WILLIAMSONWM.CO.UK
Shared Attributes
Domain
wmcinvestment.com wmcinvestment.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
woodfallwealth.co.uk woodfallwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 175 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
yiotawilkinsonwm.co.uk yiotawilkinsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 55 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 116 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 112 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
langleyparkwealth.co.uk langleyparkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-TJPPJ8 Aug 2020 Aug 2020 One Off
williamswealthmanagement.co.uk williamswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
willingalewealthmanagement.co.uk willingalewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 116 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
wronskiwealthmanagement.co.uk wronskiwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 102 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
wilcoxday.co.uk wilcoxday.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Sep 2020 Oct 2020 50 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
wiltshirewm.co.uk wiltshirewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
wilkinsonwealth.co.uk wilkinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 137 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
greavesfinancialservices.co.uk greavesfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-TJPPJ8 Aug 2020 Aug 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
lehmannfinancialmanagement.co.uk lehmannfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-TJPPJ8 Aug 2020 Aug 2020 One Off
wilsonwealthmanagement.co.uk wilsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
GTM GTM-TJPPJ8 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
wjpickering.co.uk wjpickering.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
wolfewealth.co.uk wolfewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
woodstockwealthmanagement.co.uk woodstockwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
GTM GTM-TJPPJ8 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
wyefieldwm.co.uk wyefieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 55 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
laurencewilkinson.co.uk laurencewilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 310 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lcwealth.co.uk lcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lhfp.co.uk lhfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
linleyblack.com linleyblack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 148 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
llewellynfs.co.uk llewellynfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lmcfinancialplanning.co.uk lmcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lochviewfinancialplanning.co.uk lochviewfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 108 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lombardwealthassociates.co.uk lombardwealthassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lowesawyerfp.co.uk lowesawyerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 152 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lsmwealth.co.uk lsmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mainewealth.co.uk mainewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 326 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mandersfinancialservices.co.uk mandersfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
martenwm.co.uk martenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
maskerywealthmanagement.com maskerywealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
masonswealthassociates.co.uk masonswealthassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2024 2 years, 227 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mathieson-financial-services.co.uk mathieson-financial-services.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
melluter.co.uk melluter.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
merlinwealthmanagement.co.uk merlinwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
michaeljcookwm.co.uk michaeljcookwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 124 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mktwealthmanagement.co.uk mktwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mwm-sjp.co.uk mwm-sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
napiersharpe.com napiersharpe.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jan 2022 104 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
narwalwm.co.uk narwalwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
naziahaquewm.co.uk naziahaquewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
niceassociates.co.uk niceassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
northumbriafm.co.uk northumbriafm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
norwoodfp.com norwoodfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
oakroomwealth.co.uk oakroomwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
patmclaughlin.co.uk patmclaughlin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 May 2021 73 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paton-feaver.com paton-feaver.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulthorntonsjp.co.uk paulthorntonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 44 days
GTM GTM-58PXN8T Feb 2021 May 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulwardwealth.co.uk paulwardwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
pcfaltd.co.uk pcfaltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 1 year, 1 day
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
petermulronefp.co.uk petermulronefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
pettengellwealth.co.uk pettengellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
pfswm.co.uk pfswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
philiphamilton.co.uk philiphamilton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
pollardwealthmanagement.co.uk pollardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
chapel-wealth.co.uk chapel-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 55 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bwfconsultants.com bwfconsultants.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
brownlow.co.uk brownlow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
acsfinancialplanning.co.uk acsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
brightwm.co.uk brightwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
broadhurstfm.co.uk broadhurstfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
admitchellfinancialplanning.co.uk admitchellfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
aflfinancial.co.uk aflfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 281 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
agfp.co.uk agfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
argentwm.co.uk argentwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alanrutherfordwealth.co.uk alanrutherfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alexanderswm.co.uk alexanderswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
albrightonwm.co.uk albrightonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ambersmithwc.co.uk ambersmithwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
armstrongswealth.co.uk armstrongswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 301 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andersonwealthplanning.co.uk andersonwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 350 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewcummingwm.co.uk andrewcummingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewswealth.co.uk andrewswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ashleyjai.co.uk ashleyjai.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
atkinsfinancialmanagement.co.uk atkinsfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 192 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
barbaracopeland.co.uk barbaracopeland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
barneswealthmanagement.co.uk barneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bderose.co.uk bderose.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
beauchampwealth.co.uk beauchampwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bellamywealthmanagement.co.uk bellamywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
benningfm.com benningfm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bglwealth.co.uk bglwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 277 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
boardmanwealth.co.uk boardmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
blancowealthmanagement.co.uk blancowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 259 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
boagenglandfp.co.uk boagenglandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bpcwealth.co.uk bpcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bracewealth.co.uk bracewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
buchanwm.co.uk buchanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cadmanandco.co.uk cadmanandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 258 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
cedarfp.co.uk cedarfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 56 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cfswp.co.uk cfswp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
chatsworthwm.co.uk chatsworthwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
chrisjwilkinson.co.uk chrisjwilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cliftonwealthmanagement.co.uk cliftonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 52 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
collinswm.co.uk collinswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
colyerassociates.co.uk colyerassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 344 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
coronationwealth.co.uk coronationwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dfsfinancialconsultancy.co.uk dfsfinancialconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 47 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davidhannonwealthmanagement.co.uk davidhannonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davidmccollwealthmanagement.co.uk davidmccollwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
derekmillswealth.co.uk derekmillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 47 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
derekscott.co.uk derekscott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 47 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dilasserprivateclients.co.uk dilasserprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 46 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dmcwm.co.uk dmcwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
