlaidlaw.co.uk kevinlaidlaw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 15 days
khawajawealthmanagement.co.uk khawajawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 15 days
kilsaranfp.co.uk kilsaranfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
lamymanandco.co.uk lamymanandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Jan 2025 1 year, 325 days
langwealthmanagement.co.uk langwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 109 days
laurajoycewealthmanagement.co.uk laurajoycewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
lemontfp.co.uk lemontfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 23 days
lifematterswmltd.co.uk lifematterswmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 17 days
lisavaughanfp.co.uk lisavaughanfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
ljgriffithswealth.co.uk ljgriffithswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 59 days
longsandsfp.co.uk longsandsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 237 days
mackaywm.co.uk mackaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
mansfieldfs.co.uk mansfieldfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 78 days
mantafp.co.uk mantafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 195 days
marccarpenterwm.co.uk marccarpenterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
martaderpenska.co.uk martaderpenska.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 23 days
matthewconroy.co.uk matthewconroy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
mattimorewealth.co.uk mattimorewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jan 2025 1 year, 151 days
mbwealthmanagement.co.uk mbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 20 days
mcdermidfinancialplanning.co.uk mcdermidfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
mcgarveyjones.co.uk mcgarveyjones.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 263 days
mcgillwm.co.uk mcgillwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Jan 2025 2 years, 216 days
mcleodwm.co.uk mcleodwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 20 days
mhwml.co.uk mhwml.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
michaelheard.co.uk michaelheard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 22 days
michaeltreed.co.uk michaeltreed.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 79 days
mjrfinancialplanning.co.uk mjrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Jan 2025 2 years, 252 days
mkm-wm.co.uk mkm-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2023 1 year, 345 days
mollamwm.co.uk mollamwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jan 2025 1 year, 274 days
morrinsonwealth.co.uk morrinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 22 days
mpurcell.co.uk mpurcell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 22 days
mwandpartners.co.uk mwandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jan 2024 290 days
naomihaynes.co.uk naomihaynes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 10 days
nauticalwealth.co.uk nauticalwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 344 days
ncoprivateclients.co.uk ncoprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2024 126 days
nicholasbonefinancial.co.uk nicholasbonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2024 1 year, 73 days
manganfp.co.uk manganfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 73 days
norfolkwealth.co.uk norfolkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 22 days
norifinancial.co.uk norifinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
northernspire.co.uk northernspire.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 One Off
oaksmithfinancialplanning.co.uk oaksmithfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2024 2 years, 288 days
originwm.co.uk originwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2024 2 years, 173 days
oxfordwm.co.uk oxfordwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2024 Sep 2024 98 days
oysterwealthplanning.com oysterwealthplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Sep 2024 173 days
revolutionwealth.co.uk revolutionwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
pantheonwealthpartners.co.uk pantheonwealthpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2024 1 year, 18 days
pardeepnarwal.co.uk pardeepnarwal.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 24 days
parnellfinancialmanagement.com parnellfinancialmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
patrickclayphanwm.co.uk patrickclayphanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 27 days
patrickmckeownwm.co.uk patrickmckeownwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 27 days
paulcoenwealth.co.uk paulcoenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
pauldaveywm.co.uk pauldaveywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 27 days
paulkerrwm.com paulkerrwm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 27 days
paulwhittlewm.co.uk paulwhittlewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 27 days
richardcoxwm.co.uk richardcoxwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Jan 2020 Feb 2020 53 days
richardmarshall.uk richardmarshall.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 17 days
pearsonfinancialwellbeing.co.uk pearsonfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 152 days
website-testing-link.net penrose.website-testing-link.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jun 2024 295 days
ripplewealth.co.uk ripplewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2024 1 year, 246 days
petrichorfinancialsolutions.com petrichorfinancialsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2024 1 year, 243 days
philipblackwealthmanagement.co.uk philipblackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2024 1 year, 362 days
planitfuture.co.uk planitfuture.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2021 4 days
planned-wealth.co.uk planned-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2024 2 years, 360 days
portawealth.co.uk portawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 83 days
portsdownwealthmanagement.co.uk portsdownwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
potterfp.co.uk potterfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2024 354 days
priteshkabawala.co.uk priteshkabawala.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
progressivewealth.co.uk progressivewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
psrwm.co.uk psrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Dec 2024 2 years, 194 days
mcqueenwealth.co.uk mcqueenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Jan 2025 2 years, 251 days
mcgwealth.co.uk mcgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 194 days
crockerandpartners.co.uk crockerandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Jan 2025 1 year, 53 days
midlandfp.co.uk midlandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Jan 2025 2 years, 118 days
rexwealth.co.uk rexwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2024 1 year, 302 days
rheawm.co.uk rheawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Sep 2024 172 days
rhwml.co.uk rhwml.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 84 days
richardreith.co.uk richardreith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
rkpwealthmanagement.co.uk rkpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 258 days
rjmfp.co.uk rjmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 2 days
rowlandfp.co.uk rowlandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 85 days
absoluteprotectionandwealth.com absoluteprotectionandwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2024 Jan 2025 11 days
bybrookwm.co.uk bybrookwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 267 days
samanthaprendergast.co.uk samanthaprendergast.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 33 days
sapphirefinancialplanning.com sapphirefinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
adastrafinancial.co.uk adastrafinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2024 Jan 2025 191 days
advice-on-line.co.uk advice-on-line.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 14 days
ajleefinancialplanning.co.uk ajleefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 76 days
akrwealth.co.uk akrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2025 2 years, 57 days
altairfp.co.uk altairfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jan 2025 3 years, 71 days
sgwealth.co.uk sgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Jun 2024 2 years, 32 days
sherwoodsolutions.com sherwoodsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 23 days
alexleamanwm.co.uk alexleamanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2025 Jan 2025 6 days
simplewealthsolutions.co.uk simplewealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 347 days
amberwealthmanagementltd.co.uk amberwealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 54 days
annsandgrange.co.uk annsandgrange.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Jan 2025 338 days
solebayfp.com solebayfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Sep 2024 324 days
southoverwealth.co.uk southoverwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Jul 2023 1 year, 214 days
andertonfinancialplanning.co.uk andertonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 91 days
sparkwealth.co.uk sparkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2024 2 years, 6 days
sovereign-wealth.co.uk sovereign-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 87 days
andyheyes.co.uk andyheyes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 210 days
spinnaker-wealth.co.uk spinnaker-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 27 days
spinnakerwealth.co.uk spinnakerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2023 1 year, 354 days
spinningfieldswealth.co.uk spinningfieldswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Sep 2024 233 days
srmwealth.co.uk srmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 36 days
sjp-cloud.info ssl-test.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 18 days
standrewswm.co.uk standrewswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 36 days
stephendawsonwealthmanagement.co.uk stephendawsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 97 days
stephensonwealthmanagement.co.uk stephensonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 20 days
stjulienfp.co.uk stjulienfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2024 1 year, 114 days
atlasprivatewealth.co.uk atlasprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 99 days
abreyprivateclients.com abreyprivateclients.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 56 days
surreyoakswm.co.uk surreyoakswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 255 days
alderleyfinancialplanning.co.uk alderleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 May 2024 2 years, 200 days
swfsltd.co.uk swfsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2024 2 years, 80 days
swilcanfinancialpartners.co.uk swilcanfinancialpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 339 days
amicafinancialwellbeing.co.uk amicafinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jan 2025 2 years, 272 days
tait.financial tait.financial
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
taylorwealthmanagement.co.uk taylorwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 31 days
templepiper.co.uk templepiper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 164 days
tgulfinancialadviser.co.uk tgulfinancialadviser.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 38 days
avfp.co.uk avfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
avongreenfinancial.co.uk avongreenfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 217 days
avonwoodfinancial.uk avonwoodfinancial.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
theethicalwealthproject.co.uk theethicalwealthproject.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 340 days
axis-fpl.co.uk axis-fpl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 97 days
thinkwealth.co.uk thinkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jun 2024 69 days
bafp.co.uk bafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 64 days
thomasporterwm.co.uk thomasporterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 39 days
tiffanybeardfinancialadvisers.co.uk tiffanybeardfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jun 2024 2 years, 138 days
balmerfinancialplanning.co.uk balmerfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jan 2025 269 days
tlcwealthmanagement.co.uk tlcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Mar 2020 Mar 2020 One Off
belgravefinancial.com belgravefinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jun 2023 1 year, 225 days
bentleybrownandco.co.uk bentleybrownandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Jan 2025 2 years, 340 days
tullochwealthmanagement.co.uk tullochwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 240 days
twachartered.co.uk twachartered.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 130 days
twcfinancial.co.uk twcfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Oct 2024 2 years, 87 days
tweedieandwyllie.co.uk tweedieandwyllie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Nov 2023 162 days
venturawealth.co.uk venturawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 188 days
blackfinwm.co.uk blackfinwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Nov 2024 2 years, 325 days
vivawealth.co.uk vivawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 1 year, 355 days
warwickshirewealthmanagement.co.uk warwickshirewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wellsandcofinancialplanning.co.uk wellsandcofinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Nov 2022 124 days
brcwm.co.uk brcwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
brewardfp.co.uk brewardfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2025 1 year, 88 days
whitfeldfinancialplanning.co.uk whitfeldfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 17 days
whitstablefp.co.uk whitstablefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 217 days
wildandwildwm.co.uk wildandwildwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 1 year, 352 days
bromleyrahlke.co.uk bromleyrahlke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
bromptonprivatewealth.co.uk bromptonprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Jan 2025 2 years, 220 days