duncanwealth.co.uk duncanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ecclesgreenwood.co.uk ecclesgreenwood.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
eswaranstone.com eswaranstone.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 159 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
executivewealth.co.uk executivewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 261 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
fawcettwm.co.uk fawcettwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
firstchoicefinancial.co.uk firstchoicefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
fowlerfp.co.uk fowlerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 38 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
franciswealth.co.uk franciswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 38 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gainsboroughwealthmanagement.co.uk gainsboroughwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
garyhewett.co.uk garyhewett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gdtwealthmanagement.co.uk gdtwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gibsonlaingwealth.co.uk gibsonlaingwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gillespiefinancial.com gillespiefinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
godridgewealth.co.uk godridgewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 156 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gofp.co.uk gofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
goldbywealth.com goldbywealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gpswealthmanagement.co.uk gpswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
grahamtiney.co.uk grahamtiney.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
grovewealthmanagement.info grovewealthmanagement.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gsqwealth.co.uk gsqwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
harmansmith.co.uk harmansmith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
harrisonjamesfp.co.uk harrisonjamesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
henshallwm.co.uk henshallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hfinancialplanning.co.uk hfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hfwealthplanning.co.uk hfwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hindleandjepsonfs.co.uk hindleandjepsonfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hjwealthplanning.co.uk hjwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
honeycroftwm.co.uk honeycroftwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hugocraggs.co.uk hugocraggs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hwmwealth.co.uk hwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 38 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hylandfp.co.uk hylandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
janineedwards.co.uk janineedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jenybeardsley.co.uk jenybeardsley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
johnsherlock.co.uk johnsherlock.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
johntavender.co.uk johntavender.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jolyonroderickfp.co.uk jolyonroderickfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jsawealthmanagement.co.uk jsawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 330 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kanishkswarup.co.uk kanishkswarup.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 312 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kimgeorge.co.uk kimgeorge.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
krfinancialplanning.co.uk krfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 146 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jpprivateclients.co.uk jpprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jsfinancialplanning.co.uk jsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
juliantrumper.co.uk juliantrumper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
justinredwards.co.uk justinredwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jwhwealth.co.uk jwhwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kcwealth.co.uk kcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
keithmarwick.co.uk keithmarwick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kevinwhite.co.uk kevinwhite.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kpfinancialwellbeing.co.uk kpfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 23 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ktwm.co.uk ktwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
leversedgewm.co.uk leversedgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lyonsfinancialmanagement.co.uk lyonsfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 19 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
marktimmins.com marktimmins.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
martinjonesfinancialservices.co.uk martinjonesfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mckenzieandco.co.uk mckenzieandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2023 1 year, 201 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mcknightassociates.co.uk mcknightassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mercuryfinancial.co.uk mercuryfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mlfinancialconsultants.co.uk mlfinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 114 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
moranprivateclientpractice.co.uk moranprivateclientpractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
murrowwealthmanagement.co.uk murrowwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
neilloveitt.co.uk neilloveitt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
newforestwealthmanagement.co.uk newforestwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
newsomewealthmanagement.co.uk newsomewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
nigelwd.co.uk nigelwd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
oundlewealthmanagement.co.uk oundlewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 312 days
GTM GTM-58PXN8T Feb 2021 May 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulsamoilys.co.uk paulsamoilys.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulsmithwm.co.uk paulsmithwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
penrosewealthmanagement.co.uk penrosewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
penvearnwealthmanagement.co.uk penvearnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
petersimonsfinancialservices.co.uk petersimonsfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
phillipsparham.co.uk phillipsparham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 293 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
pickeringandryefinancial.co.uk pickeringandryefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
pjlwealthmanagement.com pjlwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 76 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
pointtopointfm.co.uk pointtopointfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 100 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
perchardwealthmanagement.co.uk perchardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
buttercrossfp.co.uk buttercrossfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
castlerockwealth.co.uk castlerockwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
buchananfp.co.uk buchananfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bpwealthmanagement.co.uk bpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
britannicfp.co.uk britannicfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adwfinancialsolutions.co.uk adwfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adrianwhitewm.co.uk adrianwhitewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adamsonross.co.uk adamsonross.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
akfm.co.uk akfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alanfilsell.co.uk alanfilsell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 341 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
altonwealth.co.uk altonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alexanderdannwealthmanagementltd.co.uk alexanderdannwealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alexcaulder.co.uk alexcaulder.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 336 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alistairblack.com alistairblack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 350 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cambriawealth.co.uk cambriawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cameronjonesfm.com cameronjonesfm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
amandaredmanfp.co.uk amandaredmanfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
amberleyhulmewm.co.uk amberleyhulmewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 192 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
anchorwmltd.co.uk anchorwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewdavid.co.uk andrewdavid.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 10 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewskinnerwealth.co.uk andrewskinnerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewvrettos.co.uk andrewvrettos.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
atlanticwc.co.uk atlanticwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 63 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
beckwealth.co.uk beckwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
benchapmanwealth.co.uk benchapmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
berkleysquarepc.co.uk berkleysquarepc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bffinancialplanning.co.uk bffinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bfpwealthmanagement.co.uk bfpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
blackdownwealthmanagement.co.uk blackdownwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
vinitmehta.co.uk vinitmehta.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 70 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bloomerwealth.co.uk bloomerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bowcliffewm.co.uk bowcliffewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
wentworthwm.co.uk wentworthwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
welshandtaylorwealth.co.uk welshandtaylorwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-TJPPJ8 Oct 2020 Oct 2020 17 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
brittonassociates.co.uk brittonassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
brooksfinancialplanning.co.uk brooksfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
woodruffhill.co.uk woodruffhill.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
calderwoodwm.co.uk calderwoodwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
carlcrossfield.co.uk carlcrossfield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
chalkfarmfinancial.co.uk chalkfarmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 55 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
chapman-associates.co.uk chapman-associates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
chrisbuckland.co.uk chrisbuckland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
chromaticwealth.co.uk chromaticwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
circlewealth.co.uk circlewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 89 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
clarenceplace.co.uk clarenceplace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
claywarden.co.uk claywarden.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2023 1 year, 166 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cmpfinancial.co.uk cmpfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 52 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
coecapital.co.uk coecapital.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
comfortfinancial.co.uk comfortfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 125 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
constantiawealthandfinance.co.uk constantiawealthandfinance.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2024 2 years, 251 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
copperrock.co.uk copperrock.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 252 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cordata.co.uk cordata.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 24 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cormackwealthmanagement.co.uk cormackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 May 2024 2 years, 199 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cornerstonewealthmanagement.co.uk cornerstonewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cruddenfinancialplanning.co.uk cruddenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 49 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
denhamwm.co.uk denhamwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 47 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
djswealthadviser.co.uk djswealthadviser.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
eamonncassidy.co.uk eamonncassidy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
flackwellfs.com flackwellfs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 156 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
frazerwealth.co.uk frazerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 38 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
garyshieldswealthmanagementllp.co.uk garyshieldswealthmanagementllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gbwealthmanagement.co.uk gbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 244 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
goldingandpartners.co.uk goldingandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 359 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
goldwealthmanagement.co.uk goldwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gravitaswm.co.uk gravitaswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
greenwealthplanning.co.uk greenwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
greenwoodwealthsolutions.co.uk greenwoodwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
guthriefps.co.uk guthriefps.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 114 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hackettwealth.co.uk hackettwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 33 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hamptonjamesfa.co.uk hamptonjamesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 33 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hawkinsthomas.co.uk hawkinsthomas.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hawwm.co.uk hawwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
holleronwm.co.uk holleronwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 129 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hutchinsonfinancialplanningltd.co.uk hutchinsonfinancialplanningltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ianrennardfp.co.uk ianrennardfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jamieweller.co.uk jamieweller.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 27 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jbedwards.co.uk jbedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jenningsfp.co.uk jenningsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 280 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
johnpigott.co.uk johnpigott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2024 2 years, 122 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jolyonhankinson.co.uk jolyonhankinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2022 222 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adhwealthmanagement.co.uk adhwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ajwwealth.co.uk ajwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ajtwealth.co.uk ajtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 133 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ajgwealthmanagement.co.uk ajgwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ajbarnesfinancial.co.uk ajbarnesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
campbellcainwm.co.uk campbellcainwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alwealthmanagement.co.uk alwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
aleksjeromel.co.uk aleksjeromel.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alisonwright.co.uk alisonwright.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 350 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
macfarlanewealthpartners.com macfarlanewealthpartners.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
annegibsonsjp.co.uk annegibsonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
antlerwealth.co.uk antlerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
antonyearley.co.uk antonyearley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2022 174 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewclarey.co.uk andrewclarey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewoliverfinancial.co.uk andrewoliverfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewrogerswm.co.uk andrewrogerswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andybarrettsjp.co.uk andybarrettsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adambentonwm.co.uk adambentonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
aswealthmanagement.co.uk aswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 63 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
athertonandassociates.co.uk athertonandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 63 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
avonwoodfinancial.co.uk avonwoodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 95 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ballantinewm.co.uk ballantinewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
beckfordandlewis.co.uk beckfordandlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bennisonyates.co.uk bennisonyates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bhtwealthmanagement.co.uk bhtwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
uwmwealth.co.uk uwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 69 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
blackwaterwealthmanagement.co.uk blackwaterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
blenheimwealthmanagement.co.uk blenheimwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
blossomwealth.co.uk blossomwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
vittyalexander.co.uk vittyalexander.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 305 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bootefinancial.co.uk bootefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
watchhousewm.co.uk watchhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 104 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 81 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
breretonjacksonfinancial.co.uk breretonjacksonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
westerhamfs.co.uk westerhamfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
burfieldshousewm.co.uk burfieldshousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cedarswm.co.uk cedarswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 56 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
christianjohnwm.co.uk christianjohnwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
chronoswm.co.uk chronoswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cockbainassociates.co.uk cockbainassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
coenandclark.co.uk coenandclark.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cooksonwm.co.uk cooksonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
corneliuswealth.co.uk corneliuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
countrysidefs.co.uk countrysidefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cranwellws.co.uk cranwellws.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 24 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
crawforddean.co.uk crawforddean.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cyrpaillard.co.uk cyrpaillard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 49 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davewalkerwealthmanagement.co.uk davewalkerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 197 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davidhillwealth.co.uk davidhillwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davidmakin.co.uk davidmakin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davidmelrosewm.co.uk davidmelrosewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dbsfinancial.co.uk dbsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ddlwealthmanagement.co.uk ddlwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
deltawealth.co.uk deltawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
denmanfp.co.uk denmanfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
doreewm.co.uk doreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 267 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
drewharperfinancialconsultants.co.uk drewharperfinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
duncannunnwm.co.uk duncannunnwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 46 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dwjwealth.co.uk dwjwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dyerandcowm.co.uk dyerandcowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