williamstreetwealth.co.uk williamstreetwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 306 days
williamswealthconsultancy.co.uk williamswealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 172 days
woodmitchellfp.co.uk woodmitchellfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 153 days
bwwm.uk bwwm.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2024 Jan 2025 160 days
yasutoarai.co.uk yasutoarai.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 242 days
yltwealthmanagement.co.uk yltwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2024 2 years, 99 days
chalicefinancialplanning.co.uk chalicefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Jan 2025 1 year, 5 days
challonerwealth.com challonerwealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 21 days
chequersfinancialplanning.co.uk chequersfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 66 days
sjp.co.uk choices.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 230 days
chrisbromiley.co.uk chrisbromiley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
chriswordsworthfinancialplanning.co.uk chriswordsworthfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2025 2 years, 52 days
ciaranpreshurwm.co.uk ciaranpreshurwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Jan 2025 2 years, 174 days
compass-fs.org compass-fs.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Jan 2025 2 years, 12 days
comptonfinancialadvice.co.uk comptonfinancialadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2025 3 years, 130 days
connectedfinancial.co.uk connectedfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 288 days
copfordfinancialplanning.co.uk copfordfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Jan 2025 317 days
cotswoldfinancialsolutions.co.uk cotswoldfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2024 Jan 2025 27 days
crescentwm.co.uk crescentwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Apr 2024 1 year, 72 days
cthfinancialplanning.co.uk cthfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Aug 2022 54 days
danielsalt.co.uk danielsalt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 101 days
davidjoneswealthmanagement.co.uk davidjoneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Jan 2025 2 years, 8 days
davieswealthmanagement.uk davieswealthmanagement.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Jan 2025 2 years, 130 days
dvcwealth.co.uk dvcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
dwiwm.co.uk dwiwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
easternhorizonwealth.co.uk easternhorizonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 148 days
eddicottwealthmanagement.co.uk eddicottwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Feb 2020 Mar 2020 36 days
ejsfinancialservices.co.uk ejsfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 51 days
ellisonwealthmanagement.co.uk ellisonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 246 days
ellisonwwm.co.uk ellisonwwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Jan 2025 2 years, 192 days
elmhurstfinancialplanning.co.uk elmhurstfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 246 days
emmarice-sjp.co.uk emmarice-sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
erinrosefinancial.co.uk erinrosefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 51 days
erwealth.co.uk erwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 2 days
etteca.asia etteca.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2024 2 years, 265 days
evelynevanswm.co.uk evelynevanswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 2 days
ffcbwealth.co.uk ffcbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 3 days
ffwm.co.uk ffwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Feb 2023 121 days
finative.co.uk finative.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Jan 2025 1 year, 284 days
fordhamfinancialplanning.co.uk fordhamfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Jan 2025 2 years, 333 days
forest-oak.co.uk forest-oak.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Jan 2025 2 years, 7 days
fortispw.co.uk fortispw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2025 3 years, 58 days
franceshackett.co.uk franceshackett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 4 days
frostwealthmanagement.co.uk frostwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 124 days
futuruswealth.co.uk futuruswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Jan 2025 141 days
geraldburns.co.uk geraldburns.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 5 days
gillespiefinancialconsultants.co.uk gillespiefinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
glenncooklandwealthmanagement.co.uk glenncooklandwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
godivafinancialplanning.co.uk godivafinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 121 days
gothamwealth.co.uk gothamwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Jan 2025 89 days
gregorycharlesfp.co.uk gregorycharlesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 7 days
grindalwealthmanagement.co.uk grindalwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 120 days
gwwealth.co.uk gwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2025 2 years, 44 days
hamiltonbennett.co.uk hamiltonbennett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 119 days
hansawealthmanagement.co.uk hansawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Apr 2023 169 days
harmoneyfinancialpartners.co.uk harmoneyfinancialpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 249 days
hbegumfinancialplanning.co.uk hbegumfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Feb 2020 Feb 2020 One Off
heberdenwealthmanagement.co.uk heberdenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 8 days
helenmrogers.co.uk helenmrogers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
helenwrightwealthmanagement.co.uk helenwrightwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 8 days
hibbertwealthmanagement.co.uk hibbertwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 8 days
hivefp.co.uk hivefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 46 days
houlcroftwm.co.uk houlcroftwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Mar 2020 103 days
hudsonwealthconsultancy.co.uk hudsonwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 9 days
hutchesonfinancial.co.uk hutchesonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2025 2 years, 43 days
hwmfinancial.co.uk hwmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 116 days
iancameronfp.co.uk iancameronfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 10 days
ikebenson.co.uk ikebenson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 10 days
iriswm.co.uk iriswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Dec 2024 1 year, 186 days
jafp.co.uk jafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jan 2025 2 years, 294 days
jamesfullerwm.co.uk jamesfullerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 177 days
jameswindsorfp.co.uk jameswindsorfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 12 days
jayjeffreywealthmanagement.co.uk jayjeffreywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 12 days
jdwealthmanagement.co.uk jdwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
jeremydavieswm.co.uk jeremydavieswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 112 days
jmwealthmanagement.co.uk jmwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
jnfwealthmanagement.co.uk jnfwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 62 days
joblingwm.co.uk joblingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 199 days
jonathanelliottwealthmanagement.co.uk jonathanelliottwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
jpafinancialplanning.co.uk jpafinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2025 1 year, 115 days
jrmwealth.co.uk jrmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 111 days
jshelleywm.co.uk jshelleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 13 days
julianmobsby.co.uk julianmobsby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 248 days
juxonwealth.com juxonwealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 2 days
kevindenman.co.uk kevindenman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 110 days
kilbrinfinancial.co.uk kilbrinfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jan 2025 1 year, 155 days
kingsfordwealthmanagement.co.uk kingsfordwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Jan 2025 1 year, 239 days
kpricewealthmanagement.co.uk kpricewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 16 days
kyarwoodwm.co.uk kyarwoodwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 16 days
lainstonwm.co.uk lainstonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2025 1 year, 113 days
lainstonwm.com lainstonwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2025 1 year, 113 days
lawrenceneilwealthmanagement.co.uk lawrenceneilwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
leeperkes.co.uk leeperkes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
legacycm.co.uk legacycm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Jan 2025 125 days
lethbridgewm.co.uk lethbridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2025 3 years, 108 days
liambailliewealthmanagement.co.uk liambailliewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 17 days
limestonefp.co.uk limestonefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Jan 2025 2 years, 186 days
lisamccreadiewealthmanagement.co.uk lisamccreadiewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 108 days
ljgwealth.co.uk ljgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2022 One Off
neallynch.co.uk neallynch.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 23 days
lochriefp.co.uk lochriefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Jan 2025 2 years
lochriewm.co.uk lochriewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 18 days
lordstonefinancial.co.uk lordstonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Jan 2025 1 year, 324 days
luwerowealthadvisers.co.uk luwerowealthadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Jan 2025 298 days
lwwealthmanagement.co.uk lwwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
lyndaamos.co.uk lyndaamos.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 19 days
macleodfinancial.co.uk macleodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jan 2025 1 year, 199 days
majorcontext.com majorcontext.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
marksullivanwm.co.uk marksullivanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 One Off
marktigwell.co.uk marktigwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Jan 2025 2 years, 325 days
masonbrownfp.co.uk masonbrownfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Jan 2025 1 year, 36 days
medexfm.co.uk medexfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 20 days
meenahalaiws.co.uk meenahalaiws.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 20 days
morewealthmanagement.co.uk morewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2024 Jan 2025 66 days
mwwealth.co.uk mwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 280 days
nickdcox.co.uk nickdcox.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
nickhowells.co.uk nickhowells.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
nineoak.co.uk nineoak.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2024 2 years, 183 days
njhwealth.co.uk njhwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2024 Sep 2024 98 days
noulawealth.com noulawealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Dec 2019 24 days
obwealth.co.uk obwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 11 days
ocsfinancialplanning.co.uk ocsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 151 days
mariakyritsis.com mariakyritsis.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2024 Jan 2025 13 days
oliumfinancial.co.uk oliumfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 One Off
oneillwealth.co.uk oneillwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2024 2 years, 203 days
orangetreewealthmanagement.co.uk orangetreewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 134 days
ovalwealthpartners.co.uk ovalwealthpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 12 days
pamw.co.uk pamw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Jan 2025 244 days
paragonwealth.co.uk paragonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Apr 2023 211 days
parallelwealthmanagement.co.uk parallelwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Aug 2022 247 days
parksidefinancialplanning.co.uk parksidefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2024 1 year, 114 days
parrettfinancial.co.uk parrettfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2024 1 year, 243 days
pathfinderpw.co.uk pathfinderpw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 345 days
pbfps.co.uk pbfps.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Jan 2020 Feb 2020 55 days
pearcesargent.co.uk pearcesargent.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2024 354 days
pearwoodfinancial.co.uk pearwoodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Sep 2024 172 days
peterstephensonwm.co.uk peterstephensonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Feb 2020 82 days
petrichorfinancialsolutions.co.uk petrichorfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2024 1 year, 114 days
quintessentialwealthmanagement.co.uk quintessentialwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Dec 2023 One Off
rebeccakingwell.co.uk rebeccakingwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-1258234 Dec 2019 Jan 2020 30 days
reddingswmltd.co.uk reddingswmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 26 days
regentdow.co.uk regentdow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2024 2 years, 205 days
DULEYPRACTICE.CO.UK
Non IP Attributes
Attribute First Last
GTM GTM-W2ZFB5N Aug 2021 Jan 2025
GTM GTM-58PXN8T Jan 2021 Jun 2021
HJ HJ-1258234 Dec 2019 Mar 2020
UA UA-5583714 Jan 2021 Mar 2021
HJ HJ-946865 Oct 2020 Oct 2020
DULEYPRACTICE.CO.UK
Overlap Attribute Domains
lcwealth.co.uk lcwealth.co.uk
ldbwealth.co.uk ldbwealth.co.uk
lewiswealthmanagement.co.uk lewiswealthmanagement.co.uk
lhfp.co.uk lhfp.co.uk
llewellynfs.co.uk llewellynfs.co.uk
lowesawyerfp.co.uk lowesawyerfp.co.uk
lsmwealth.co.uk lsmwealth.co.uk
macleodandmaccallumwm.co.uk macleodandmaccallumwm.co.uk
martenwm.co.uk martenwm.co.uk