financialwealthsolutions.co.uk financialwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
flavellwm.co.uk flavellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
florastamato.co.uk florastamato.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
forbesfinancial.co.uk forbesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
haycockandgricefp.co.uk haycockandgricefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gillisfinancial.co.uk gillisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2023 1 year, 204 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ginderswm.co.uk ginderswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 336 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
godfreywealthmanagement.co.uk godfreywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
grahamwealthmanagement.co.uk grahamwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2024 2 years, 260 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
guthriewealthconsultancy.co.uk guthriewealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hadlowedwards.co.uk hadlowedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
harnhill.com harnhill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
harriesfinancial.co.uk harriesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hartleywm.co.uk hartleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 39 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
heritagefc.co.uk heritagefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hesslewoodwm.co.uk hesslewoodwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 74 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hillandcofa.co.uk hillandcofa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
houghtonwm.co.uk houghtonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 153 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
howardfinancialplanning.co.uk howardfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 333 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hutchinsonwealthmanagement.co.uk hutchinsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hwlwm.co.uk hwlwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
igwm.co.uk igwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 29 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
investasure.co.im investasure.co.im
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 28 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jeanlamb.co.uk jeanlamb.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2023 1 year, 320 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jerimeattah.co.uk jerimeattah.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 257 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jmswealthmanagement.co.uk jmswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
johncummingswm.co.uk johncummingswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jon-paulhardy.co.uk jon-paulhardy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jopottsfinancialplanning.co.uk jopottsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
juliedaweswealthmanagement.co.uk juliedaweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
juliehowiesonwealthmanagement.co.uk juliehowiesonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2024 2 years, 174 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kathwilkinson.co.uk kathwilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kennettwealthmanagement.co.uk kennettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kevindavieswm.co.uk kevindavieswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 311 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kineticwealthmanagement.co.uk kineticwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kudoswealth.com kudoswealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 182 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lenwalters.co.uk lenwalters.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 310 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lfhwealthmanagement.co.uk lfhwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lisaleewealthmanagement.co.uk lisaleewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
littlepebbles.co.uk littlepebbles.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lockingtonfinancial.co.uk lockingtonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
louisewoollardfinancial.co.uk louisewoollardfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 20 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lukecarless.co.uk lukecarless.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 352 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lynnanderson.co.uk lynnanderson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2023 2 years, 68 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
marsonwm.co.uk marsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
martellowealth.co.uk martellowealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 277 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
masperoassociates.co.uk masperoassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
maylamfinancial.co.uk maylamfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 16 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
meadwm.co.uk meadwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mercianwm.co.uk mercianwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
michaelkiener.co.uk michaelkiener.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mjbfp.co.uk mjbfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mkm-wealth.co.uk mkm-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mountstuartwm.co.uk mountstuartwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 331 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
myerswealthmanagement.co.uk myerswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
newmanrea.com newmanrea.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 307 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
nickspence.co.uk nickspence.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
oakmerewealth.co.uk oakmerewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2024 2 years, 179 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paularodriguez.co.uk paularodriguez.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulbutlerwm.co.uk paulbutlerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulmkavanagh.co.uk paulmkavanagh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 345 days
GTM GTM-58PXN8T Feb 2021 May 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulmorganwealthmanagement.co.uk paulmorganwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
petermooresjp.co.uk petermooresjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 255 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
peterwildwealth.co.uk peterwildwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 45 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
portburywealth.co.uk portburywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 127 days
GTM GTM-58PXN8T Feb 2021 May 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
prudentfpa.co.uk prudentfpa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-TJPPJ8 Aug 2020 Aug 2020 One Off
pwandpartners.co.uk pwandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 1 year, 3 days
GTM GTM-58PXN8T Feb 2021 May 2021 101 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lorrainecoaton.co.uk lorrainecoaton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 20 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lucialangella.co.uk lucialangella.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 20 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adamsandbowleswm.co.uk adamsandbowleswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
HJ HJ-946865 Oct 2020 Oct 2020 One Off
alanhillfp.co.uk alanhillfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alisongregorywm.co.uk alisongregorywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
alexziff.com alexziff.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
almavalewealthmanagement.co.uk almavalewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
askwealthmanagement.co.uk askwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 63 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
anderson-wealthmanagement.co.uk anderson-wealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andersonfinancial.co.uk andersonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewconnolly.co.uk andrewconnolly.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
carterlegrand.co.uk carterlegrand.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
casewealth.co.uk casewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 57 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bathandwestwealth.co.uk bathandwestwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
twelvewm.co.uk twelvewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
twomeywm.co.uk twomeywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 316 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bhwml.co.uk bhwml.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
valantineassociates.co.uk valantineassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 69 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
watchoakpw.co.uk watchoakpw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 104 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bowaterwealth.co.uk bowaterwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 251 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
wharfebank.co.uk wharfebank.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 116 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
brianemslie.co.uk brianemslie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bricknellwealth.co.uk bricknellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 277 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bridgesandco.co.uk bridgesandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
broadcharepartners.co.uk broadcharepartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
wilkinsonfinancialmgt.co.uk wilkinsonfinancialmgt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
willowbrooklfp.co.uk willowbrooklfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
woodheadwm.co.uk woodheadwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 100 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
wrightshadwell.co.uk wrightshadwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 116 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
burn-joneswealthmanagement.co.uk burn-joneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
burtonhills.co.uk burtonhills.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
castellwm.co.uk castellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 93 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cathedralgreenfinancialplanning.co.uk cathedralgreenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 15 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
claytondenefp.co.uk claytondenefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2022 1 year, 46 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
clearwaterwealthmanagement.co.uk clearwaterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2022 294 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
coldfairwealthmanagement.co.uk coldfairwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 51 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
colefinancial.co.uk colefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
colinjessopp.co.uk colinjessopp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
colinrexwm.co.uk colinrexwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2022 1 year, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
corinthianwealthmanagement.co.uk corinthianwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cotswoldwealth.co.uk cotswoldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ctpwm.co.uk ctpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 49 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dalejohnsonwealthmanagement.co.uk dalejohnsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 49 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
daleycroft.co.uk daleycroft.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 269 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dalviwealth.co.uk dalviwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 343 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davidgallagherwm.com davidgallagherwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2024 2 years, 132 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
daviswealth.co.uk daviswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
deltachelmsford.co.uk deltachelmsford.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
djbrewsterfcs.co.uk djbrewsterfcs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
duleypractice.co.uk duleypractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dwbwealth.co.uk dwbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dwmfp.co.uk dwmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
eadenwm.co.uk eadenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
educate-financial.co.uk educate-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
farrowwealth.co.uk farrowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 41 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
fortemfm.co.uk fortemfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
heraldwealth.co.uk heraldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
fyldewealthmanagement.co.uk fyldewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 33 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
genoawealthmanagement.co.uk genoawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2024 2 years, 179 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
goldsmithwm.co.uk goldsmithwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
goodallsmith.co.uk goodallsmith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gregorywm.co.uk gregorywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2023 2 years, 77 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gregthomsonwealth.co.uk gregthomsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
griersonwm.co.uk griersonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hallandcostellowealthmanagement.co.uk hallandcostellowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 114 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hamwicwealth.co.uk hamwicwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 33 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hetalpatelwealth.co.uk hetalpatelwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
highhousewealth.co.uk highhousewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hilljohnstone.co.uk hilljohnstone.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
islinwm.co.uk islinwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 28 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jameselliottwealthmanagement.co.uk jameselliottwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 27 days
GTM GTM-58PXN8T Feb 2021 May 2021 87 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jfwealth.co.uk jfwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
johnclementswealthmanagement.co.uk johnclementswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 71 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jpswealthmanagement.co.uk jpswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 197 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kearsleyfinancialmanagement.co.uk kearsleyfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kevinprobertwealthmanagement.co.uk kevinprobertwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 311 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kmosbyfinancial.co.uk kmosbyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 183 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
las-wealth.co.uk las-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2023 2 years, 70 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
latorrewealthmanagement.co.uk latorrewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
leedowdall.com leedowdall.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
leeswm.co.uk leeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2024 2 years, 348 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mardons.co.uk mardons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 70 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 114 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
marshallwealthmanagement.co.uk marshallwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
martinkeyte.co.uk martinkeyte.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
matrixwp.co.uk matrixwp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
matthewwykes.co.uk matthewwykes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
metcalfewealth.co.uk metcalfewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
murraywealthmanagement.co.uk murraywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
navigationwm.co.uk navigationwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
networkventuresfs.co.uk networkventuresfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2024 2 years, 288 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
nicholsonwm.co.uk nicholsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
nickclarkwm.co.uk nickclarkwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 43 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
nickcumminswealthmanagement.co.uk nickcumminswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
osmanwealth.co.uk osmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 41 days
GTM GTM-58PXN8T Feb 2021 May 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
papewealthmanagement.co.uk papewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 May 2021 73 days
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulasherlock-cross.co.uk paulasherlock-cross.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
paulgeddeswm.co.uk paulgeddeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
persellewart.co.uk persellewart.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 53 days
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
plummerandassociates.co.uk plummerandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 76 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
leeblissettwealthmanagement.co.uk leeblissettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
lewiswealthmanagement.co.uk lewiswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
lifeandlegacywm.co.uk lifeandlegacywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lisawickenswm.co.uk lisawickenswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 28 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
macintyrewealth.co.uk macintyrewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 19 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
macleodandmaccallumwm.co.uk macleodandmaccallumwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 68 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
marclbennett.co.uk marclbennett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
michellesheppard.co.uk michellesheppard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 15 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
minsterwealthmanagement.co.uk minsterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mitchellwm.co.uk mitchellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
moorewealth.co.uk moorewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 65 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
moorgatefp.co.uk moorgatefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 68 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
nathanind.co.uk nathanind.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 30 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
norfolkwealthmanagement.co.uk norfolkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
nowfinancial.co.uk nowfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 340 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
npfc.co.uk npfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 43 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rbawealthmanagement.com rbawealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
parkswm.co.uk parkswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pcfinancialplanning.com pcfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
petergavin.net petergavin.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 May 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
peterhardingwm.co.uk peterhardingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
poolegrahamwc.co.uk poolegrahamwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 35 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
portbrae.co.uk portbrae.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 35 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
ridlandwealth.co.uk ridlandwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rmwmllp.co.uk rmwmllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
roburwm.co.uk roburwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rppw.co.uk rppw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
scharpwm.co.uk scharpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
afswm.co.uk afswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 107 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
seifertdunk.co.uk seifertdunk.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 51 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
smtwealth.co.uk smtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 300 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stephendawsonfp.co.uk stephendawsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 74 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