michaeljcookwm.co.uk michaeljcookwm.co.uk
mitchellwm.co.uk mitchellwm.co.uk
mktwealthmanagement.co.uk mktwealthmanagement.co.uk
moorgatefp.co.uk moorgatefp.co.uk
mwm-sjp.co.uk mwm-sjp.co.uk
napiersharpe.com napiersharpe.com
naziahaquewm.co.uk naziahaquewm.co.uk
northumbriafm.co.uk northumbriafm.co.uk
norwoodfp.com norwoodfp.com
nowfinancial.co.uk nowfinancial.co.uk
oakroomwealth.co.uk oakroomwealth.co.uk
ocswealthmanagement.co.uk ocswealthmanagement.co.uk
oliverwronski.co.uk oliverwronski.co.uk
orangetreewm.co.uk orangetreewm.co.uk
rbawealthmanagement.com rbawealthmanagement.com
parkswm.co.uk parkswm.co.uk
paulthorntonsjp.co.uk paulthorntonsjp.co.uk
pcfaltd.co.uk pcfaltd.co.uk
pcfinancialplanning.com pcfinancialplanning.com
peterhardingwm.co.uk peterhardingwm.co.uk
petermulronefp.co.uk petermulronefp.co.uk
pfswm.co.uk pfswm.co.uk
poolegrahamwc.co.uk poolegrahamwc.co.uk
portbrae.co.uk portbrae.co.uk
reddingswm.co.uk reddingswm.co.uk
renoufwmltd.co.uk renoufwmltd.co.uk
bwfconsultants.com bwfconsultants.com
rmwmllp.co.uk rmwmllp.co.uk
acsfinancialplanning.co.uk acsfinancialplanning.co.uk
brightwm.co.uk brightwm.co.uk
aflfinancial.co.uk aflfinancial.co.uk
scharpwm.co.uk scharpwm.co.uk
afswm.co.uk afswm.co.uk
agfp.co.uk agfp.co.uk
seifertdunk.co.uk seifertdunk.co.uk
sevenhillswealth.co.uk sevenhillswealth.co.uk
argentwm.co.uk argentwm.co.uk
albrightonwm.co.uk albrightonwm.co.uk
ambersmithwc.co.uk ambersmithwc.co.uk
andrewcummingwm.co.uk andrewcummingwm.co.uk
srbwm.co.uk srbwm.co.uk
stephendawsonfp.co.uk stephendawsonfp.co.uk
stephensonfp.co.uk stephensonfp.co.uk
suepickeringwealth.co.uk suepickeringwealth.co.uk
sycamorealliance.com sycamorealliance.com
thetdp.co.uk thetdp.co.uk
thomashallwm.co.uk thomashallwm.co.uk
barbaracopeland.co.uk barbaracopeland.co.uk
tinaowenfp.co.uk tinaowenfp.co.uk
bderose.co.uk bderose.co.uk
beechcroftwm.co.uk beechcroftwm.co.uk
trowlockwm.co.uk trowlockwm.co.uk
bglwealth.co.uk bglwealth.co.uk
boardmanwealth.co.uk boardmanwealth.co.uk
boagenglandfp.co.uk boagenglandfp.co.uk
wbwealth.co.uk wbwealth.co.uk
wdwealth.co.uk wdwealth.co.uk
bpcwealth.co.uk bpcwealth.co.uk
bracewealth.co.uk bracewealth.co.uk
wellsandcompanywm.co.uk wellsandcompanywm.co.uk
whitehousefm.co.uk whitehousefm.co.uk
wickenswealthmanagement.co.uk wickenswealthmanagement.co.uk
buchanwm.co.uk buchanwm.co.uk
wmcinvestment.com wmcinvestment.com
woodfallwealth.co.uk woodfallwealth.co.uk
yiotawilkinsonwm.co.uk yiotawilkinsonwm.co.uk
cedarfp.co.uk cedarfp.co.uk
cfswp.co.uk cfswp.co.uk
chatsworthwm.co.uk chatsworthwm.co.uk
collinswm.co.uk collinswm.co.uk
dfsfinancialconsultancy.co.uk dfsfinancialconsultancy.co.uk
deanstevenswm.co.uk deanstevenswm.co.uk
derekmillswealth.co.uk derekmillswealth.co.uk
derekscott.co.uk derekscott.co.uk
dilasserprivateclients.co.uk dilasserprivateclients.co.uk
dmcwm.co.uk dmcwm.co.uk
duncanwealth.co.uk duncanwealth.co.uk
ecclesgreenwood.co.uk ecclesgreenwood.co.uk
eswaranstone.com eswaranstone.com
executivewealth.co.uk executivewealth.co.uk
fawcettwm.co.uk fawcettwm.co.uk
fowlerfp.co.uk fowlerfp.co.uk
gdtwealthmanagement.co.uk gdtwealthmanagement.co.uk
godridgewealth.co.uk godridgewealth.co.uk
gofp.co.uk gofp.co.uk
goldbywealth.com goldbywealth.com
gpswealthmanagement.co.uk gpswealthmanagement.co.uk
harrisonjamesfp.co.uk harrisonjamesfp.co.uk
henshallwm.co.uk henshallwm.co.uk
hfwealthplanning.co.uk hfwealthplanning.co.uk
hindleandjepsonfs.co.uk hindleandjepsonfs.co.uk
hjwealthplanning.co.uk hjwealthplanning.co.uk
honeycroftwm.co.uk honeycroftwm.co.uk
huntminaswm.co.uk huntminaswm.co.uk
hwmwealth.co.uk hwmwealth.co.uk
hylandfp.co.uk hylandfp.co.uk
jenkinsandcofm.co.uk jenkinsandcofm.co.uk
jolyonroderickfp.co.uk jolyonroderickfp.co.uk
jsawealthmanagement.co.uk jsawealthmanagement.co.uk
kimgeorge.co.uk kimgeorge.co.uk
kmcwealthmanagement.co.uk kmcwealthmanagement.co.uk
krfinancialplanning.co.uk krfinancialplanning.co.uk
jwhwealth.co.uk jwhwealth.co.uk
kcwealth.co.uk kcwealth.co.uk
keithmarwick.co.uk keithmarwick.co.uk
kenbinniefinancialltd.co.uk kenbinniefinancialltd.co.uk
klafp.co.uk klafp.co.uk
ktwm.co.uk ktwm.co.uk
leowealth.co.uk leowealth.co.uk
lfp.co.uk lfp.co.uk
lyonsfinancialmanagement.co.uk lyonsfinancialmanagement.co.uk
mbjj.co.uk mbjj.co.uk
mckenzieandco.co.uk mckenzieandco.co.uk
mlfinancialconsultants.co.uk mlfinancialconsultants.co.uk
moranwealthmanagement.co.uk moranwealthmanagement.co.uk
neilloveitt.co.uk neilloveitt.co.uk
nigelwd.co.uk nigelwd.co.uk
odellwealth.com odellwealth.com
rectorygreenfs.co.uk rectorygreenfs.co.uk
oundlewealthmanagement.co.uk oundlewealthmanagement.co.uk
paulsamoilys.co.uk paulsamoilys.co.uk
paulsmithwm.co.uk paulsmithwm.co.uk
pbfwm.co.uk pbfwm.co.uk
pdprivateclient.co.uk pdprivateclient.co.uk
pfpwealth.co.uk pfpwealth.co.uk
pickeringandryefinancial.co.uk pickeringandryefinancial.co.uk
pjlwealthmanagement.com pjlwealthmanagement.com
pointtopointfm.co.uk pointtopointfm.co.uk
perchardwealthmanagement.co.uk perchardwealthmanagement.co.uk
prestfieldwm.co.uk prestfieldwm.co.uk
pricefp.co.uk pricefp.co.uk
prjfinancialplanning.co.uk prjfinancialplanning.co.uk
pswm.co.uk pswm.co.uk
pwmni.co.uk pwmni.co.uk
richardsonhewittfp.co.uk richardsonhewittfp.co.uk
rjfinancialplanning.co.uk rjfinancialplanning.co.uk
buttercrossfp.co.uk buttercrossfp.co.uk
bpwealthmanagement.co.uk bpwealthmanagement.co.uk
rogerswealthmanagement.co.uk rogerswealthmanagement.co.uk
rossmitchellwm.com rossmitchellwm.com
britannicfp.co.uk britannicfp.co.uk
adwfinancialsolutions.co.uk adwfinancialsolutions.co.uk
adrianwhitewm.co.uk adrianwhitewm.co.uk
saragray.co.uk saragray.co.uk
scottsymeswm.co.uk scottsymeswm.co.uk
akfm.co.uk akfm.co.uk
sfwm.co.uk sfwm.co.uk
alexanderdannwealthmanagementltd.co.uk alexanderdannwealthmanagementltd.co.uk
sharpfs.co.uk sharpfs.co.uk
sheebapadman.co.uk sheebapadman.co.uk
cambriawealth.co.uk cambriawealth.co.uk
cameronjonesfm.com cameronjonesfm.com
amandaredmanfp.co.uk amandaredmanfp.co.uk
sjbettridgefp.co.uk sjbettridgefp.co.uk
amberleyhulmewm.co.uk amberleyhulmewm.co.uk
sldwealth.co.uk sldwealth.co.uk
sleightwm.co.uk sleightwm.co.uk
anchorwmltd.co.uk anchorwmltd.co.uk
solosywm.co.uk solosywm.co.uk
andrewdavid.co.uk andrewdavid.co.uk
spwealth.co.uk spwealth.co.uk
sterlingfa.co.uk sterlingfa.co.uk
atlanticwc.co.uk atlanticwc.co.uk
templewoodwealth.co.uk templewoodwealth.co.uk
themjp.co.uk themjp.co.uk
threehillswealth.co.uk threehillswealth.co.uk
bassantfs.co.uk bassantfs.co.uk
beckwealth.co.uk beckwealth.co.uk
benchapmanwealth.co.uk benchapmanwealth.co.uk
berkleysquarepc.co.uk berkleysquarepc.co.uk
bffinancialplanning.co.uk bffinancialplanning.co.uk
bfpwealthmanagement.co.uk bfpwealthmanagement.co.uk
victoredmonds.co.uk victoredmonds.co.uk
vtwealth.co.uk vtwealth.co.uk
walbrookfinancial.co.uk walbrookfinancial.co.uk
wallwm.co.uk wallwm.co.uk
wardwealthmanagement.co.uk wardwealthmanagement.co.uk
watersdaywm.co.uk watersdaywm.co.uk
bowcliffewm.co.uk bowcliffewm.co.uk
wentworthwm.co.uk wentworthwm.co.uk
calderwoodwm.co.uk calderwoodwm.co.uk
chrisbuckland.co.uk chrisbuckland.co.uk
circlewealth.co.uk circlewealth.co.uk
cmpfinancial.co.uk cmpfinancial.co.uk
coecapital.co.uk coecapital.co.uk
cruddenfinancialplanning.co.uk cruddenfinancialplanning.co.uk
davidmasonfp.com davidmasonfp.com
dmbwealthmanagement.co.uk dmbwealthmanagement.co.uk
dpfinplan.com dpfinplan.com
eamonncassidy.co.uk eamonncassidy.co.uk
ellisonedwardswm.co.uk ellisonedwardswm.co.uk
frcfinancialplanning.co.uk frcfinancialplanning.co.uk
garyshieldswealthmanagementllp.co.uk garyshieldswealthmanagementllp.co.uk
gayworrow.co.uk gayworrow.co.uk
gbwealthmanagement.co.uk gbwealthmanagement.co.uk
gravitaswm.co.uk gravitaswm.co.uk
guthriefps.co.uk guthriefps.co.uk
hackettwealth.co.uk hackettwealth.co.uk
hamptonjamesfa.co.uk hamptonjamesfa.co.uk
hawkinsthomas.co.uk hawkinsthomas.co.uk
hawwm.co.uk hawwm.co.uk
holleronwm.co.uk holleronwm.co.uk
hutchinsonfinancialplanningltd.co.uk hutchinsonfinancialplanningltd.co.uk
ianbellwm.co.uk ianbellwm.co.uk
ianrennardfp.co.uk ianrennardfp.co.uk
ifswealth.co.uk ifswealth.co.uk
jbedwards.co.uk jbedwards.co.uk
jenningsfp.co.uk jenningsfp.co.uk
rcawealth.co.uk rcawealth.co.uk
rcwealthmanagement.co.uk rcwealthmanagement.co.uk
reedmanwm.co.uk reedmanwm.co.uk
reeffc.com reeffc.com
rollowm.co.uk rollowm.co.uk
rozsimcockwealthmanagement.co.uk rozsimcockwealthmanagement.co.uk
rsr-wm.co.uk rsr-wm.co.uk
salterwm.co.uk salterwm.co.uk
samuelcroudacewm.co.uk samuelcroudacewm.co.uk
samuellukeswm.co.uk samuellukeswm.co.uk
ajwwealth.co.uk ajwwealth.co.uk
ajtwealth.co.uk ajtwealth.co.uk
ajgwealthmanagement.co.uk ajgwealthmanagement.co.uk
ajbarnesfinancial.co.uk ajbarnesfinancial.co.uk
campbellcainwm.co.uk campbellcainwm.co.uk
alwealthmanagement.co.uk alwealthmanagement.co.uk
aleksjeromel.co.uk aleksjeromel.co.uk
shireswm.co.uk shireswm.co.uk
shubhokunduwm.co.uk shubhokunduwm.co.uk
annegibsonsjp.co.uk annegibsonsjp.co.uk
southdownsfp.co.uk southdownsfp.co.uk
arw-wm.com arw-wm.com
abacuswm.co.uk abacuswm.co.uk
adambentonwm.co.uk adambentonwm.co.uk
tailoredsolutionswm.co.uk tailoredsolutionswm.co.uk
aswealthmanagement.co.uk aswealthmanagement.co.uk
thomas-rigg.co.uk thomas-rigg.co.uk
bathwealth.co.uk bathwealth.co.uk
uwmwealth.co.uk uwmwealth.co.uk
blenheimwealthmanagement.co.uk blenheimwealthmanagement.co.uk
vibrantwealthmanagement.co.uk vibrantwealthmanagement.co.uk
vswealth.co.uk vswealth.co.uk
watchhousewm.co.uk watchhousewm.co.uk
westerhamfs.co.uk westerhamfs.co.uk
whitepeakwm.co.uk whitepeakwm.co.uk
wiltshirewm.co.uk wiltshirewm.co.uk
burfieldshousewm.co.uk burfieldshousewm.co.uk
cedarswm.co.uk cedarswm.co.uk
christianjohnwm.co.uk christianjohnwm.co.uk
chronoswm.co.uk chronoswm.co.uk
cooksonwm.co.uk cooksonwm.co.uk
countrysidefs.co.uk countrysidefs.co.uk
cranwellws.co.uk cranwellws.co.uk
curzonwm.com curzonwm.com
cyrpaillard.co.uk cyrpaillard.co.uk
davidmelrosewm.co.uk davidmelrosewm.co.uk
dbsfinancial.co.uk dbsfinancial.co.uk
ddlwealthmanagement.co.uk ddlwealthmanagement.co.uk
denmanfp.co.uk denmanfp.co.uk
doreewm.co.uk doreewm.co.uk
duncannunnwm.co.uk duncannunnwm.co.uk
dwjwealth.co.uk dwjwealth.co.uk
dyerandcowm.co.uk dyerandcowm.co.uk
eawealth.co.uk eawealth.co.uk
enverwm.co.uk enverwm.co.uk
flavellwm.co.uk flavellwm.co.uk
forbesfinancial.co.uk forbesfinancial.co.uk
haycockandgricefp.co.uk haycockandgricefp.co.uk
garymorrisonwm.co.uk garymorrisonwm.co.uk
gcadurham.co.uk gcadurham.co.uk
ginderswm.co.uk ginderswm.co.uk
godfreywealthmanagement.co.uk godfreywealthmanagement.co.uk
guthriewealthconsultancy.co.uk guthriewealthconsultancy.co.uk
hadlowedwards.co.uk hadlowedwards.co.uk
hartleywm.co.uk hartleywm.co.uk
heritagefc.co.uk heritagefc.co.uk
hesslewoodwm.co.uk hesslewoodwm.co.uk
hillandcofa.co.uk hillandcofa.co.uk
houghtonwm.co.uk houghtonwm.co.uk
hutchinsonwealthmanagement.co.uk hutchinsonwealthmanagement.co.uk
hwlwm.co.uk hwlwm.co.uk
igwm.co.uk igwm.co.uk
jeanlamb.co.uk jeanlamb.co.uk
jennerwm.co.uk jennerwm.co.uk
jmswealthmanagement.co.uk jmswealthmanagement.co.uk
johncummingswm.co.uk johncummingswm.co.uk
jopottsfinancialplanning.co.uk jopottsfinancialplanning.co.uk
jpnfinancial.co.uk jpnfinancial.co.uk
julianspencerwm.co.uk julianspencerwm.co.uk
kevindavieswm.co.uk kevindavieswm.co.uk
kirbyknott.co.uk kirbyknott.co.uk
kudoswealth.com kudoswealth.com
lehmannfinancialmanagement.co.uk lehmannfinancialmanagement.co.uk
lfhwealthmanagement.co.uk lfhwealthmanagement.co.uk
lisaleewealthmanagement.co.uk lisaleewealthmanagement.co.uk
lukecarless.co.uk lukecarless.co.uk
marknieldwm.co.uk marknieldwm.co.uk
marsonwm.co.uk marsonwm.co.uk
meadwm.co.uk meadwm.co.uk
mercianwm.co.uk mercianwm.co.uk
mglwealthmanagement.co.uk mglwealthmanagement.co.uk
mjbfp.co.uk mjbfp.co.uk
mkm-wealth.co.uk mkm-wealth.co.uk
mountstuartwm.co.uk mountstuartwm.co.uk
mwcarefeesadvice.co.uk mwcarefeesadvice.co.uk
oakmerewealth.co.uk oakmerewealth.co.uk
paularodriguez.co.uk paularodriguez.co.uk
paulbutlerwm.co.uk paulbutlerwm.co.uk
paulmkavanagh.co.uk paulmkavanagh.co.uk
peterallensjp.co.uk peterallensjp.co.uk
petermooresjp.co.uk petermooresjp.co.uk
portburywealth.co.uk portburywealth.co.uk
prudentfpa.co.uk prudentfpa.co.uk
ptrembeth.co.uk ptrembeth.co.uk
puxleypartnership.co.uk puxleypartnership.co.uk
pwandpartners.co.uk pwandpartners.co.uk
rachaelbellwealthmanagement.co.uk rachaelbellwealthmanagement.co.uk
randallwm.co.uk randallwm.co.uk
abbeywealthmanagement.co.uk abbeywealthmanagement.co.uk
rodneyspillerwm.co.uk rodneyspillerwm.co.uk
roseassociatesfp.co.uk roseassociatesfp.co.uk
rtwwealth.co.uk rtwwealth.co.uk
ryleywm.co.uk ryleywm.co.uk
samrawm.co.uk samrawm.co.uk
alanhillfp.co.uk alanhillfp.co.uk
alpewealthmanagement.co.uk alpewealthmanagement.co.uk
alisongregorywm.co.uk alisongregorywm.co.uk
almavalewealthmanagement.co.uk almavalewealthmanagement.co.uk
silvertreewm.co.uk silvertreewm.co.uk
sneddonfp.co.uk sneddonfp.co.uk
anderson-wealthmanagement.co.uk anderson-wealthmanagement.co.uk
stilgoefm.co.uk stilgoefm.co.uk
atlanticwealth.co.uk atlanticwealth.co.uk
aagwealthmanagement.co.uk aagwealthmanagement.co.uk
thindwealthadvisory.co.uk thindwealthadvisory.co.uk
treskelionfp.co.uk treskelionfp.co.uk
twomeywm.co.uk twomeywm.co.uk
valantineassociates.co.uk valantineassociates.co.uk
villageestatesfc.co.uk villageestatesfc.co.uk
watchoakpw.co.uk watchoakpw.co.uk
bowaterwealth.co.uk bowaterwealth.co.uk
westbrookfs.co.uk westbrookfs.co.uk
wharfebank.co.uk wharfebank.co.uk
brianemslie.co.uk brianemslie.co.uk
whitewm.co.uk whitewm.co.uk
wilkinsonfinancialmgt.co.uk wilkinsonfinancialmgt.co.uk
wjpickering.co.uk wjpickering.co.uk
wolfewealth.co.uk wolfewealth.co.uk
wyefieldwm.co.uk wyefieldwm.co.uk
castellwm.co.uk castellwm.co.uk
claytondenefp.co.uk claytondenefp.co.uk
colinjessopp.co.uk colinjessopp.co.uk
colinrexwm.co.uk colinrexwm.co.uk
cotswoldwealth.co.uk cotswoldwealth.co.uk
ctpwm.co.uk ctpwm.co.uk
dalejohnsonwealthmanagement.co.uk dalejohnsonwealthmanagement.co.uk
daleycroft.co.uk daleycroft.co.uk
danielburnswm.co.uk danielburnswm.co.uk
davidgallagherwm.com davidgallagherwm.com
djbrewsterfcs.co.uk djbrewsterfcs.co.uk
duleypractice.co.uk duleypractice.co.uk
dwbwealth.co.uk dwbwealth.co.uk
dwmfp.co.uk dwmfp.co.uk
eadenwm.co.uk eadenwm.co.uk
fisherwealthconsultancy.co.uk fisherwealthconsultancy.co.uk
fortemfm.co.uk fortemfm.co.uk
heraldwealth.co.uk heraldwealth.co.uk
fyldewealthmanagement.co.uk fyldewealthmanagement.co.uk
goldsmithwm.co.uk goldsmithwm.co.uk
goodallsmith.co.uk goodallsmith.co.uk
gregorywm.co.uk gregorywm.co.uk
griersonwm.co.uk griersonwm.co.uk
havenwealthmanagement.co.uk havenwealthmanagement.co.uk
hetalpatelwealth.co.uk hetalpatelwealth.co.uk
ianhuntwm.co.uk ianhuntwm.co.uk
islinwm.co.uk islinwm.co.uk
jfwealth.co.uk jfwealth.co.uk
johnclementswealthmanagement.co.uk johnclementswealthmanagement.co.uk
kearsleyfinancialmanagement.co.uk kearsleyfinancialmanagement.co.uk
kevinmunrofp.co.uk kevinmunrofp.co.uk
kevinprobertwealthmanagement.co.uk kevinprobertwealthmanagement.co.uk
kmosbyfinancial.co.uk kmosbyfinancial.co.uk
las-wealth.co.uk las-wealth.co.uk
leeswm.co.uk leeswm.co.uk
liztuccy.co.uk liztuccy.co.uk
matrixwp.co.uk matrixwp.co.uk
napierlane.com napierlane.com
navigationwm.co.uk navigationwm.co.uk
networkventuresfs.co.uk networkventuresfs.co.uk
nicholsonwm.co.uk nicholsonwm.co.uk
nickclarkwm.co.uk nickclarkwm.co.uk
osmanwealth.co.uk osmanwealth.co.uk
paulabicknellwealth.co.uk paulabicknellwealth.co.uk
paulasherlock-cross.co.uk paulasherlock-cross.co.uk
paulgeddeswm.co.uk paulgeddeswm.co.uk
pfpswm.com pfpswm.com
poundburywealth.co.uk poundburywealth.co.uk
psgwealth.co.uk psgwealth.co.uk
queenssquarewealth.co.uk queenssquarewealth.co.uk
rebeccapope.co.uk rebeccapope.co.uk
laurencewilkinson.co.uk laurencewilkinson.co.uk
leeblissettwealthmanagement.co.uk leeblissettwealthmanagement.co.uk
linleyblack.com linleyblack.com
lisawickenswm.co.uk lisawickenswm.co.uk
lmcfinancialplanning.co.uk lmcfinancialplanning.co.uk
lochviewfinancialplanning.co.uk lochviewfinancialplanning.co.uk
lombardwealthassociates.co.uk lombardwealthassociates.co.uk
lpwealth.co.uk lpwealth.co.uk
macintyrewealth.co.uk macintyrewealth.co.uk
mainewealth.co.uk mainewealth.co.uk
mandersfinancialservices.co.uk mandersfinancialservices.co.uk
marclbennett.co.uk marclbennett.co.uk
marcsmelt.co.uk marcsmelt.co.uk
marionsiddall.co.uk marionsiddall.co.uk
maskerywealthmanagement.com maskerywealthmanagement.com
masonswealthassociates.co.uk masonswealthassociates.co.uk
mastersfinancial.co.uk mastersfinancial.co.uk
mathieson-financial-services.co.uk mathieson-financial-services.co.uk
melluter.co.uk melluter.co.uk
merlinwealthmanagement.co.uk merlinwealthmanagement.co.uk
michellesheppard.co.uk michellesheppard.co.uk
narwalwm.co.uk narwalwm.co.uk
nathanind.co.uk nathanind.co.uk
neathercoat.com neathercoat.com
niceassociates.co.uk niceassociates.co.uk
norfolkwealthmanagement.co.uk norfolkwealthmanagement.co.uk
npfc.co.uk npfc.co.uk
oakdalefinancialservices.co.uk oakdalefinancialservices.co.uk
olcotelappin.co.uk olcotelappin.co.uk
patmclaughlin.co.uk patmclaughlin.co.uk
paton-feaver.com paton-feaver.com
paulwardwealth.co.uk paulwardwealth.co.uk
pentelow-wealth-management.co.uk pentelow-wealth-management.co.uk
pettengellwealth.co.uk pettengellwealth.co.uk
philiphamilton.co.uk philiphamilton.co.uk
pollardwealthmanagement.co.uk pollardwealthmanagement.co.uk
priteshpankhania.co.uk priteshpankhania.co.uk
chapel-wealth.co.uk chapel-wealth.co.uk
ridlandwealth.co.uk ridlandwealth.co.uk
roburwm.co.uk roburwm.co.uk
robinson-porteous.co.uk robinson-porteous.co.uk
brownlow.co.uk brownlow.co.uk
robinsonwealth.co.uk robinsonwealth.co.uk
broadhurstfm.co.uk broadhurstfm.co.uk
sandafinancialservice.com sandafinancialservice.com
admitchellfinancialplanning.co.uk admitchellfinancialplanning.co.uk
seandownswealthmanagement.co.uk seandownswealthmanagement.co.uk
alanrutherfordwealth.co.uk alanrutherfordwealth.co.uk
alexanderswm.co.uk alexanderswm.co.uk
shenleyprivatewealth.co.uk shenleyprivatewealth.co.uk
shiptonwealth.co.uk shiptonwealth.co.uk
armstrongswealth.co.uk armstrongswealth.co.uk
snwfinancialplanning.co.uk snwfinancialplanning.co.uk
andersonwealthplanning.co.uk andersonwealthplanning.co.uk
andrewswealth.co.uk andrewswealth.co.uk
stephenpitcher.co.uk stephenpitcher.co.uk
sullivanwealthmanagement.co.uk sullivanwealthmanagement.co.uk
ashleyjai.co.uk ashleyjai.co.uk
taffetsaufferwm.co.uk taffetsaufferwm.co.uk
atkinsfinancialmanagement.co.uk atkinsfinancialmanagement.co.uk
thederouetpartnership.co.uk thederouetpartnership.co.uk
thestrainpractice.co.uk thestrainpractice.co.uk
timmswealthmanagement.co.uk timmswealthmanagement.co.uk
barneswealthmanagement.co.uk barneswealthmanagement.co.uk
beauchampwealth.co.uk beauchampwealth.co.uk
tpcwealth.co.uk tpcwealth.co.uk
bedfordwm.co.uk bedfordwm.co.uk
trbarbour.co.uk trbarbour.co.uk
bellamywealthmanagement.co.uk bellamywealthmanagement.co.uk
benningfm.com benningfm.com
vcpc.co.uk vcpc.co.uk
blancowealthmanagement.co.uk blancowealthmanagement.co.uk
walkerwm.co.uk walkerwm.co.uk
wealthandfinancematterslimited.co.uk wealthandfinancematterslimited.co.uk
whitelockfinancialplanning.co.uk whitelockfinancialplanning.co.uk
bullwm.co.uk bullwm.co.uk
cadmanandco.co.uk cadmanandco.co.uk
chasebridgewm.co.uk chasebridgewm.co.uk
chrisjwilkinson.co.uk chrisjwilkinson.co.uk
cliftonwealthmanagement.co.uk cliftonwealthmanagement.co.uk
colyerassociates.co.uk colyerassociates.co.uk
coronationwealth.co.uk coronationwealth.co.uk
davidbeanwealth.co.uk davidbeanwealth.co.uk
davidhannonwealthmanagement.co.uk davidhannonwealthmanagement.co.uk
davidmccollwealthmanagement.co.uk davidmccollwealthmanagement.co.uk
douglasrowefs.co.uk douglasrowefs.co.uk
easternwealth.co.uk easternwealth.co.uk
eatlywm.co.uk eatlywm.co.uk
experiumfinancialservices.co.uk experiumfinancialservices.co.uk
firstchoicefinancial.co.uk firstchoicefinancial.co.uk
franciswealth.co.uk franciswealth.co.uk
gainsboroughwealthmanagement.co.uk gainsboroughwealthmanagement.co.uk
garyhewett.co.uk garyhewett.co.uk
gibsonlaingwealth.co.uk gibsonlaingwealth.co.uk
gillespiefinancial.com gillespiefinancial.com
grahamtiney.co.uk grahamtiney.co.uk
grovewealthmanagement.info grovewealthmanagement.info
gsqwealth.co.uk gsqwealth.co.uk
harmansmith.co.uk harmansmith.co.uk
hartyltd.co.uk hartyltd.co.uk
hfinancialplanning.co.uk hfinancialplanning.co.uk
hugocraggs.co.uk hugocraggs.co.uk
iccwealthmanagement.co.uk iccwealthmanagement.co.uk
irpwealth.co.uk irpwealth.co.uk
iwmwealth.co.uk iwmwealth.co.uk
janineedwards.co.uk janineedwards.co.uk
jennymoloney.co.uk jennymoloney.co.uk
jenybeardsley.co.uk jenybeardsley.co.uk
johnsherlock.co.uk johnsherlock.co.uk
johntavender.co.uk johntavender.co.uk
kanishkswarup.co.uk kanishkswarup.co.uk
kdmurraywm.co.uk kdmurraywm.co.uk
kimdevinefp.co.uk kimdevinefp.co.uk
klcfinancial.co.uk klcfinancial.co.uk
joybarden.co.uk joybarden.co.uk
jpprivateclients.co.uk jpprivateclients.co.uk
jsfinancialplanning.co.uk jsfinancialplanning.co.uk
juliantrumper.co.uk juliantrumper.co.uk
justinredwards.co.uk justinredwards.co.uk
kevinwhite.co.uk kevinwhite.co.uk
kingsforestwealth.co.uk kingsforestwealth.co.uk
kpfinancialwellbeing.co.uk kpfinancialwellbeing.co.uk
langleyparkwealth.co.uk langleyparkwealth.co.uk
leemerrettwealthmanagement.co.uk leemerrettwealthmanagement.co.uk
leonardwealthsolutions.co.uk leonardwealthsolutions.co.uk
lettswealthmanagement.co.uk lettswealthmanagement.co.uk
leversedgewm.co.uk leversedgewm.co.uk
lockwoodwealth.co.uk lockwoodwealth.co.uk
mandyknox.co.uk mandyknox.co.uk
markingarfield.co.uk markingarfield.co.uk
marktimmins.com marktimmins.com
martinjonesfinancialservices.co.uk martinjonesfinancialservices.co.uk
matthewwilkeswealthmanagement.co.uk matthewwilkeswealthmanagement.co.uk
mcknightassociates.co.uk mcknightassociates.co.uk
mercuryfinancial.co.uk mercuryfinancial.co.uk
moifc.co.uk moifc.co.uk
moranprivateclientpractice.co.uk moranprivateclientpractice.co.uk
murrowwealthmanagement.co.uk murrowwealthmanagement.co.uk
newforestwealthmanagement.co.uk newforestwealthmanagement.co.uk
newsomewealthmanagement.co.uk newsomewealthmanagement.co.uk
oliverreeve.co.uk oliverreeve.co.uk
redoakwealth.co.uk redoakwealth.co.uk
patrickwardconsulting.co.uk patrickwardconsulting.co.uk
penrosewealthmanagement.co.uk penrosewealthmanagement.co.uk
penvearnwealthmanagement.co.uk penvearnwealthmanagement.co.uk
reliancewealth.co.uk reliancewealth.co.uk
petersimonsfinancialservices.co.uk petersimonsfinancialservices.co.uk
phillipsparham.co.uk phillipsparham.co.uk
provestfs.co.uk provestfs.co.uk
rhodesbrook.co.uk rhodesbrook.co.uk
castlerockwealth.co.uk castlerockwealth.co.uk
buchananfp.co.uk buchananfp.co.uk
russellfairbrass.co.uk russellfairbrass.co.uk
ruthhomberger.co.uk ruthhomberger.co.uk
samuelsfinancial.co.uk samuelsfinancial.co.uk
adamsonross.co.uk adamsonross.co.uk
sarahquirkassociates.co.uk sarahquirkassociates.co.uk
sarahsiddons.co.uk sarahsiddons.co.uk
alanfilsell.co.uk alanfilsell.co.uk
altonwealth.co.uk altonwealth.co.uk
alexcaulder.co.uk alexcaulder.co.uk
alistairblack.com alistairblack.com
silverthornwealth.co.uk silverthornwealth.co.uk
simonroffey.co.uk simonroffey.co.uk
amgwealthmanagement.com amgwealthmanagement.com
smithhobbswealth.co.uk smithhobbswealth.co.uk
anglianwealthmanagement.co.uk anglianwealthmanagement.co.uk
solentwealth.co.uk solentwealth.co.uk
andrewskinnerwealth.co.uk andrewskinnerwealth.co.uk
andrewvrettos.co.uk andrewvrettos.co.uk
stevejoyce.co.uk stevejoyce.co.uk
sussexwealthmanagement.com sussexwealthmanagement.com
swannfinancial.co.uk swannfinancial.co.uk
swiftsurewealthmanagement.co.uk swiftsurewealthmanagement.co.uk
templemewswm.co.uk templemewswm.co.uk
avantiwm.co.uk avantiwm.co.uk
theplattpartnership.com theplattpartnership.com
thompsonfinancialplanning.co.uk thompsonfinancialplanning.co.uk
thompstonewm.co.uk thompstonewm.co.uk
berkeleystjames-wm.co.uk berkeleystjames-wm.co.uk
blackdownwealthmanagement.co.uk blackdownwealthmanagement.co.uk
vinitmehta.co.uk vinitmehta.co.uk
bloomerwealth.co.uk bloomerwealth.co.uk
welshandtaylorwealth.co.uk welshandtaylorwealth.co.uk
brittonassociates.co.uk brittonassociates.co.uk
bromileyandpartners.co.uk bromileyandpartners.co.uk
brooksfinancialplanning.co.uk brooksfinancialplanning.co.uk
willsfinancial.co.uk willsfinancial.co.uk
williamsonwm.co.uk williamsonwm.co.uk
williamswealthmanagement.co.uk williamswealthmanagement.co.uk
willingalewealthmanagement.co.uk willingalewealthmanagement.co.uk
wronskiwealthmanagement.co.uk wronskiwealthmanagement.co.uk
carlcrossfield.co.uk carlcrossfield.co.uk
chalkfarmfinancial.co.uk chalkfarmfinancial.co.uk
chapman-associates.co.uk chapman-associates.co.uk
chromaticwealth.co.uk chromaticwealth.co.uk
clarenceplace.co.uk clarenceplace.co.uk
claywarden.co.uk claywarden.co.uk
comfortfinancial.co.uk comfortfinancial.co.uk
constantiawealthandfinance.co.uk constantiawealthandfinance.co.uk
copperrock.co.uk copperrock.co.uk
cordata.co.uk cordata.co.uk
cormackwealthmanagement.co.uk cormackwealthmanagement.co.uk
cornerstonewealthmanagement.co.uk cornerstonewealthmanagement.co.uk
davidsonpert.co.uk davidsonpert.co.uk
denhamwm.co.uk denhamwm.co.uk
djswealthadviser.co.uk djswealthadviser.co.uk
flackwellfs.com flackwellfs.com
frazerwealth.co.uk frazerwealth.co.uk
gallimorewealthmanagement.co.uk gallimorewealthmanagement.co.uk
goldingandpartners.co.uk goldingandpartners.co.uk
goldwealthmanagement.co.uk goldwealthmanagement.co.uk
greenwealthplanning.co.uk greenwealthplanning.co.uk
greenwoodwealthsolutions.co.uk greenwoodwealthsolutions.co.uk
hargreaveswealth.co.uk hargreaveswealth.co.uk
ingramwealthmanagement.co.uk ingramwealthmanagement.co.uk
iqandco.com iqandco.com
jamieweller.co.uk jamieweller.co.uk
jlwealthconsultancy.co.uk jlwealthconsultancy.co.uk
joethomas.info joethomas.info
johnpigott.co.uk johnpigott.co.uk
jolyonhankinson.co.uk jolyonhankinson.co.uk
jonathanjgibbons.co.uk jonathanjgibbons.co.uk
reasonwilliamspartnership.co.uk reasonwilliamspartnership.co.uk
robertapugh.co.uk robertapugh.co.uk
robertpilnick.co.uk robertpilnick.co.uk
rosspenman.co.uk rosspenman.co.uk
rwafp.com rwafp.com
adhwealthmanagement.co.uk adhwealthmanagement.co.uk
sarahbuckwealthmanagement.co.uk sarahbuckwealthmanagement.co.uk
scottwallace.co.uk scottwallace.co.uk
scrivenerfinancial.co.uk scrivenerfinancial.co.uk
sedgwickwm.co.uk sedgwickwm.co.uk
selectinvestors.sg selectinvestors.sg
alisonwright.co.uk alisonwright.co.uk
macfarlanewealthpartners.com macfarlanewealthpartners.com
antlerwealth.co.uk antlerwealth.co.uk
antonyearley.co.uk antonyearley.co.uk
andrewclarey.co.uk andrewclarey.co.uk
andrewoliverfinancial.co.uk andrewoliverfinancial.co.uk
andrewrogerswm.co.uk andrewrogerswm.co.uk
andybarrettsjp.co.uk andybarrettsjp.co.uk
sterlingwealthmanagement.co.uk sterlingwealthmanagement.co.uk
stevenheyes.co.uk stevenheyes.co.uk
stevereeswealthmanagement.co.uk stevereeswealthmanagement.co.uk
storercfp.co.uk storercfp.co.uk
carpenterwealthmanagement.co.uk carpenterwealthmanagement.co.uk
athertonandassociates.co.uk athertonandassociates.co.uk
terencegoddardassociates.co.uk terencegoddardassociates.co.uk
avonwoodfinancial.co.uk avonwoodfinancial.co.uk
thegrahamharmspractice.co.uk thegrahamharmspractice.co.uk
ballantinewm.co.uk ballantinewm.co.uk
throgmortonassociates.co.uk throgmortonassociates.co.uk
batchworthwealth.co.uk batchworthwealth.co.uk
beckfordandlewis.co.uk beckfordandlewis.co.uk
bennisonyates.co.uk bennisonyates.co.uk
bhtwealthmanagement.co.uk bhtwealthmanagement.co.uk
blackwaterwealthmanagement.co.uk blackwaterwealthmanagement.co.uk
blossomwealth.co.uk blossomwealth.co.uk
vittyalexander.co.uk vittyalexander.co.uk
bootefinancial.co.uk bootefinancial.co.uk
breretonjacksonfinancial.co.uk breretonjacksonfinancial.co.uk
wilcoxday.co.uk wilcoxday.co.uk
bryantassociates.co.uk bryantassociates.co.uk
wilkinsonwealth.co.uk wilkinsonwealth.co.uk
callumleachwm.co.uk callumleachwm.co.uk
cedarvalegroup.co.uk cedarvalegroup.co.uk
cmjfinancialplanning.co.uk cmjfinancialplanning.co.uk
cockbainassociates.co.uk cockbainassociates.co.uk
coenandclark.co.uk coenandclark.co.uk
corneliuswealth.co.uk corneliuswealth.co.uk
crawforddean.co.uk crawforddean.co.uk
davewalkerwealthmanagement.co.uk davewalkerwealthmanagement.co.uk
davidhillwealth.co.uk davidhillwealth.co.uk
davidmakin.co.uk davidmakin.co.uk
deltawealth.co.uk deltawealth.co.uk
doweswealthmanagement.co.uk doweswealthmanagement.co.uk
drewharperfinancialconsultants.co.uk drewharperfinancialconsultants.co.uk
edenwoodwealth.com edenwoodwealth.com
edmundwilson.co.uk edmundwilson.co.uk
elliottwealthmanagement.co.uk elliottwealthmanagement.co.uk
financialwealthsolutions.co.uk financialwealthsolutions.co.uk
firmitasfs.co.uk firmitasfs.co.uk
florastamato.co.uk florastamato.co.uk
frankmcmillan.co.uk frankmcmillan.co.uk
garryjohnsonwealthmanagement.co.uk garryjohnsonwealthmanagement.co.uk
hayesfinancialplanning.com hayesfinancialplanning.com
hayeswealthmanagement.co.uk hayeswealthmanagement.co.uk
gildedwealth.co.uk gildedwealth.co.uk
gillisfinancial.co.uk gillisfinancial.co.uk
grahamwealthmanagement.co.uk grahamwealthmanagement.co.uk
greavesfinancialservices.co.uk greavesfinancialservices.co.uk
gregjmiddleton.co.uk gregjmiddleton.co.uk