suepickeringwealth.co.uk suepickeringwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sycamorealliance.com sycamorealliance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
timmswealthmanagement.co.uk timmswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 315 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
tinaowenfp.co.uk tinaowenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
barnesrobertson.com barnesrobertson.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
tpcwealth.co.uk tpcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2023 1 year, 218 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
bedfordwm.co.uk bedfordwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
beechcroftwm.co.uk beechcroftwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
trbarbour.co.uk trbarbour.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
trowlockwm.co.uk trowlockwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 316 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
vcpc.co.uk vcpc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
wellsandcompanywm.co.uk wellsandcompanywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 346 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
whitehousefm.co.uk whitehousefm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 195 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
whitelockfinancialplanning.co.uk whitelockfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 132 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
whitfieldwealth.co.uk whitfieldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Oct 2020 Oct 2020 17 days
wickenswealthmanagement.co.uk wickenswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
willgrace.co.uk willgrace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 1 year, 11 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Sep 2020 66 days
bullwm.co.uk bullwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 49 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
chasebridgewm.co.uk chasebridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2024 2 years, 349 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
coulterweir.co.uk coulterweir.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davidbeanwealth.co.uk davidbeanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2024 2 years, 348 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
deanstevenswm.co.uk deanstevenswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
easternwealth.co.uk easternwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
eatlywm.co.uk eatlywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 346 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
experiumfinancialservices.co.uk experiumfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 41 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
hartyltd.co.uk hartyltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
irpwealth.co.uk irpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Apr 2021 Jun 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
iwmwealth.co.uk iwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 331 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 103 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jenkinsandcofm.co.uk jenkinsandcofm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kimdevinefp.co.uk kimdevinefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 35 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
joybarden.co.uk joybarden.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
keithwilliamsfinancial.co.uk keithwilliamsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
kenbinniefinancialltd.co.uk kenbinniefinancialltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
leemerrettwealthmanagement.co.uk leemerrettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 181 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
leonardwealthsolutions.co.uk leonardwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
lettswealthmanagement.co.uk lettswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mandyknox.co.uk mandyknox.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 325 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-TJPPJ8 Aug 2020 Aug 2020 One Off
miwealth.co.uk miwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
moifc.co.uk moifc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
rectorygreenfs.co.uk rectorygreenfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
oliverreeve.co.uk oliverreeve.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
patrickwardconsulting.co.uk patrickwardconsulting.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pbfwm.co.uk pbfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pfpwealth.co.uk pfpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
polarisfp.co.uk polarisfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2023 1 year, 208 days
GTM GTM-58PXN8T Mar 2021 May 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pricefp.co.uk pricefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 35 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
provestfs.co.uk provestfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 314 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rhodesbrook.co.uk rhodesbrook.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
ridley-jones.co.uk ridley-jones.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 315 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
scottsymeswm.co.uk scottsymeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sjbettridgefp.co.uk sjbettridgefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 53 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sjpp.asia sjpp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 May 2021 88 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sldwealth.co.uk sldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
anglianwealthmanagement.co.uk anglianwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
solosywm.co.uk solosywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 55 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
andrewspillane.co.uk andrewspillane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 10 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewtodd-sjp.co.uk andrewtodd-sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sussexwealthmanagement.com sussexwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
swannfinancial.co.uk swannfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
templemewswm.co.uk templemewswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2024 2 years, 155 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
avantiwm.co.uk avantiwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 63 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
ayeshakhanfinancialplanning.co.uk ayeshakhanfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
themjp.co.uk themjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
thompsonfinancialplanning.co.uk thompsonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 315 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
threehillswealth.co.uk threehillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
bassantfs.co.uk bassantfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
berkeleystjames-wm.co.uk berkeleystjames-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
walbrookfinancial.co.uk walbrookfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
bromileyandpartners.co.uk bromileyandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 131 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
willsfinancial.co.uk willsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
willgrasscornishwealthmanagement.co.uk willgrasscornishwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
cassidyfinancial.co.uk cassidyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
darrenford.co.uk darrenford.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
davidmasonfp.com davidmasonfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
davidsonpert.co.uk davidsonpert.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 197 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dmbwealthmanagement.co.uk dmbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dpfinplan.com dpfinplan.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ellisonedwardswm.co.uk ellisonedwardswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 194 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gallimorewealthmanagement.co.uk gallimorewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
gayworrow.co.uk gayworrow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
hawthornewealthmanagement.com hawthornewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
ifswealth.co.uk ifswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 29 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
illingworthseddon.co.uk illingworthseddon.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 46 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
iqandco.com iqandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 336 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 103 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jlwealthconsultancy.co.uk jlwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jonathanjgibbons.co.uk jonathanjgibbons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
rcwealthmanagement.co.uk rcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
reedmanwm.co.uk reedmanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
reeffc.com reeffc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
robertapugh.co.uk robertapugh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 311 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rwafp.com rwafp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
schoolfeessolutions.co.uk schoolfeessolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
scottwallace.co.uk scottwallace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
scrivenerfinancial.co.uk scrivenerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 41 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
shubhokunduwm.co.uk shubhokunduwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 53 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 42 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
southdownsfp.co.uk southdownsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 283 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
arw-wm.com arw-wm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stefaniepricewealth.co.uk stefaniepricewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
abacuswm.co.uk abacuswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
carpenterwealthmanagement.co.uk carpenterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 102 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