harnhill.com harnhill.com
harriesfinancial.co.uk harriesfinancial.co.uk
hartfordwealth.co.uk hartfordwealth.co.uk
horizonwealthconsultancy.co.uk horizonwealthconsultancy.co.uk
howardfinancialplanning.co.uk howardfinancialplanning.co.uk
iancrookwm.co.uk iancrookwm.co.uk
impactwm.co.uk impactwm.co.uk
investasure.co.im investasure.co.im
jamielewington.co.uk jamielewington.co.uk
jeremybarrett.co.uk jeremybarrett.co.uk
jerimeattah.co.uk jerimeattah.co.uk
jon-paulhardy.co.uk jon-paulhardy.co.uk
jonathangrantwealth.co.uk jonathangrantwealth.co.uk
jonpittey.co.uk jonpittey.co.uk
juliedaweswealthmanagement.co.uk juliedaweswealthmanagement.co.uk
juliehowiesonwealthmanagement.co.uk juliehowiesonwealthmanagement.co.uk
kathwilkinson.co.uk kathwilkinson.co.uk
kennettwealthmanagement.co.uk kennettwealthmanagement.co.uk
keystonefinancial.co.uk keystonefinancial.co.uk
kineticwealthmanagement.co.uk kineticwealthmanagement.co.uk
lenwalters.co.uk lenwalters.co.uk
lesterbrunt.co.uk lesterbrunt.co.uk
lisaeveritt.co.uk lisaeveritt.co.uk
littlepebbles.co.uk littlepebbles.co.uk
lockingtonfinancial.co.uk lockingtonfinancial.co.uk
louisewoollardfinancial.co.uk louisewoollardfinancial.co.uk
lynnanderson.co.uk lynnanderson.co.uk
malcolmfrost.co.uk malcolmfrost.co.uk
marquewealth.co.uk marquewealth.co.uk
martellowealth.co.uk martellowealth.co.uk
masperoassociates.co.uk masperoassociates.co.uk
matthewgreenhalgh.co.uk matthewgreenhalgh.co.uk
maylamfinancial.co.uk maylamfinancial.co.uk
mbarclay.co.uk mbarclay.co.uk
mbwwealthmanagement.co.uk mbwwealthmanagement.co.uk
mellingfp.co.uk mellingfp.co.uk
michaelkiener.co.uk michaelkiener.co.uk
myerswealthmanagement.co.uk myerswealthmanagement.co.uk
neilforeman.co.uk neilforeman.co.uk
newmanrea.com newmanrea.com
nickspence.co.uk nickspence.co.uk
nigelcookewm.co.uk nigelcookewm.co.uk
njwealthplanning.co.uk njwealthplanning.co.uk
oreillywealthmanagement.co.uk oreillywealthmanagement.co.uk
paulmorganwealthmanagement.co.uk paulmorganwealthmanagement.co.uk
rickettsfp.co.uk rickettsfp.co.uk
pdfinancialmanagement.co.uk pdfinancialmanagement.co.uk
penninewealthmanagement.co.uk penninewealthmanagement.co.uk
peter-walmsley.co.uk peter-walmsley.co.uk
peterwildwealth.co.uk peterwildwealth.co.uk
pjwwealth.co.uk pjwwealth.co.uk
primusfinancial.co.uk primusfinancial.co.uk
priorywealthmanagement.co.uk priorywealthmanagement.co.uk
prosperawealth.co.uk prosperawealth.co.uk
rajivprabhakar.co.uk rajivprabhakar.co.uk
richardbrewster.co.uk richardbrewster.co.uk
richardcbooth.co.uk richardcbooth.co.uk
richardjkbrown.co.uk richardjkbrown.co.uk
rmbfc.co.uk rmbfc.co.uk
lorrainecoaton.co.uk lorrainecoaton.co.uk
rsrobertsonfp.co.uk rsrobertsonfp.co.uk
lucialangella.co.uk lucialangella.co.uk
accessionrwm.co.uk accessionrwm.co.uk
adamsandbowleswm.co.uk adamsandbowleswm.co.uk
sarahmhughes.co.uk sarahmhughes.co.uk
sarahspraguewealthmanagement.co.uk sarahspraguewealthmanagement.co.uk
savvideswealthmanagement.co.uk savvideswealthmanagement.co.uk
scottjamesandassociates.co.uk scottjamesandassociates.co.uk
shaunajhappan.co.uk shaunajhappan.co.uk
alexziff.com alexziff.com
simonbraywm.co.uk simonbraywm.co.uk
simonlipp.co.uk simonlipp.co.uk
smartinfinancialplanning.co.uk smartinfinancialplanning.co.uk
smithjackson.co.uk smithjackson.co.uk
askwealthmanagement.co.uk askwealthmanagement.co.uk
andersonfinancial.co.uk andersonfinancial.co.uk
andrewconnolly.co.uk andrewconnolly.co.uk
spillaneandcompany.co.uk spillaneandcompany.co.uk
carterlegrand.co.uk carterlegrand.co.uk
casewealth.co.uk casewealth.co.uk
stanleyfinancial.co.uk stanleyfinancial.co.uk
stevenswealthmanagement.co.uk stevenswealthmanagement.co.uk
stwwealth.co.uk stwwealth.co.uk
swindonfinancialservices.com swindonfinancialservices.com
taitfinancialservices.co.uk taitfinancialservices.co.uk
tarnwealthmanagement.co.uk tarnwealthmanagement.co.uk
tcolleyassociates.co.uk tcolleyassociates.co.uk
taylorfinancial.co.uk taylorfinancial.co.uk
thomaswealthadvisory.co.uk thomaswealthadvisory.co.uk
thomlinsonwealthmanagement.co.uk thomlinsonwealthmanagement.co.uk
bathandwestwealth.co.uk bathandwestwealth.co.uk
trevorngraham.co.uk trevorngraham.co.uk
twelvewm.co.uk twelvewm.co.uk
bhwml.co.uk bhwml.co.uk
virtuewealthsolutions.co.uk virtuewealthsolutions.co.uk
westgatewealth.co.uk westgatewealth.co.uk
bricknellwealth.co.uk bricknellwealth.co.uk
bridgesandco.co.uk bridgesandco.co.uk
broadcharepartners.co.uk broadcharepartners.co.uk
willgcunningham.co.uk willgcunningham.co.uk
willowbrooklfp.co.uk willowbrooklfp.co.uk
wilsonwealthmanagement.co.uk wilsonwealthmanagement.co.uk
woodheadwm.co.uk woodheadwm.co.uk
woodstockwealthmanagement.co.uk woodstockwealthmanagement.co.uk
wrightshadwell.co.uk wrightshadwell.co.uk
burn-joneswealthmanagement.co.uk burn-joneswealthmanagement.co.uk
burtonhills.co.uk burtonhills.co.uk
capitalplanningpartners.co.uk capitalplanningpartners.co.uk
cathedralgreenfinancialplanning.co.uk cathedralgreenfinancialplanning.co.uk
clearwaterwealthmanagement.co.uk clearwaterwealthmanagement.co.uk
coldfairwealthmanagement.co.uk coldfairwealthmanagement.co.uk
colefinancial.co.uk colefinancial.co.uk
corinthianwealthmanagement.co.uk corinthianwealthmanagement.co.uk
craigjameswm.co.uk craigjameswm.co.uk
dalviwealth.co.uk dalviwealth.co.uk
darronchildspractice.co.uk darronchildspractice.co.uk
davidkeddie.co.uk davidkeddie.co.uk
daviswealth.co.uk daviswealth.co.uk
deltachelmsford.co.uk deltachelmsford.co.uk
educate-financial.co.uk educate-financial.co.uk
edwardjowilson.co.uk edwardjowilson.co.uk
ejwm.co.uk ejwm.co.uk
equinoxfinancialplanning.co.uk equinoxfinancialplanning.co.uk
farrowwealth.co.uk farrowwealth.co.uk
flynnwealthmanagement.co.uk flynnwealthmanagement.co.uk
garywalker.co.uk garywalker.co.uk
genoawealthmanagement.co.uk genoawealthmanagement.co.uk
gregthomsonwealth.co.uk gregthomsonwealth.co.uk
grovewoodwealth.co.uk grovewoodwealth.co.uk
hallandcostellowealthmanagement.co.uk hallandcostellowealthmanagement.co.uk
hamesassociates.co.uk hamesassociates.co.uk
hamwicwealth.co.uk hamwicwealth.co.uk
highhousewealth.co.uk highhousewealth.co.uk
hilljohnstone.co.uk hilljohnstone.co.uk
howefinancialadvisers.co.uk howefinancialadvisers.co.uk
invictuswealth.co.uk invictuswealth.co.uk
iptucker.co.uk iptucker.co.uk
jameselliottwealthmanagement.co.uk jameselliottwealthmanagement.co.uk
jpswealthmanagement.co.uk jpswealthmanagement.co.uk
kgrwealth.co.uk kgrwealth.co.uk
kpwoodandassociates.co.uk kpwoodandassociates.co.uk
lambert-wealth.co.uk lambert-wealth.co.uk
latorrewealthmanagement.co.uk latorrewealthmanagement.co.uk
leedowdall.com leedowdall.com
littlewickwealthmanagement.co.uk littlewickwealthmanagement.co.uk
ljwealthmanagement.co.uk ljwealthmanagement.co.uk
louisewarland.co.uk louisewarland.co.uk
magorwealthmanagement.co.uk magorwealthmanagement.co.uk
mardons.co.uk mardons.co.uk
markkidd.co.uk markkidd.co.uk
marshallwealthmanagement.co.uk marshallwealthmanagement.co.uk
martinkeyte.co.uk martinkeyte.co.uk
matthewjohnrowland.co.uk matthewjohnrowland.co.uk
matthewwykes.co.uk matthewwykes.co.uk
mccuewealthmanagement.co.uk mccuewealthmanagement.co.uk
mcleanandpartnerswm.co.uk mcleanandpartnerswm.co.uk
mercerandassociates.co.uk mercerandassociates.co.uk
metcalfewealth.co.uk metcalfewealth.co.uk
michaelmacauley.co.uk michaelmacauley.co.uk
murraywealthmanagement.co.uk murraywealthmanagement.co.uk
newmanlangley.co.uk newmanlangley.co.uk
nickcumminswealthmanagement.co.uk nickcumminswealthmanagement.co.uk
oloughlinandco.co.uk oloughlinandco.co.uk
palmerwealth.co.uk palmerwealth.co.uk
papewealthmanagement.co.uk papewealthmanagement.co.uk
pdavisfinancial.co.uk pdavisfinancial.co.uk
persellewart.co.uk persellewart.co.uk
plummerandassociates.co.uk plummerandassociates.co.uk
pritchardwm.co.uk pritchardwm.co.uk
probertwealthmanagement.co.uk probertwealthmanagement.co.uk
quaysidewealthmanagement.co.uk quaysidewealthmanagement.co.uk
reeswealthmanagement.co.uk reeswealthmanagement.co.uk
legacywealth.sg legacywealth.sg
lifeandlegacywm.co.uk lifeandlegacywm.co.uk
lifetimeconnections.co.uk lifetimeconnections.co.uk
mansionhousefp.co.uk mansionhousefp.co.uk
minsterwealthmanagement.co.uk minsterwealthmanagement.co.uk
moorewealth.co.uk moorewealth.co.uk
one-wealth.co.uk one-wealth.co.uk
paulgschofield.co.uk paulgschofield.co.uk
petergavin.net petergavin.net
rhiannongoghfp.co.uk rhiannongoghfp.co.uk
robertshawsidlow-wealth.co.uk robertshawsidlow-wealth.co.uk
rppw.co.uk rppw.co.uk
mgwealth.co.uk mgwealth.co.uk
silverdomefinancial.co.uk silverdomefinancial.co.uk
sjp.co.uk sjp.co.uk
smtwealth.co.uk smtwealth.co.uk
andrewwhiting.co.uk andrewwhiting.co.uk
stroudwm.co.uk stroudwm.co.uk
templecloudwm.co.uk templecloudwm.co.uk
barnesrobertson.com barnesrobertson.com
walfordwealth.co.uk walfordwealth.co.uk
willgrace.co.uk willgrace.co.uk
coulterweir.co.uk coulterweir.co.uk
frizzellandpartners.co.uk frizzellandpartners.co.uk
graywealth.co.uk graywealth.co.uk
hallwealth.co.uk hallwealth.co.uk
jamiecalder.co.uk jamiecalder.co.uk
johncharper.co.uk johncharper.co.uk
keithwilliamsfinancial.co.uk keithwilliamsfinancial.co.uk
miwealth.co.uk miwealth.co.uk
regencywealthltd.co.uk regencywealthltd.co.uk
pinnaclewealth.co.uk pinnaclewealth.co.uk
polarisfp.co.uk polarisfp.co.uk
rherbert.co.uk rherbert.co.uk
richardpaddle.com richardpaddle.com
ridley-jones.co.uk ridley-jones.co.uk
robertcompton.co.uk robertcompton.co.uk
sjpp.asia sjpp.asia
andrewspillane.co.uk andrewspillane.co.uk
andrewtodd-sjp.co.uk andrewtodd-sjp.co.uk
speightwealthmanagement.co.uk speightwealthmanagement.co.uk
sterlingsolutionsltd.co.uk sterlingsolutionsltd.co.uk
stowwm.co.uk stowwm.co.uk
swhfp.co.uk swhfp.co.uk
tandhfinancialplanning.co.uk tandhfinancialplanning.co.uk
ayeshakhanfinancialplanning.co.uk ayeshakhanfinancialplanning.co.uk
victoria-lawson.co.uk victoria-lawson.co.uk
williamsandassociatesfa.co.uk williamsandassociatesfa.co.uk
woodruffhill.co.uk woodruffhill.co.uk
cassidyfinancial.co.uk cassidyfinancial.co.uk
crusewealth.com crusewealth.com
darrenford.co.uk darrenford.co.uk
hawthornewealthmanagement.com hawthornewealthmanagement.com
hillcrestwm.co.uk hillcrestwm.co.uk
illingworthseddon.co.uk illingworthseddon.co.uk
jayramfinancialservices.co.uk jayramfinancialservices.co.uk
rjvaughanwealth.co.uk rjvaughanwealth.co.uk
russellpikefinancial.co.uk russellpikefinancial.co.uk
schoolfeessolutions.co.uk schoolfeessolutions.co.uk
simplicityfp.co.uk simplicityfp.co.uk
sjpfoundation.co.uk sjpfoundation.co.uk
apwealth.co.uk apwealth.co.uk
srjwm.co.uk srjwm.co.uk
stefaniepricewealth.co.uk stefaniepricewealth.co.uk
thegroveprivatewealthltd.co.uk thegroveprivatewealthltd.co.uk
davidjwalsh.co.uk davidjwalsh.co.uk
demellowandco.com demellowandco.com
dominicmarcus.co.uk dominicmarcus.co.uk
dsmcdermottfinancialplanning.co.uk dsmcdermottfinancialplanning.co.uk
foremostfinancial.net foremostfinancial.net
gardnerwealthmanagement.co.uk gardnerwealthmanagement.co.uk
glencastlefs.co.uk glencastlefs.co.uk
gqwm.co.uk gqwm.co.uk
guildfordfinancial.co.uk guildfordfinancial.co.uk
hampshirefinancialplanning.co.uk hampshirefinancialplanning.co.uk
jacquinorman.co.uk jacquinorman.co.uk
lizmaudsleyfinancialplanning.co.uk lizmaudsleyfinancialplanning.co.uk
ltcsolutionsltd.co.uk ltcsolutionsltd.co.uk
meridianadvice.co.uk meridianadvice.co.uk
mooreforwealth.co.uk mooreforwealth.co.uk
nbwealthmanagement.co.uk nbwealthmanagement.co.uk
oakridge-partners.co.uk oakridge-partners.co.uk
richardjdavies.co.uk richardjdavies.co.uk
richardmarshall.co.uk richardmarshall.co.uk
perowealthmanagement.co.uk perowealthmanagement.co.uk
placidgonzales.co.uk placidgonzales.co.uk
rppw.sg rppw.sg
allenfinancial.co.uk allenfinancial.co.uk
alfristonwealth.co.uk alfristonwealth.co.uk
apexfinancialservices.co.uk apexfinancialservices.co.uk
carterlane.co.uk carterlane.co.uk
stevensonwealthplanning.co.uk stevensonwealthplanning.co.uk
stuartdavieswealthconsultancy.co.uk stuartdavieswealthconsultancy.co.uk
sunflowerfinancialplanning.co.uk sunflowerfinancialplanning.co.uk
sutherlandmayfairwm.co.uk sutherlandmayfairwm.co.uk
baggermanwm.co.uk baggermanwm.co.uk
whittowwilliamswalkerllp.co.uk whittowwilliamswalkerllp.co.uk
williamsbirley.co.uk williamsbirley.co.uk
capitolfinancial.co.uk capitolfinancial.co.uk
capstone-financial.co.uk capstone-financial.co.uk
coleridgewm.co.uk coleridgewm.co.uk
consiliumwmltd.co.uk consiliumwmltd.co.uk
gdcfinancialadvisers.co.uk gdcfinancialadvisers.co.uk
germainfinancial.co.uk germainfinancial.co.uk
gilsongrayfinancial.co.uk gilsongrayfinancial.co.uk
hearndenandwestonwm.co.uk hearndenandwestonwm.co.uk
hemmensfinancial.co.uk hemmensfinancial.co.uk
hydewealthmanagement.co.uk hydewealthmanagement.co.uk
jamesbarnett.co.uk jamesbarnett.co.uk
jamescurriefinancialsolutions.co.uk jamescurriefinancialsolutions.co.uk
jamestrickett.co.uk jamestrickett.co.uk
lombardprivateclients.co.uk lombardprivateclients.co.uk
maclennanwealth.co.uk maclennanwealth.co.uk
mandyrodgers.co.uk mandyrodgers.co.uk
mayflowerfinancialplanning.co.uk mayflowerfinancialplanning.co.uk
mikestarkeywealthmanagement.co.uk mikestarkeywealthmanagement.co.uk
milesnovotny.co.uk milesnovotny.co.uk
millfieldwm.com millfieldwm.com
modus-wealth.co.uk modus-wealth.co.uk
nigelhelen.co.uk nigelhelen.co.uk
pathwaywealthmanagement.co.uk pathwaywealthmanagement.co.uk
pellegriniandbarlowassociates.co.uk pellegriniandbarlowassociates.co.uk
pineapplefp.co.uk pineapplefp.co.uk
quantumprivateclients.co.uk quantumprivateclients.co.uk
regencywm.co.uk regencywm.co.uk
lwcwealthmanagement.co.uk lwcwealthmanagement.co.uk
middletonfp.co.uk middletonfp.co.uk
mjwsjp.co.uk mjwsjp.co.uk
neavewealth.co.uk neavewealth.co.uk
opawealthmanagement.co.uk opawealthmanagement.co.uk
pricewhitinghodgson.co.uk pricewhitinghodgson.co.uk
richardtidy.co.uk richardtidy.co.uk
bruceandassociates.co.uk bruceandassociates.co.uk
sdhandawealthmanagement.co.uk sdhandawealthmanagement.co.uk
selectinvestors.hk selectinvestors.hk
amwm.co.uk amwm.co.uk
spillaneassociates.co.uk spillaneassociates.co.uk
srmfinancial.co.uk srmfinancial.co.uk
aswwm.co.uk aswwm.co.uk
tempuswealth.co.uk tempuswealth.co.uk
thompsonnorburyfinancialplanning.co.uk thompsonnorburyfinancialplanning.co.uk
tim-watts.co.uk tim-watts.co.uk
timramptonwealthmanagement.com timramptonwealthmanagement.com
tmpwealthmanagement.co.uk tmpwealthmanagement.co.uk
ubuntuwealthmanagement.co.uk ubuntuwealthmanagement.co.uk
beyondwm.co.uk beyondwm.co.uk
unaking.co.uk unaking.co.uk
blakebrooke.co.uk blakebrooke.co.uk
vickykleboe.co.uk vickykleboe.co.uk
brecklandfinancialmanagement.co.uk brecklandfinancialmanagement.co.uk
brewsterfinancialplanning.co.uk brewsterfinancialplanning.co.uk
westwealthmanagement.co.uk westwealthmanagement.co.uk
whitfieldwealth.co.uk whitfieldwealth.co.uk
bsjfinancialplanning.co.uk bsjfinancialplanning.co.uk
calderwealthmanagement.co.uk calderwealthmanagement.co.uk
charlottepoolegraham.co.uk charlottepoolegraham.co.uk
clearwaterwm.co.uk clearwaterwm.co.uk
drpwm.com drpwm.com
drsaqibkarim.co.uk drsaqibkarim.co.uk
duncanmaw.co.uk duncanmaw.co.uk
farisnori.co.uk farisnori.co.uk
frizzellwm.co.uk frizzellwm.co.uk
gpfp.co.uk gpfp.co.uk
kaplan-planwell.co.uk kaplan-planwell.co.uk
krc-wealth-management.co.uk krc-wealth-management.co.uk
marklowewm.co.uk marklowewm.co.uk
martastonesfm.co.uk martastonesfm.co.uk
mjonesandco.co.uk mjonesandco.co.uk
msestatesandfinancialservices.co.uk msestatesandfinancialservices.co.uk
ninewealth.co.uk ninewealth.co.uk
oakridgewealth.co.uk oakridgewealth.co.uk
rnpwealth.co.uk rnpwealth.co.uk
bowbrookfp.co.uk bowbrookfp.co.uk
adeptiowm.co.uk adeptiowm.co.uk
adamjameswm.co.uk adamjameswm.co.uk
allardwhiteley.co.uk allardwhiteley.co.uk
allensykeswm.com allensykeswm.com
mimigom.co.uk mimigom.co.uk
sjp-partner-nginx-prd-asia.uk.deptagency.com sjp-partner-nginx-prd-asia.uk.deptagency.com
anthonyanderson.co.uk anthonyanderson.co.uk
sophiederouet.co.uk sophiederouet.co.uk
andrewhugheswm.co.uk andrewhugheswm.co.uk
stringermann.com stringermann.com
suffolkfp.co.uk suffolkfp.co.uk
tedreesltd.co.uk tedreesltd.co.uk
avocetwealth.co.uk avocetwealth.co.uk
avonwoodfinancialplanning.co.uk avonwoodfinancialplanning.co.uk
tywm.co.uk tywm.co.uk
wandco-fp.co.uk wandco-fp.co.uk
btmwealth.co.uk btmwealth.co.uk
willgrasscornishwealthmanagement.co.uk willgrasscornishwealthmanagement.co.uk
willgrasswealthmanagement.co.uk willgrasswealthmanagement.co.uk
carringtonbond.co.uk carringtonbond.co.uk
zenithfinancial.co.uk zenithfinancial.co.uk
cooperassociateswm.com cooperassociateswm.com
danielgreenwm.co.uk danielgreenwm.co.uk
davidjohnsonfp.co.uk davidjohnsonfp.co.uk
denmanwealthmanagement.co.uk denmanwealthmanagement.co.uk
eatonwealthmanagement.co.uk eatonwealthmanagement.co.uk
ellisonwealth.co.uk ellisonwealth.co.uk
integralwm.co.uk integralwm.co.uk
ivanhoefp.co.uk ivanhoefp.co.uk
jamesbournewm.com jamesbournewm.com
acwwealthmanagement.co.uk acwwealthmanagement.co.uk
sandgatewealth.co.uk sandgatewealth.co.uk
advisorycube.co.uk advisorycube.co.uk
shearwoodfinancialmanagement.co.uk shearwoodfinancialmanagement.co.uk
sjp-partner-nginx-prd.uk.deptagency.com sjp-partner-nginx-prd.uk.deptagency.com
antlerwealth.com antlerwealth.com
stephenhopewealthmanagement.com stephenhopewealthmanagement.com
strategicwealthsolutions.co.uk strategicwealthsolutions.co.uk
avonwoodfinancialplanning.com avonwoodfinancialplanning.com
awwealth.co.uk awwealth.co.uk
thinkfinancialwealthmanagement.co.uk thinkfinancialwealthmanagement.co.uk
tomricketts.co.uk tomricketts.co.uk
waymarkerfinancial.co.uk waymarkerfinancial.co.uk
bridgegatewm.co.uk bridgegatewm.co.uk
westwellwm.co.uk westwellwm.co.uk
whitepeakwm.uk whitepeakwm.uk
calderwoodswm.co.uk calderwoodswm.co.uk
catherinerichardson.co.uk catherinerichardson.co.uk
cgafinancial.co.uk cgafinancial.co.uk
chartsmorewealthltd.co.uk chartsmorewealthltd.co.uk
cheshirelifestyle.com cheshirelifestyle.com
clachanviewwm.co.uk clachanviewwm.co.uk
claremont-financial.co.uk claremont-financial.co.uk
cogentfinancial.co.uk cogentfinancial.co.uk
cowgillwealthmanagement.co.uk cowgillwealthmanagement.co.uk
cpfc.org.uk cpfc.org.uk
crossleythompson.co.uk crossleythompson.co.uk
dalemurtenwealthmanagement.co.uk dalemurtenwealthmanagement.co.uk
edwardsandpringle.co.uk edwardsandpringle.co.uk
majoroakwm.co.uk majoroakwm.co.uk
hsprivatewealth.co.uk hsprivatewealth.co.uk
innoviawm.co.uk innoviawm.co.uk
isaacwealth.co.uk isaacwealth.co.uk
jacksonfinancial.co.uk jacksonfinancial.co.uk
jasonbellissimo.co.uk jasonbellissimo.co.uk
joejoblingwealthmanagement.co.uk joejoblingwealthmanagement.co.uk
johngoldiewm.co.uk johngoldiewm.co.uk
johnpeoples.co.uk johnpeoples.co.uk
libertywm.co.uk libertywm.co.uk
lionbridgewealth.co.uk lionbridgewealth.co.uk
markbeverley.co.uk markbeverley.co.uk
mendipwm.co.uk mendipwm.co.uk
oakwaywm.co.uk oakwaywm.co.uk
rabeyaislam.co.uk rabeyaislam.co.uk
richardjhewlett.co.uk richardjhewlett.co.uk
acjordanwealthmanagement.co.uk acjordanwealthmanagement.co.uk
sharpwm.co.uk sharpwm.co.uk
steggleswm.co.uk steggleswm.co.uk
stricklandwealthmanagement.co.uk stricklandwealthmanagement.co.uk
avonwoodfinancial.com avonwoodfinancial.com
tilikumwealth.co.uk tilikumwealth.co.uk
towerhousewm.co.uk towerhousewm.co.uk
trbeardwealth.co.uk trbeardwealth.co.uk
wadewealthmanagement.co.uk wadewealthmanagement.co.uk
waltierwealthmanagement.co.uk waltierwealthmanagement.co.uk
boundstonewm.co.uk boundstonewm.co.uk
whcfp.co.uk whcfp.co.uk
brightsidewealthmanagement.co.uk brightsidewealthmanagement.co.uk
chrishillsfc.co.uk chrishillsfc.co.uk
cotterell-wilkie.co.uk cotterell-wilkie.co.uk
crownwealth.co.uk crownwealth.co.uk
cuthbertsonwealthmanagement.com cuthbertsonwealthmanagement.com
davidwilkinsonsjp.co.uk davidwilkinsonsjp.co.uk
debenprivatewealth.co.uk debenprivatewealth.co.uk
denmanfp.com denmanfp.com
hexafinancialplanning.co.uk hexafinancialplanning.co.uk
jonathanstorrwm.co.uk jonathanstorrwm.co.uk
kbruce.co.uk kbruce.co.uk
markproberts.co.uk markproberts.co.uk
mphwealthmanagement.co.uk mphwealthmanagement.co.uk
ovieo.co.uk ovieo.co.uk
partnership.sjp.asia partnership.sjp.asia
partnership.sjp.co.uk partnership.sjp.co.uk
qafp.co.uk qafp.co.uk
ksfinancialadvisers.co.uk ksfinancialadvisers.co.uk
kwmfp.co.uk kwmfp.co.uk
lansdownplace.co.uk lansdownplace.co.uk
lauriefp.co.uk lauriefp.co.uk
legatumwealthmanagement.co.uk legatumwealthmanagement.co.uk
lewingtonwealth.co.uk lewingtonwealth.co.uk
linkswealthmanagement.co.uk linkswealthmanagement.co.uk
malcolmgibsonwealthmanagement.co.uk malcolmgibsonwealthmanagement.co.uk
lochranzawealth.co.uk lochranzawealth.co.uk
loswealth.co.uk loswealth.co.uk
mackiewealthmanagement.co.uk mackiewealthmanagement.co.uk
macphail-kennedy.co.uk macphail-kennedy.co.uk
malikzadafp.co.uk malikzadafp.co.uk
markedwardswm.co.uk markedwardswm.co.uk
markgolesworthy.co.uk markgolesworthy.co.uk
mbfinancial-planning.co.uk mbfinancial-planning.co.uk
mcgrathwm.co.uk mcgrathwm.co.uk
mdslackwealthmanagement.co.uk mdslackwealthmanagement.co.uk
michaeldaywm.co.uk michaeldaywm.co.uk
milnewealth.co.uk milnewealth.co.uk
mkkwealthmanagement.co.uk mkkwealthmanagement.co.uk
rajrayarel.com rajrayarel.com
monteaglewm.co.uk monteaglewm.co.uk
morgancfp.co.uk morgancfp.co.uk
mrfinancial.info mrfinancial.info
mulberrytreewealth.co.uk mulberrytreewealth.co.uk
municipalfp.co.uk municipalfp.co.uk
nbwealth.co.uk nbwealth.co.uk
neilmitchellfm.com neilmitchellfm.com
neilmorrisfinancial.co.uk neilmorrisfinancial.co.uk
centurywealthmanagement.co.uk centurywealthmanagement.co.uk
nickcarterwm.co.uk nickcarterwm.co.uk
nicolamanfrediwm.co.uk nicolamanfrediwm.co.uk
njholmeswealth.co.uk njholmeswealth.co.uk
maplewoodwealth.co.uk maplewoodwealth.co.uk
northwealthmanagement.co.uk northwealthmanagement.co.uk
npswealth.co.uk npswealth.co.uk
marcnorris.co.uk marcnorris.co.uk
oaktreefinancial.asia oaktreefinancial.asia
ockendenfp.co.uk ockendenfp.co.uk
ofarrellwealth.co.uk ofarrellwealth.co.uk
oliverwm.co.uk oliverwm.co.uk
markeldor.co.uk markeldor.co.uk
orchardfinancialassociates.co.uk orchardfinancialassociates.co.uk
orestonewealth.co.uk orestonewealth.co.uk
paulmwilliams.co.uk paulmwilliams.co.uk
peakfifteenfp.co.uk peakfifteenfp.co.uk
peakpf.co.uk peakpf.co.uk
pennygatefinancialassociates.co.uk pennygatefinancialassociates.co.uk
philippotterwealth.co.uk philippotterwealth.co.uk
markpattersonfp.co.uk markpattersonfp.co.uk
ptpwealthmanagement.co.uk ptpwealthmanagement.co.uk
quartzfinancialplanning.co.uk quartzfinancialplanning.co.uk
quaylifewm.co.uk quaylifewm.co.uk
reignwm.co.uk reignwm.co.uk
rhodianwm.co.uk rhodianwm.co.uk
richardpearsonwealth.co.uk richardpearsonwealth.co.uk
rickardsfinancialplanning.com rickardsfinancialplanning.com
abacuswealthservices.co.uk abacuswealthservices.co.uk
robinsonfp.co.uk robinsonfp.co.uk
rodgersfamilywealth.co.uk rodgersfamilywealth.co.uk
abfinancialplanning.co.uk abfinancialplanning.co.uk
rossingtonwm.co.uk rossingtonwm.co.uk
bwfinancialplanning.co.uk bwfinancialplanning.co.uk
rubywealth.co.uk rubywealth.co.uk
bullferguson.co.uk bullferguson.co.uk
adnfp.co.uk adnfp.co.uk
agilepensions.uk agilepensions.uk
schofieldassociatesfp.co.uk schofieldassociatesfp.co.uk
ahwm.co.uk ahwm.co.uk
searlesfinancial.co.uk searlesfinancial.co.uk
selectinvestors.asia selectinvestors.asia
alumni.sjp.co.uk alumni.sjp.co.uk
machanwealthmanagement.co.uk machanwealthmanagement.co.uk
simonlunnwm.co.uk simonlunnwm.co.uk
skeltons.co.uk skeltons.co.uk
sjp-partner-nginx-stg.uk.deptagency.com sjp-partner-nginx-stg.uk.deptagency.com
sjp-partner-nginx-uat.uk.deptagency.com sjp-partner-nginx-uat.uk.deptagency.com
antaris.asia antaris.asia
capriwealth.co.uk capriwealth.co.uk
angelamillarwm.co.uk angelamillarwm.co.uk
smithsonwm.co.uk smithsonwm.co.uk
smjwealth.co.uk smjwealth.co.uk
annikagwm.co.uk annikagwm.co.uk
solastawm.co.uk solastawm.co.uk
somersetwealthmanagement.co.uk somersetwealthmanagement.co.uk
solebayfp.co.uk solebayfp.co.uk
andrewdaldrywm.co.uk andrewdaldrywm.co.uk
andrewpaynewm.co.uk andrewpaynewm.co.uk
andrewvarleyfinancialplanning.co.uk andrewvarleyfinancialplanning.co.uk
spirewealth.co.uk spirewealth.co.uk
springwealth.co.uk springwealth.co.uk
stanfordwealth.co.uk stanfordwealth.co.uk
stathamwm.co.uk stathamwm.co.uk
steeleaspire.co.uk steeleaspire.co.uk
steelewealthmanagement.co.uk steelewealthmanagement.co.uk
stephenkingwealthmanagement.co.uk stephenkingwealthmanagement.co.uk
stevejamespfp.co.uk stevejamespfp.co.uk
stevenjerath.co.uk stevenjerath.co.uk
stoneacrefp.co.uk stoneacrefp.co.uk
swanwealthmanagement.co.uk swanwealthmanagement.co.uk
careyandcofinancialsolutions.co.uk careyandcofinancialsolutions.co.uk
swindonfinancialadvisers.uk swindonfinancialadvisers.uk
swindonfinancialservices.co.uk swindonfinancialservices.co.uk
swindonfinancialservices.uk swindonfinancialservices.uk
tarporleywealth.co.uk tarporleywealth.co.uk
aureliaprivatewealth.co.uk aureliaprivatewealth.co.uk
templemewsfp.co.uk templemewsfp.co.uk
terryhartley.co.uk terryhartley.co.uk
averywealthmanagement.co.uk averywealthmanagement.co.uk
tfsni.com tfsni.com
awfwm.co.uk awfwm.co.uk
bainfa.co.uk bainfa.co.uk
thwm.co.uk thwm.co.uk
tmcfc.co.uk tmcfc.co.uk
beaconfp.co.uk beaconfp.co.uk
towcester-fp.co.uk towcester-fp.co.uk
trinityfp.co.uk trinityfp.co.uk
benhiles.co.uk benhiles.co.uk
truitywealth.co.uk truitywealth.co.uk
tsfinancialplanning.co.uk tsfinancialplanning.co.uk
bessellfp.co.uk bessellfp.co.uk
beverleyfinancialmanagement.co.uk beverleyfinancialmanagement.co.uk
bhwml.com bhwml.com
vfcwealthmanagement.co.uk vfcwealthmanagement.co.uk
vinewealth.co.uk vinewealth.co.uk
blythswood.com blythswood.com
wangwm.co.uk wangwm.co.uk
bradnickwealth.co.uk bradnickwealth.co.uk
bredonhillwm.co.uk bredonhillwm.co.uk
whistonwealth.com whistonwealth.com
willcoxwealthmanagement.co.uk willcoxwealthmanagement.co.uk
rafflesplaceprivatewealth.com rafflesplaceprivatewealth.com
wylliewealth.co.uk wylliewealth.co.uk
calderwoodfinancial.co.uk calderwoodfinancial.co.uk
cfwealth.asia cfwealth.asia
zohulmalikzada.co.uk zohulmalikzada.co.uk
cheshirewealthconsultancy.co.uk cheshirewealthconsultancy.co.uk
clareclarkson.co.uk clareclarkson.co.uk
clarityfinancialplanningsjp.co.uk clarityfinancialplanningsjp.co.uk
clhwm.co.uk clhwm.co.uk
colewealthmanagement.co.uk colewealthmanagement.co.uk
concordiafp.co.uk concordiafp.co.uk
corcilliumwm.co.uk corcilliumwm.co.uk
cormackwealth.co.uk cormackwealth.co.uk
danrmayo.com danrmayo.com
darcyfp.co.uk darcyfp.co.uk
davidagg.co.uk davidagg.co.uk
dfwealthmanagement.co.uk dfwealthmanagement.co.uk
dlwm.co.uk dlwm.co.uk
dowdallwealthmanagement.co.uk dowdallwealthmanagement.co.uk
dwightmorreywm.co.uk dwightmorreywm.co.uk
eastgatewealthmanagementltd.co.uk eastgatewealthmanagementltd.co.uk
eastpointwm.co.uk eastpointwm.co.uk
edgintonstanley.co.uk edgintonstanley.co.uk
edmondsfinancialplanning.co.uk edmondsfinancialplanning.co.uk
elaineford.co.uk elaineford.co.uk
elainemilne.co.uk elainemilne.co.uk
eltonfinancialconsultants.co.uk eltonfinancialconsultants.co.uk
emmadandy.co.uk emmadandy.co.uk
ennveefinancial.co.uk ennveefinancial.co.uk
eonegreen.com eonegreen.com
ericahaywealth.co.uk ericahaywealth.co.uk
evermore.financial evermore.financial
excavationexcavate.com excavationexcavate.com
fgjfinancialservices.co.uk fgjfinancialservices.co.uk
fifteenfinancialplanning.co.uk fifteenfinancialplanning.co.uk
firmstonewealth.co.uk firmstonewealth.co.uk
foresightfs.co.uk foresightfs.co.uk
forte-financial.co.uk forte-financial.co.uk
fortisfinancial.co.uk fortisfinancial.co.uk
fortresswealthpartnership.com fortresswealthpartnership.com
fortveritaswealth.co.uk fortveritaswealth.co.uk
fossewayfs.co.uk fossewayfs.co.uk
freddieansah.co.uk freddieansah.co.uk
freearwm.co.uk freearwm.co.uk
futureperfectwealthmanagement.co.uk futureperfectwealthmanagement.co.uk
georgeshippam.co.uk georgeshippam.co.uk
gewealthmanagement.co.uk gewealthmanagement.co.uk
gibsonfinancialmanagement.co.uk gibsonfinancialmanagement.co.uk
gkbfinancialplanning.co.uk gkbfinancialplanning.co.uk
goldenacornfp.co.uk goldenacornfp.co.uk
grahamlavinwealthmanagement.co.uk grahamlavinwealthmanagement.co.uk
graysonlewis.co.uk graysonlewis.co.uk
grazianolongo.co.uk grazianolongo.co.uk
greenfortpw.com greenfortpw.com
gritstone-fp.co.uk gritstone-fp.co.uk
hallamwealth.co.uk hallamwealth.co.uk
hannonfinancialplanning.co.uk hannonfinancialplanning.co.uk
hayatfp.co.uk hayatfp.co.uk
haydnlewis.co.uk haydnlewis.co.uk
hayekwm.com hayekwm.com
heideswiftfinancialplanning.co.uk heideswiftfinancialplanning.co.uk
hendredfinancialpartners.co.uk hendredfinancialpartners.co.uk
heyesassociates.co.uk heyesassociates.co.uk
hipstagram.com hipstagram.com
hoadley-financial.co.uk hoadley-financial.co.uk
holmesfinancialplanning.co.uk holmesfinancialplanning.co.uk
hudsonandrogersfinancial.co.uk hudsonandrogersfinancial.co.uk
hudsonwealthmanagement.co.uk hudsonwealthmanagement.co.uk
hummingbirdprivateclients.co.uk hummingbirdprivateclients.co.uk
ipswichfs.co.uk ipswichfs.co.uk
isabellastepkowska-fellows.co.uk isabellastepkowska-fellows.co.uk
ithacafinancial.co.uk ithacafinancial.co.uk
jameshendersonwm.co.uk jameshendersonwm.co.uk
jameshunwickewealthmanagement.co.uk jameshunwickewealthmanagement.co.uk
jcrwealth.co.uk jcrwealth.co.uk
jensenwealth.co.uk jensenwealth.co.uk
jgriverwealth.co.uk jgriverwealth.co.uk