tailoredsolutionswm.co.uk tailoredsolutionswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 340 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
throgmortonassociates.co.uk throgmortonassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
batchworthwealth.co.uk batchworthwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
bathwealth.co.uk bathwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
whitepeakwm.co.uk whitepeakwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
bryantassociates.co.uk bryantassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
callumleachwm.co.uk callumleachwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2023 1 year, 259 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
cedarvalegroup.co.uk cedarvalegroup.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 56 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
cmjfinancialplanning.co.uk cmjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 294 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
curzonwm.com curzonwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 49 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
davidjwalsh.co.uk davidjwalsh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
dominicmarcus.co.uk dominicmarcus.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 45 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
doweswealthmanagement.co.uk doweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2024 2 years, 348 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
dsmcdermottfinancialplanning.co.uk dsmcdermottfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
edenwoodwealth.com edenwoodwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
edmundwilson.co.uk edmundwilson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
elliottwealthmanagement.co.uk elliottwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
enverwm.co.uk enverwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
firmitasfs.co.uk firmitasfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
foremostfinancial.net foremostfinancial.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 39 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 86 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
frankmcmillan.co.uk frankmcmillan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 38 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
garryjohnsonwealthmanagement.co.uk garryjohnsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
garymorrisonwm.co.uk garymorrisonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
gcadurham.co.uk gcadurham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hayeswealthmanagement.co.uk hayeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gildedwealth.co.uk gildedwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 36 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
guildfordfinancial.co.uk guildfordfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
hampshirefinancialplanning.co.uk hampshirefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 42 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
horizonwealthconsultancy.co.uk horizonwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
impactwm.co.uk impactwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2024 2 years, 350 days
GTM GTM-58PXN8T May 2021 Jun 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jacquinorman.co.uk jacquinorman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 27 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 103 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jennerwm.co.uk jennerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jonathangrantwealth.co.uk jonathangrantwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jpnfinancial.co.uk jpnfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 299 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
keystonefinancial.co.uk keystonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kirbyknott.co.uk kirbyknott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 148 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
lesterbrunt.co.uk lesterbrunt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 328 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
lizmaudsleyfinancialplanning.co.uk lizmaudsleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 99 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mbwwealthmanagement.co.uk mbwwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mellingfp.co.uk mellingfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
meridianadvice.co.uk meridianadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
mwcarefeesadvice.co.uk mwcarefeesadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2022 274 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 30 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
nigelcookewm.co.uk nigelcookewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
oakridge-partners.co.uk oakridge-partners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 70 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
oreillywealthmanagement.co.uk oreillywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 41 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T May 2021 May 2021 One Off
richardjdavies.co.uk richardjdavies.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
richardmarshall.co.uk richardmarshall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pdfinancialmanagement.co.uk pdfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
penninewealthmanagement.co.uk penninewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pjwwealth.co.uk pjwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
primusfinancial.co.uk primusfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 35 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
priorywealthmanagement.co.uk priorywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 256 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
prosperawealth.co.uk prosperawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
puxleypartnership.co.uk puxleypartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rachaelbellwealthmanagement.co.uk rachaelbellwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 310 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
randallwm.co.uk randallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
richardbrewster.co.uk richardbrewster.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rmbfc.co.uk rmbfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
abbeywealthmanagement.co.uk abbeywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
roseassociatesfp.co.uk roseassociatesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rppw.sg rppw.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rsrobertsonfp.co.uk rsrobertsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 258 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
rtwwealth.co.uk rtwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
accessionrwm.co.uk accessionrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sarahmhughes.co.uk sarahmhughes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 258 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 40 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
alpewealthmanagement.co.uk alpewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 106 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
allenfinancial.co.uk allenfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 66 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
simonlipp.co.uk simonlipp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 53 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sneddonfp.co.uk sneddonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 348 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
spillaneandcompany.co.uk spillaneandcompany.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 56 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
apexfinancialservices.co.uk apexfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
stanleyfinancial.co.uk stanleyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 56 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stilgoefm.co.uk stilgoefm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stwwealth.co.uk stwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 260 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
atlanticwealth.co.uk atlanticwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 139 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 104 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
aagwealthmanagement.co.uk aagwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
thindwealthadvisory.co.uk thindwealthadvisory.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 264 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
thomaswealthadvisory.co.uk thomaswealthadvisory.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 315 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
thomlinsonwealthmanagement.co.uk thomlinsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
trevorngraham.co.uk trevorngraham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 316 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
virtuewealthsolutions.co.uk virtuewealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 70 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
westbrookfs.co.uk westbrookfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
westgatewealth.co.uk westgatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
whitewm.co.uk whitewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
willgcunningham.co.uk willgcunningham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 318 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
capitalplanningpartners.co.uk capitalplanningpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
capitolfinancial.co.uk capitolfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 102 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
GTM GTM-W2ZFB5N Aug 2021 Aug 2021 One Off
capstone-financial.co.uk capstone-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 10 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
craigjameswm.co.uk craigjameswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 24 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
danielburnswm.co.uk danielburnswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 123 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
darronchildspractice.co.uk darronchildspractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 8 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
davidkeddie.co.uk davidkeddie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
edwardjowilson.co.uk edwardjowilson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
ejwm.co.uk ejwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 92 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
fisherwealthconsultancy.co.uk fisherwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 9 days