jhwm.co.uk jhwm.co.uk
jillyoungwealthmanagement.co.uk jillyoungwealthmanagement.co.uk
joebointon.co.uk joebointon.co.uk
jonathannugentwm.co.uk jonathannugentwm.co.uk
jonesregan.co.uk jonesregan.co.uk
jopowis.co.uk jopowis.co.uk
jtwealthmanagementltd.co.uk jtwealthmanagementltd.co.uk
julianhoweswealthmanagement.co.uk julianhoweswealthmanagement.co.uk
justicewealth.co.uk justicewealth.co.uk
karlbadrick.co.uk karlbadrick.co.uk
kathrynshearsfinancialplanning.co.uk kathrynshearsfinancialplanning.co.uk
kempbarnesfp.co.uk kempbarnesfp.co.uk
kfhwm.co.uk kfhwm.co.uk
kieranfowley.co.uk kieranfowley.co.uk
kinlifetimeplanning.co.uk kinlifetimeplanning.co.uk
kirstywilsonwm.co.uk kirstywilsonwm.co.uk
klcwealth.co.uk klcwealth.co.uk
mentmorefp.co.uk mentmorefp.co.uk
michellegermain.co.uk michellegermain.co.uk
monriewm.co.uk monriewm.co.uk
josephineblythe.co.uk josephineblythe.co.uk
jwfinancialadvice.co.uk jwfinancialadvice.co.uk
jwoodward-sjp.co.uk jwoodward-sjp.co.uk
kainewm.co.uk kainewm.co.uk
kdswealth.co.uk kdswealth.co.uk
keyhavenwealth.co.uk keyhavenwealth.co.uk
keyplanwealth.co.uk keyplanwealth.co.uk
keysolutionswm.co.uk keysolutionswm.co.uk
klara-wealth.co.uk klara-wealth.co.uk
kmwm.co.uk kmwm.co.uk
kneefinancialplanning.co.uk kneefinancialplanning.co.uk
knightturnerprivateclients.co.uk knightturnerprivateclients.co.uk
knightwealthmanagement.co.uk knightwealthmanagement.co.uk
lafirmasantana.com lafirmasantana.com
lawcapitalwealth.co.uk lawcapitalwealth.co.uk
lclaytonfm.co.uk lclaytonfm.co.uk
leonnasalmon.co.uk leonnasalmon.co.uk
lisacalvertfw.com lisacalvertfw.com
litterickwm.co.uk litterickwm.co.uk
lokmanwm.co.uk lokmanwm.co.uk
louisemoorewealthmanagement.co.uk louisemoorewealthmanagement.co.uk
lpfinancial.co.uk lpfinancial.co.uk
lucernawealth.com lucernawealth.com
lundwm.co.uk lundwm.co.uk
lwmwealth.co.uk lwmwealth.co.uk
maggieralph.co.uk maggieralph.co.uk
malcolmodonovan.co.uk malcolmodonovan.co.uk
mansionhousefinancialplanning.co.uk mansionhousefinancialplanning.co.uk
marginsfinancialsolutions.co.uk marginsfinancialsolutions.co.uk
markbowenwm.co.uk markbowenwm.co.uk
markhollandwm.co.uk markhollandwm.co.uk
markwheatleywealth.co.uk markwheatleywealth.co.uk
mcgintywealthmanagement.co.uk mcgintywealthmanagement.co.uk
melvillewm.co.uk melvillewm.co.uk
michaelkylewm.co.uk michaelkylewm.co.uk
midlandswealthmanagement.co.uk midlandswealthmanagement.co.uk
minsterfinancialplanning.co.uk minsterfinancialplanning.co.uk
miwealthmanagement.co.uk miwealthmanagement.co.uk
mjashleywm.co.uk mjashleywm.co.uk
mjcwealthmanagement.co.uk mjcwealthmanagement.co.uk
moorefinancialwellbeing.co.uk moorefinancialwellbeing.co.uk
morriswm.co.uk morriswm.co.uk
murfittwealth.co.uk murfittwealth.co.uk
myleschurchill.com myleschurchill.com
nandsfp.co.uk nandsfp.co.uk
ncfa.uk ncfa.uk
neilmccann.co.uk neilmccann.co.uk
neptunefinancialmanagement.co.uk neptunefinancialmanagement.co.uk
niamwealth.co.uk niamwealth.co.uk
nigelgreenwm.com nigelgreenwm.com
nighatali.co.uk nighatali.co.uk
nightingalewealth.co.uk nightingalewealth.co.uk
noblewealth.co.uk noblewealth.co.uk
marathonwm.co.uk marathonwm.co.uk
oakwood-capital.co.uk oakwood-capital.co.uk
oconnorwm.co.uk oconnorwm.co.uk
onewealthltd.co.uk onewealthltd.co.uk
markcosgrave.co.uk markcosgrave.co.uk
orangetreefs.co.uk orangetreefs.co.uk
osbornewm.co.uk osbornewm.co.uk
paulbryantonwm.co.uk paulbryantonwm.co.uk
paulmageewealthmanagement.co.uk paulmageewealthmanagement.co.uk
powerfinancialmanagement.co.uk powerfinancialmanagement.co.uk
primaryfinancialplanning.co.uk primaryfinancialplanning.co.uk
priteshpankhania.com priteshpankhania.com
marlowwealth.co.uk marlowwealth.co.uk
richardbroughtonwealthmanagement.co.uk richardbroughtonwealthmanagement.co.uk
richardburchnall.co.uk richardburchnall.co.uk
charterededgefp.co.uk charterededgefp.co.uk
robertbutler-sjp.com robertbutler-sjp.com
rossonwyewm.co.uk rossonwyewm.co.uk
roxburghonline.co.uk roxburghonline.co.uk
rsfinancial.co.uk rsfinancial.co.uk
rpwealthmanagement.co.uk rpwealthmanagement.co.uk
rsmwm.co.uk rsmwm.co.uk
russellgreer.co.uk russellgreer.co.uk
bradbyswm.co.uk bradbyswm.co.uk
ryanmcguinnesswm.co.uk ryanmcguinnesswm.co.uk
accelerator.sjp-cloud.info accelerator.sjp-cloud.info
saltandlightfs.co.uk saltandlightfs.co.uk
sapphirefp.co.uk sapphirefp.co.uk
sarahmcgurkwealthmanagement.co.uk sarahmcgurkwealthmanagement.co.uk
scholeswm.co.uk scholeswm.co.uk
arkioswealth.co.uk arkioswealth.co.uk
searlewm.co.uk searlewm.co.uk
seekerfinancial.co.uk seekerfinancial.co.uk
shanehukewm.co.uk shanehukewm.co.uk
shandandburnsfinancial.co.uk shandandburnsfinancial.co.uk
sherpawealth.uk sherpawealth.uk
allensalterwm.co.uk allensalterwm.co.uk
albionhousewm.co.uk albionhousewm.co.uk
siddonsand.co siddonsand.co
sigmafp.co.uk sigmafp.co.uk
silverlinewealth.co.uk silverlinewealth.co.uk
sjp-cloud.info sjp-cloud.info
sjpinsights.co.uk sjpinsights.co.uk
sjwalkerwm.co.uk sjwalkerwm.co.uk
skylarkwealth.co.uk skylarkwealth.co.uk
andrewgrayafp.co.uk andrewgrayafp.co.uk
southgatewm.co.uk southgatewm.co.uk
spco.co.uk spco.co.uk
spillane.viewcreative.agency spillane.viewcreative.agency
srgwealthmanagement.co.uk srgwealthmanagement.co.uk
arvanwealth.co.uk arvanwealth.co.uk
steadfastwm.co.uk steadfastwm.co.uk
stoneswealth.co.uk stoneswealth.co.uk
stpetersfinancialplanning.co.uk stpetersfinancialplanning.co.uk
adamlordwm.co.uk adamlordwm.co.uk
summitfinancial.asia summitfinancial.asia
agilelife.uk agilelife.uk
asmwealth.com asmwealth.com
availfinancialplanning.co.uk availfinancialplanning.co.uk
thamesvalleyfinancialplanning.co.uk thamesvalleyfinancialplanning.co.uk
thelockyerpartnership.co.uk thelockyerpartnership.co.uk
tjpwealthmanagement.co.uk tjpwealthmanagement.co.uk
tomworley.co.uk tomworley.co.uk
torweybridge.co.uk torweybridge.co.uk
beaconswealth.co.uk beaconswealth.co.uk
tridentwm.co.uk tridentwm.co.uk
truenorthfp.co.uk truenorthfp.co.uk
twmfinancialplanning.co.uk twmfinancialplanning.co.uk
valkyriefinancialadvice.co.uk valkyriefinancialadvice.co.uk
vantagewm.co.uk vantagewm.co.uk
vaughanwealth.co.uk vaughanwealth.co.uk
vinetreefinancialservices.co.uk vinetreefinancialservices.co.uk
virtusfp.co.uk virtusfp.co.uk
vividfp.co.uk vividfp.co.uk
blueoceanwm.co.uk blueoceanwm.co.uk
walmsleyfinancialplanning.co.uk walmsleyfinancialplanning.co.uk
whfinancialwellbeing.co.uk whfinancialwellbeing.co.uk
whitehousecapital.co.uk whitehousecapital.co.uk
wholewealth.com wholewealth.com
whrwealthmanagement.co.uk whrwealthmanagement.co.uk
brwm.org.uk brwm.org.uk
woodmitchellfp.com woodmitchellfp.com
calderdaviswealthmanagement.co.uk calderdaviswealthmanagement.co.uk
cambridgefinancialadvisers.co.uk cambridgefinancialadvisers.co.uk
carefeeadvice.co.uk carefeeadvice.co.uk
carrfinancialplanning.co.uk carrfinancialplanning.co.uk
charlesjoneswealthmanagement.co.uk charlesjoneswealthmanagement.co.uk
chwwealth.co.uk chwwealth.co.uk
clarkwm.co.uk clarkwm.co.uk
claytonprofessionalwealth.co.uk claytonprofessionalwealth.co.uk
covewealth.co.uk covewealth.co.uk
cphanburywealthmanagement.co.uk cphanburywealthmanagement.co.uk
ctwealthmanagement.co.uk ctwealthmanagement.co.uk
danmorganfinancialassociates.co.uk danmorganfinancialassociates.co.uk
darienwilliams.co.uk darienwilliams.co.uk
darrenknibbwealthmanagement.co.uk darrenknibbwealthmanagement.co.uk
davesouthbyfp.co.uk davesouthbyfp.co.uk
davidbilantzwm.co.uk davidbilantzwm.co.uk
davidsonfinancialplanning.co.uk davidsonfinancialplanning.co.uk
dhfinancial.co.uk dhfinancial.co.uk
dianacooper.co.uk dianacooper.co.uk
doweswealth.co.uk doweswealth.co.uk
doyleleighfs.co.uk doyleleighfs.co.uk
dragonwealth.co.uk dragonwealth.co.uk
dynamicws.co.uk dynamicws.co.uk
earleywm.co.uk earleywm.co.uk
edwardswealth.co.uk edwardswealth.co.uk
edwardtrehearne.co.uk edwardtrehearne.co.uk
ejstapleywm.co.uk ejstapleywm.co.uk
ellorawealth.co.uk ellorawealth.co.uk
emeraldassociates.co.uk emeraldassociates.co.uk
emmarallswealthmanagement.co.uk emmarallswealthmanagement.co.uk
evolvefinancialplanning.co.uk evolvefinancialplanning.co.uk
ewartandbridgemanadvisers.co.uk ewartandbridgemanadvisers.co.uk
ewenharris.co.uk ewenharris.co.uk
excaliburwm.co.uk excaliburwm.co.uk
familytreewealthmanagement.co.uk familytreewealthmanagement.co.uk
farrierrose.co.uk farrierrose.co.uk
fayarrundale.co.uk fayarrundale.co.uk
fearndalewealth.co.uk fearndalewealth.co.uk
fehufp.co.uk fehufp.co.uk
fernbankwealth.co.uk fernbankwealth.co.uk
financialmerrett.co.uk financialmerrett.co.uk
finessefinancialplanning.co.uk finessefinancialplanning.co.uk
fisherfm.co.uk fisherfm.co.uk
formanwealthmanagement.co.uk formanwealthmanagement.co.uk
formfinancialclarity.co.uk formfinancialclarity.co.uk
macaulaywm.co.uk macaulaywm.co.uk
francefinancial.co.uk francefinancial.co.uk
frontierwealth.co.uk frontierwealth.co.uk
ftalk.co.uk ftalk.co.uk
futurumfa.co.uk futurumfa.co.uk
gallacherwealth.co.uk gallacherwealth.co.uk
gapstowwealth.co.uk gapstowwealth.co.uk
gardnerwealthmanagement.com gardnerwealthmanagement.com
ghfinancialsolutions.co.uk ghfinancialsolutions.co.uk
gillespiefinancialconsultancy.com gillespiefinancialconsultancy.com
glamorganwm.co.uk glamorganwm.co.uk
greatoakfp.co.uk greatoakfp.co.uk
greenparkwm.com greenparkwm.com
greenswardfp.co.uk greenswardfp.co.uk
gregorhowitt.co.uk gregorhowitt.co.uk
hamiltonpullenfp.co.uk hamiltonpullenfp.co.uk
hightowerwealthmanagementltd.co.uk hightowerwealthmanagementltd.co.uk
hillsidefinancialplanning.co.uk hillsidefinancialplanning.co.uk
hjpcfp.com hjpcfp.com
hodgewealthmanagement.co.uk hodgewealthmanagement.co.uk
horshamfinancial.co.uk horshamfinancial.co.uk
hudsonwm.co.uk hudsonwm.co.uk
huntminasfinancial.co.uk huntminasfinancial.co.uk
iaincampbellwm.co.uk iaincampbellwm.co.uk
iwplanning.com iwplanning.com
janetgee.co.uk janetgee.co.uk
jckfinancialeducation.co.uk jckfinancialeducation.co.uk
jenkinsfinancialpartnership.co.uk jenkinsfinancialpartnership.co.uk
jgriver.co jgriver.co
jjfm.co.uk jjfm.co.uk
jmbwealth.co.uk jmbwealth.co.uk
jmkwealthmanagement.co.uk jmkwealthmanagement.co.uk
cordnerwealthmanagement.co.uk cordnerwealthmanagement.co.uk
middletonwealth.co.uk middletonwealth.co.uk
gnkwealthmanagement.co.uk gnkwealthmanagement.co.uk
raynhamhendersonwm.co.uk raynhamhendersonwm.co.uk
rebeccabailey.co.uk rebeccabailey.co.uk
reflectfp.co.uk reflectfp.co.uk
repositorywealth.co.uk repositorywealth.co.uk
brownandcofp.co.uk brownandcofp.co.uk
rmcfp.co.uk rmcfp.co.uk
aresfinancialplanning.co.uk aresfinancialplanning.co.uk
robingram.co.uk robingram.co.uk
rowlandwealthmanagement.co.uk rowlandwealthmanagement.co.uk
rwmfinance.co.uk rwmfinance.co.uk
bywaterwealth.co.uk bywaterwealth.co.uk
hauxwellwealthmanagement.co.uk hauxwellwealthmanagement.co.uk
sagewm.co.uk sagewm.co.uk
saxtonfp.co.uk saxtonfp.co.uk
scottjameswealthmanagement.co.uk scottjameswealthmanagement.co.uk
scrimgerandoakes.co.uk scrimgerandoakes.co.uk
sebastienzamora.co.uk sebastienzamora.co.uk
seven-wealth.co.uk seven-wealth.co.uk
allardwealth.co.uk allardwealth.co.uk
shawfieldwealthmanagement.co.uk shawfieldwealthmanagement.co.uk
silveroakfs.co.uk silveroakfs.co.uk
skentelberyfinancial.co.uk skentelberyfinancial.co.uk
sjmfinancial.co.uk sjmfinancial.co.uk
sjp.asia sjp.asia
sjpinsights.asia sjpinsights.asia
skwealthsolutions.co.uk skwealthsolutions.co.uk
autuswealth.co.uk autuswealth.co.uk
antlerwealth.asia antlerwealth.asia
andersonbellfinancial.co.uk andersonbellfinancial.co.uk
sovereign-marketharborough.co.uk sovereign-marketharborough.co.uk
srmfs.co.uk srmfs.co.uk
appartnerswealth.co.uk appartnerswealth.co.uk
stagwealthmanagement.co.uk stagwealthmanagement.co.uk
stanfieldfp.co.uk stanfieldfp.co.uk
stellenboschfp.co.uk stellenboschfp.co.uk
stephenboylewealthmanagement.co.uk stephenboylewealthmanagement.co.uk
stephenhydewealthmanagement.co.uk stephenhydewealthmanagement.co.uk
sterlingadvice.co.uk sterlingadvice.co.uk
strakerfp.co.uk strakerfp.co.uk
aspirelane.co.uk aspirelane.co.uk
stuartthom.co.uk stuartthom.co.uk
sullivanandcofp.co.uk sullivanandcofp.co.uk
swannfinancial.com swannfinancial.com
swtwealth.co.uk swtwealth.co.uk
swindonfinancialadvisers.co.uk swindonfinancialadvisers.co.uk
angieaddisonfinancial.co.uk angieaddisonfinancial.co.uk
athelisfinancial.co.uk athelisfinancial.co.uk
aureliaprivatewealth.com aureliaprivatewealth.com
aurorafinancialservices.co.uk aurorafinancialservices.co.uk
avonwoodfinancialplanning.uk avonwoodfinancialplanning.uk
thameswealth.co.uk thameswealth.co.uk
axtruwealth.co.uk axtruwealth.co.uk
bardenwealthmanagement.co.uk bardenwealthmanagement.co.uk
baxterfinancial.co.uk baxterfinancial.co.uk
baybluewealth.co.uk baybluewealth.co.uk
beaglefinancialadvice.co.uk beaglefinancialadvice.co.uk
trueselfwealth.co.uk trueselfwealth.co.uk
berryfinancial.co.uk berryfinancial.co.uk
turnerwm.co.uk turnerwm.co.uk
birchwealthmanagement.co.uk birchwealthmanagement.co.uk
vanderweelewm.co.uk vanderweelewm.co.uk
vffm.co.uk vffm.co.uk
watchhousefp.co.uk watchhousefp.co.uk
wellbankwm.co.uk wellbankwm.co.uk
bridgewaterwm.co.uk bridgewaterwm.co.uk
whittinghamprivateclients.com whittinghamprivateclients.com
wokingfinancialadviser.co.uk wokingfinancialadviser.co.uk
bullivantwealth.co.uk bullivantwealth.co.uk
woodwealth.co.uk woodwealth.co.uk
wpwfinancial.co.uk wpwfinancial.co.uk
calverwm.co.uk calverwm.co.uk
chapmansfinancial.co.uk chapmansfinancial.co.uk
christopherpughwealthmanagement.co.uk christopherpughwealthmanagement.co.uk
clairereadwm.co.uk clairereadwm.co.uk
claywealth.co.uk claywealth.co.uk
cleevefinancialplanning.co.uk cleevefinancialplanning.co.uk
cliffordcharleswm.co.uk cliffordcharleswm.co.uk
colebridgefs.co.uk colebridgefs.co.uk
compoundwealth.uk compoundwealth.uk
coralfp.co.uk coralfp.co.uk
craigcrawfordfinancial.co.uk craigcrawfordfinancial.co.uk
craigsaxtonwm.co.uk craigsaxtonwm.co.uk
creativelp.co.uk creativelp.co.uk
custom.sjp-cloud.info custom.sjp-cloud.info
declankiely.co.uk declankiely.co.uk
destinationwealth.co.uk destinationwealth.co.uk
dmcfp.co.uk dmcfp.co.uk
dtbwealthmanagement.co.uk dtbwealthmanagement.co.uk
dunnewealthmanagement.co.uk dunnewealthmanagement.co.uk
dwwealthplanning.co.uk dwwealthplanning.co.uk
eastlakewm.co.uk eastlakewm.co.uk
ecwealthmanagement.co.uk ecwealthmanagement.co.uk
emilyman.com emilyman.com
euanmacfarlane.co.uk euanmacfarlane.co.uk
fardiniwm.co.uk fardiniwm.co.uk
farrfinancialplanning.co.uk farrfinancialplanning.co.uk
fenlandfinancialplanning.co.uk fenlandfinancialplanning.co.uk
filsellwealth.co.uk filsellwealth.co.uk
financialplanningformedics.co.uk financialplanningformedics.co.uk
finlaywealth.co.uk finlaywealth.co.uk
fisherwealthmanagementltd.co.uk fisherwealthmanagementltd.co.uk
fmwealth.co.uk fmwealth.co.uk
forethoughtfinancial.co.uk forethoughtfinancial.co.uk
fortitudewealthmanagement.co.uk fortitudewealthmanagement.co.uk
fskfinancialplanning.co.uk fskfinancialplanning.co.uk
gandhiwealth.co.uk gandhiwealth.co.uk
gillespiefinancial.co.uk gillespiefinancial.co.uk
gillespiefinancialconsultancy.co.uk gillespiefinancialconsultancy.co.uk
gillespiefinancialconsultants.com gillespiefinancialconsultants.com
gittinsandco.com gittinsandco.com
glencairnfp.co.uk glencairnfp.co.uk
goldenacornfp.com goldenacornfp.com
goldreflectwm.co.uk goldreflectwm.co.uk
grantcharlesfp.co.uk grantcharlesfp.co.uk
hartfp.co.uk hartfp.co.uk
herfinancialplanning.co.uk herfinancialplanning.co.uk
hfkwealth.co.uk hfkwealth.co.uk
highfieldwealth.co.uk highfieldwealth.co.uk
hinaziawm.co.uk hinaziawm.co.uk
hmhwealth.co.uk hmhwealth.co.uk
hoylandwm.co.uk hoylandwm.co.uk
hrwilsonassociates.co.uk hrwilsonassociates.co.uk
ironbarkwm.co.uk ironbarkwm.co.uk
isherwoodfinancialservices.co.uk isherwoodfinancialservices.co.uk
jamesdrowley.co.uk jamesdrowley.co.uk
jamesonwealthmanagement.co.uk jamesonwealthmanagement.co.uk
jdcfinancialplanning.co.uk jdcfinancialplanning.co.uk
jenkinsonwealth.co.uk jenkinsonwealth.co.uk
jimbondwm.co.uk jimbondwm.co.uk
jkb-wealth.co.uk jkb-wealth.co.uk
jmfp.co.uk jmfp.co.uk
joannefogowm.co.uk joannefogowm.co.uk
johnhomewealthmanagement.co.uk johnhomewealthmanagement.co.uk
jpwealthmanagement.co.uk jpwealthmanagement.co.uk
kellypardoewm.co.uk kellypardoewm.co.uk
kenwoodwealthmanagement.co.uk kenwoodwealthmanagement.co.uk
kevinbassett.co.uk kevinbassett.co.uk
kevinhepworth.co.uk kevinhepworth.co.uk
kevinlaidlaw.co.uk kevinlaidlaw.co.uk
khawajawealthmanagement.co.uk khawajawealthmanagement.co.uk
kilsaranfp.co.uk kilsaranfp.co.uk
lamymanandco.co.uk lamymanandco.co.uk
langwealthmanagement.co.uk langwealthmanagement.co.uk
laurajoycewealthmanagement.co.uk laurajoycewealthmanagement.co.uk
lemontfp.co.uk lemontfp.co.uk
lifematterswmltd.co.uk lifematterswmltd.co.uk
lisavaughanfp.co.uk lisavaughanfp.co.uk
ljgriffithswealth.co.uk ljgriffithswealth.co.uk
longsandsfp.co.uk longsandsfp.co.uk
mackaywm.co.uk mackaywm.co.uk
mansfieldfs.co.uk mansfieldfs.co.uk
mantafp.co.uk mantafp.co.uk
marccarpenterwm.co.uk marccarpenterwm.co.uk
martaderpenska.co.uk martaderpenska.co.uk
matthewconroy.co.uk matthewconroy.co.uk
mattimorewealth.co.uk mattimorewealth.co.uk
mbwealthmanagement.co.uk mbwealthmanagement.co.uk
mcdermidfinancialplanning.co.uk mcdermidfinancialplanning.co.uk
mcgarveyjones.co.uk mcgarveyjones.co.uk
mcgillwm.co.uk mcgillwm.co.uk
mcleodwm.co.uk mcleodwm.co.uk
mhwml.co.uk mhwml.co.uk
michaelheard.co.uk michaelheard.co.uk
michaeltreed.co.uk michaeltreed.co.uk
mjrfinancialplanning.co.uk mjrfinancialplanning.co.uk
mkm-wm.co.uk mkm-wm.co.uk
mollamwm.co.uk mollamwm.co.uk
morrinsonwealth.co.uk morrinsonwealth.co.uk
mpurcell.co.uk mpurcell.co.uk
mwandpartners.co.uk mwandpartners.co.uk
naomihaynes.co.uk naomihaynes.co.uk
nauticalwealth.co.uk nauticalwealth.co.uk
ncoprivateclients.co.uk ncoprivateclients.co.uk
nicholasbonefinancial.co.uk nicholasbonefinancial.co.uk
manganfp.co.uk manganfp.co.uk
norfolkwealth.co.uk norfolkwealth.co.uk
norifinancial.co.uk norifinancial.co.uk
northernspire.co.uk northernspire.co.uk
oaksmithfinancialplanning.co.uk oaksmithfinancialplanning.co.uk
originwm.co.uk originwm.co.uk
oxfordwm.co.uk oxfordwm.co.uk
oysterwealthplanning.com oysterwealthplanning.com
revolutionwealth.co.uk revolutionwealth.co.uk
pantheonwealthpartners.co.uk pantheonwealthpartners.co.uk
pardeepnarwal.co.uk pardeepnarwal.co.uk
parnellfinancialmanagement.com parnellfinancialmanagement.com
patrickclayphanwm.co.uk patrickclayphanwm.co.uk
patrickmckeownwm.co.uk patrickmckeownwm.co.uk
paulcoenwealth.co.uk paulcoenwealth.co.uk
pauldaveywm.co.uk pauldaveywm.co.uk
paulkerrwm.com paulkerrwm.com
paulwhittlewm.co.uk paulwhittlewm.co.uk
richardcoxwm.co.uk richardcoxwm.co.uk
richardmarshall.uk richardmarshall.uk
pearsonfinancialwellbeing.co.uk pearsonfinancialwellbeing.co.uk
penrose.website-testing-link.net penrose.website-testing-link.net
ripplewealth.co.uk ripplewealth.co.uk
petrichorfinancialsolutions.com petrichorfinancialsolutions.com
philipblackwealthmanagement.co.uk philipblackwealthmanagement.co.uk
planitfuture.co.uk planitfuture.co.uk
planned-wealth.co.uk planned-wealth.co.uk
portawealth.co.uk portawealth.co.uk
portsdownwealthmanagement.co.uk portsdownwealthmanagement.co.uk
potterfp.co.uk potterfp.co.uk
priteshkabawala.co.uk priteshkabawala.co.uk
progressivewealth.co.uk progressivewealth.co.uk
psrwm.co.uk psrwm.co.uk
mcqueenwealth.co.uk mcqueenwealth.co.uk
mcgwealth.co.uk mcgwealth.co.uk
crockerandpartners.co.uk crockerandpartners.co.uk
midlandfp.co.uk midlandfp.co.uk
rexwealth.co.uk rexwealth.co.uk
rheawm.co.uk rheawm.co.uk
rhwml.co.uk rhwml.co.uk
richardreith.co.uk richardreith.co.uk
rkpwealthmanagement.co.uk rkpwealthmanagement.co.uk
rjmfp.co.uk rjmfp.co.uk
rowlandfp.co.uk rowlandfp.co.uk
absoluteprotectionandwealth.com absoluteprotectionandwealth.com
bybrookwm.co.uk bybrookwm.co.uk
samanthaprendergast.co.uk samanthaprendergast.co.uk
sapphirefinancialplanning.com sapphirefinancialplanning.com
adastrafinancial.co.uk adastrafinancial.co.uk
advice-on-line.co.uk advice-on-line.co.uk
ajleefinancialplanning.co.uk ajleefinancialplanning.co.uk
akrwealth.co.uk akrwealth.co.uk
altairfp.co.uk altairfp.co.uk
sgwealth.co.uk sgwealth.co.uk
sherwoodsolutions.com sherwoodsolutions.com
alexleamanwm.co.uk alexleamanwm.co.uk
simplewealthsolutions.co.uk simplewealthsolutions.co.uk
amberwealthmanagementltd.co.uk amberwealthmanagementltd.co.uk
annsandgrange.co.uk annsandgrange.co.uk
solebayfp.com solebayfp.com
southoverwealth.co.uk southoverwealth.co.uk
andertonfinancialplanning.co.uk andertonfinancialplanning.co.uk
sparkwealth.co.uk sparkwealth.co.uk
sovereign-wealth.co.uk sovereign-wealth.co.uk
andyheyes.co.uk andyheyes.co.uk
spinnaker-wealth.co.uk spinnaker-wealth.co.uk
spinnakerwealth.co.uk spinnakerwealth.co.uk
spinningfieldswealth.co.uk spinningfieldswealth.co.uk
srmwealth.co.uk srmwealth.co.uk
ssl-test.sjp-cloud.info ssl-test.sjp-cloud.info
standrewswm.co.uk standrewswm.co.uk
stephendawsonwealthmanagement.co.uk stephendawsonwealthmanagement.co.uk
stephensonwealthmanagement.co.uk stephensonwealthmanagement.co.uk
stjulienfp.co.uk stjulienfp.co.uk
atlasprivatewealth.co.uk atlasprivatewealth.co.uk
abreyprivateclients.com abreyprivateclients.com
surreyoakswm.co.uk surreyoakswm.co.uk
alderleyfinancialplanning.co.uk alderleyfinancialplanning.co.uk
swfsltd.co.uk swfsltd.co.uk
swilcanfinancialpartners.co.uk swilcanfinancialpartners.co.uk
amicafinancialwellbeing.co.uk amicafinancialwellbeing.co.uk
tait.financial tait.financial
taylorwealthmanagement.co.uk taylorwealthmanagement.co.uk
templepiper.co.uk templepiper.co.uk
tgulfinancialadviser.co.uk tgulfinancialadviser.co.uk
avfp.co.uk avfp.co.uk
avongreenfinancial.co.uk avongreenfinancial.co.uk
avonwoodfinancial.uk avonwoodfinancial.uk
theethicalwealthproject.co.uk theethicalwealthproject.co.uk
axis-fpl.co.uk axis-fpl.co.uk
thinkwealth.co.uk thinkwealth.co.uk
bafp.co.uk bafp.co.uk
thomasporterwm.co.uk thomasporterwm.co.uk
tiffanybeardfinancialadvisers.co.uk tiffanybeardfinancialadvisers.co.uk
balmerfinancialplanning.co.uk balmerfinancialplanning.co.uk
tlcwealthmanagement.co.uk tlcwealthmanagement.co.uk
belgravefinancial.com belgravefinancial.com
bentleybrownandco.co.uk bentleybrownandco.co.uk
tullochwealthmanagement.co.uk tullochwealthmanagement.co.uk
twachartered.co.uk twachartered.co.uk
twcfinancial.co.uk twcfinancial.co.uk
tweedieandwyllie.co.uk tweedieandwyllie.co.uk
venturawealth.co.uk venturawealth.co.uk
blackfinwm.co.uk blackfinwm.co.uk
vivawealth.co.uk vivawealth.co.uk
warwickshirewealthmanagement.co.uk warwickshirewealthmanagement.co.uk
wellsandcofinancialplanning.co.uk wellsandcofinancialplanning.co.uk
brcwm.co.uk brcwm.co.uk
brewardfp.co.uk brewardfp.co.uk
whitfeldfinancialplanning.co.uk whitfeldfinancialplanning.co.uk
whitstablefp.co.uk whitstablefp.co.uk
wildandwildwm.co.uk wildandwildwm.co.uk
bromleyrahlke.co.uk bromleyrahlke.co.uk
bromptonprivatewealth.co.uk bromptonprivatewealth.co.uk
williamstreetwealth.co.uk williamstreetwealth.co.uk
williamswealthconsultancy.co.uk williamswealthconsultancy.co.uk
woodmitchellfp.co.uk woodmitchellfp.co.uk
bwwm.uk bwwm.uk
yasutoarai.co.uk yasutoarai.co.uk
yltwealthmanagement.co.uk yltwealthmanagement.co.uk
chalicefinancialplanning.co.uk chalicefinancialplanning.co.uk
challonerwealth.com challonerwealth.com
chequersfinancialplanning.co.uk chequersfinancialplanning.co.uk
choices.sjp.co.uk choices.sjp.co.uk
chrisbromiley.co.uk chrisbromiley.co.uk
chriswordsworthfinancialplanning.co.uk chriswordsworthfinancialplanning.co.uk
ciaranpreshurwm.co.uk ciaranpreshurwm.co.uk
compass-fs.org compass-fs.org
comptonfinancialadvice.co.uk comptonfinancialadvice.co.uk
connectedfinancial.co.uk connectedfinancial.co.uk
copfordfinancialplanning.co.uk copfordfinancialplanning.co.uk
cotswoldfinancialsolutions.co.uk cotswoldfinancialsolutions.co.uk
crescentwm.co.uk crescentwm.co.uk
cthfinancialplanning.co.uk cthfinancialplanning.co.uk
danielsalt.co.uk danielsalt.co.uk
davidjoneswealthmanagement.co.uk davidjoneswealthmanagement.co.uk
davieswealthmanagement.uk davieswealthmanagement.uk
dvcwealth.co.uk dvcwealth.co.uk
dwiwm.co.uk dwiwm.co.uk
easternhorizonwealth.co.uk easternhorizonwealth.co.uk
eddicottwealthmanagement.co.uk eddicottwealthmanagement.co.uk
ejsfinancialservices.co.uk ejsfinancialservices.co.uk
ellisonwealthmanagement.co.uk ellisonwealthmanagement.co.uk
ellisonwwm.co.uk ellisonwwm.co.uk
elmhurstfinancialplanning.co.uk elmhurstfinancialplanning.co.uk
emmarice-sjp.co.uk emmarice-sjp.co.uk
erinrosefinancial.co.uk erinrosefinancial.co.uk
erwealth.co.uk erwealth.co.uk
etteca.asia etteca.asia
evelynevanswm.co.uk evelynevanswm.co.uk
ffcbwealth.co.uk ffcbwealth.co.uk
ffwm.co.uk ffwm.co.uk
finative.co.uk finative.co.uk
fordhamfinancialplanning.co.uk fordhamfinancialplanning.co.uk
forest-oak.co.uk forest-oak.co.uk
fortispw.co.uk fortispw.co.uk
franceshackett.co.uk franceshackett.co.uk
frostwealthmanagement.co.uk frostwealthmanagement.co.uk
futuruswealth.co.uk futuruswealth.co.uk
geraldburns.co.uk geraldburns.co.uk
gillespiefinancialconsultants.co.uk gillespiefinancialconsultants.co.uk
glenncooklandwealthmanagement.co.uk glenncooklandwealthmanagement.co.uk
godivafinancialplanning.co.uk godivafinancialplanning.co.uk
gothamwealth.co.uk gothamwealth.co.uk
gregorycharlesfp.co.uk gregorycharlesfp.co.uk
grindalwealthmanagement.co.uk grindalwealthmanagement.co.uk
gwwealth.co.uk gwwealth.co.uk
hamiltonbennett.co.uk hamiltonbennett.co.uk
hansawealthmanagement.co.uk hansawealthmanagement.co.uk
harmoneyfinancialpartners.co.uk harmoneyfinancialpartners.co.uk
hbegumfinancialplanning.co.uk hbegumfinancialplanning.co.uk
heberdenwealthmanagement.co.uk heberdenwealthmanagement.co.uk
helenmrogers.co.uk helenmrogers.co.uk
helenwrightwealthmanagement.co.uk helenwrightwealthmanagement.co.uk
hibbertwealthmanagement.co.uk hibbertwealthmanagement.co.uk
hivefp.co.uk hivefp.co.uk
houlcroftwm.co.uk houlcroftwm.co.uk
hudsonwealthconsultancy.co.uk hudsonwealthconsultancy.co.uk
hutchesonfinancial.co.uk hutchesonfinancial.co.uk
hwmfinancial.co.uk hwmfinancial.co.uk
iancameronfp.co.uk iancameronfp.co.uk
ikebenson.co.uk ikebenson.co.uk
iriswm.co.uk iriswm.co.uk
jafp.co.uk jafp.co.uk
jamesfullerwm.co.uk jamesfullerwm.co.uk
jameswindsorfp.co.uk jameswindsorfp.co.uk
jayjeffreywealthmanagement.co.uk jayjeffreywealthmanagement.co.uk
jdwealthmanagement.co.uk jdwealthmanagement.co.uk
jeremydavieswm.co.uk jeremydavieswm.co.uk
jmwealthmanagement.co.uk jmwealthmanagement.co.uk
jnfwealthmanagement.co.uk jnfwealthmanagement.co.uk
joblingwm.co.uk joblingwm.co.uk
jonathanelliottwealthmanagement.co.uk jonathanelliottwealthmanagement.co.uk
jpafinancialplanning.co.uk jpafinancialplanning.co.uk
jrmwealth.co.uk jrmwealth.co.uk
jshelleywm.co.uk jshelleywm.co.uk
julianmobsby.co.uk julianmobsby.co.uk
juxonwealth.com juxonwealth.com
kevindenman.co.uk kevindenman.co.uk
kilbrinfinancial.co.uk kilbrinfinancial.co.uk
kingsfordwealthmanagement.co.uk kingsfordwealthmanagement.co.uk
kpricewealthmanagement.co.uk kpricewealthmanagement.co.uk
kyarwoodwm.co.uk kyarwoodwm.co.uk
lainstonwm.co.uk lainstonwm.co.uk
lainstonwm.com lainstonwm.com
lawrenceneilwealthmanagement.co.uk lawrenceneilwealthmanagement.co.uk
leeperkes.co.uk leeperkes.co.uk
legacycm.co.uk legacycm.co.uk
lethbridgewm.co.uk lethbridgewm.co.uk
liambailliewealthmanagement.co.uk liambailliewealthmanagement.co.uk
limestonefp.co.uk limestonefp.co.uk
lisamccreadiewealthmanagement.co.uk lisamccreadiewealthmanagement.co.uk
ljgwealth.co.uk ljgwealth.co.uk
neallynch.co.uk neallynch.co.uk
lochriefp.co.uk lochriefp.co.uk
lochriewm.co.uk lochriewm.co.uk
lordstonefinancial.co.uk lordstonefinancial.co.uk
luwerowealthadvisers.co.uk luwerowealthadvisers.co.uk
lwwealthmanagement.co.uk lwwealthmanagement.co.uk
lyndaamos.co.uk lyndaamos.co.uk
macleodfinancial.co.uk macleodfinancial.co.uk
majorcontext.com majorcontext.com
marksullivanwm.co.uk marksullivanwm.co.uk
marktigwell.co.uk marktigwell.co.uk
masonbrownfp.co.uk masonbrownfp.co.uk
medexfm.co.uk medexfm.co.uk
meenahalaiws.co.uk meenahalaiws.co.uk
morewealthmanagement.co.uk morewealthmanagement.co.uk
mwwealth.co.uk mwwealth.co.uk
nickdcox.co.uk nickdcox.co.uk
nickhowells.co.uk nickhowells.co.uk
nineoak.co.uk nineoak.co.uk
njhwealth.co.uk njhwealth.co.uk
noulawealth.com noulawealth.com
obwealth.co.uk obwealth.co.uk
ocsfinancialplanning.co.uk ocsfinancialplanning.co.uk
mariakyritsis.com mariakyritsis.com
oliumfinancial.co.uk oliumfinancial.co.uk
oneillwealth.co.uk oneillwealth.co.uk
orangetreewealthmanagement.co.uk orangetreewealthmanagement.co.uk
ovalwealthpartners.co.uk ovalwealthpartners.co.uk
pamw.co.uk pamw.co.uk
paragonwealth.co.uk paragonwealth.co.uk
parallelwealthmanagement.co.uk parallelwealthmanagement.co.uk
parksidefinancialplanning.co.uk parksidefinancialplanning.co.uk
parrettfinancial.co.uk parrettfinancial.co.uk
pathfinderpw.co.uk pathfinderpw.co.uk
pbfps.co.uk pbfps.co.uk
pearcesargent.co.uk pearcesargent.co.uk
pearwoodfinancial.co.uk pearwoodfinancial.co.uk
peterstephensonwm.co.uk peterstephensonwm.co.uk
petrichorfinancialsolutions.co.uk petrichorfinancialsolutions.co.uk
quintessentialwealthmanagement.co.uk quintessentialwealthmanagement.co.uk
rebeccakingwell.co.uk rebeccakingwell.co.uk
reddingswmltd.co.uk reddingswmltd.co.uk
regentdow.co.uk regentdow.co.uk
DULEYPRACTICE.CO.UK
IP History

Click the IP addresses to see over domains using them.