flynnwealthmanagement.co.uk flynnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
garywalker.co.uk garywalker.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
gdcfinancialadvisers.co.uk gdcfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 84 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
germainfinancial.co.uk germainfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 111 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
gilsongrayfinancial.co.uk gilsongrayfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 36 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 109 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
grovewoodwealth.co.uk grovewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
hydewealthmanagement.co.uk hydewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
invictuswealth.co.uk invictuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 28 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
iptucker.co.uk iptucker.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 28 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jamescurriefinancialsolutions.co.uk jamescurriefinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 May 2021 87 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
jamestrickett.co.uk jamestrickett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
kgrwealth.co.uk kgrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 162 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
lambert-wealth.co.uk lambert-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2024 2 years, 348 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 100 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
liztuccy.co.uk liztuccy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ljwealthmanagement.co.uk ljwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T May 2021 Jun 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
lombardprivateclients.co.uk lombardprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 55 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
louisewarland.co.uk louisewarland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2024 2 years, 173 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 58 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
magorwealthmanagement.co.uk magorwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 213 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
markkidd.co.uk markkidd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
GTM GTM-58PXN8T Mar 2021 May 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mayflowerfinancialplanning.co.uk mayflowerfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 249 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mccuewealthmanagement.co.uk mccuewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
mercerandassociates.co.uk mercerandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 113 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mikestarkeywealthmanagement.co.uk mikestarkeywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
modus-wealth.co.uk modus-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
napierlane.com napierlane.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 30 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
newmanlangley.co.uk newmanlangley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pathwaywealthmanagement.co.uk pathwaywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Mar 2021 May 2021 40 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pellegriniandbarlowassociates.co.uk pellegriniandbarlowassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
poundburywealth.co.uk poundburywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 35 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
probertwealthmanagement.co.uk probertwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
psgwealth.co.uk psgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
quantumprivateclients.co.uk quantumprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 335 days
GTM GTM-58PXN8T Mar 2021 May 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
quaysidewealthmanagement.co.uk quaysidewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
ldbwealth.co.uk ldbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
legacywealth.sg legacywealth.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
lifetimeconnections.co.uk lifetimeconnections.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
lpwealth.co.uk lpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 25 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mansionhousefp.co.uk mansionhousefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
marionsiddall.co.uk marionsiddall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 234 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 26 days
mastersfinancial.co.uk mastersfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
neathercoat.com neathercoat.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
oakdalefinancialservices.co.uk oakdalefinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
olcotelappin.co.uk olcotelappin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
oliverwronski.co.uk oliverwronski.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2022 1 year, 85 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
one-wealth.co.uk one-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 311 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 32 days
orangetreewm.co.uk orangetreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 163 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 32 days
pentelow-wealth-management.co.uk pentelow-wealth-management.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
pricewhitinghodgson.co.uk pricewhitinghodgson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2023 1 year, 211 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
priteshpankhania.co.uk priteshpankhania.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
renoufwmltd.co.uk renoufwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rhiannongoghfp.co.uk rhiannongoghfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
robinson-porteous.co.uk robinson-porteous.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
robinsonwealth.co.uk robinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
bruceandassociates.co.uk bruceandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sandafinancialservice.com sandafinancialservice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 40 days
mgwealth.co.uk mgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 63 days
selectinvestors.hk selectinvestors.hk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Apr 2022 173 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sevenhillswealth.co.uk sevenhillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 51 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
shiptonwealth.co.uk shiptonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 52 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
amwm.co.uk amwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 140 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sjp.co.uk sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
andrewwhiting.co.uk andrewwhiting.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 10 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
spillaneassociates.co.uk spillaneassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 56 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
srbwm.co.uk srbwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 56 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stroudwm.co.uk stroudwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 340 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
templecloudwm.co.uk templecloudwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2022 283 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
thetdp.co.uk thetdp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 128 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
thomashallwm.co.uk thomashallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2022 1 year, 95 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
tim-watts.co.uk tim-watts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 315 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
timramptonwealthmanagement.com timramptonwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 320 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
tmpwealthmanagement.co.uk tmpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
beyondwm.co.uk beyondwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
blakebrooke.co.uk blakebrooke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 60 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
vickykleboe.co.uk vickykleboe.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 131 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
walkerwm.co.uk walkerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
wbwealth.co.uk wbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
wdwealth.co.uk wdwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
wealthandfinancematterslimited.co.uk wealthandfinancematterslimited.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
brecklandfinancialmanagement.co.uk brecklandfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
brewsterfinancialplanning.co.uk brewsterfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
westwealthmanagement.co.uk westwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 301 days
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
bsjfinancialplanning.co.uk bsjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 1 year, 10 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 2 days
calderwealthmanagement.co.uk calderwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 335 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 74 days
charlottepoolegraham.co.uk charlottepoolegraham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 54 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
clearwaterwm.co.uk clearwaterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 52 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
douglasrowefs.co.uk douglasrowefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 45 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
frizzellwm.co.uk frizzellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 38 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 85 days
graywealth.co.uk graywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 41 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
hallwealth.co.uk hallwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 15 days
huntminaswm.co.uk huntminaswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 280 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
iccwealthmanagement.co.uk iccwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Apr 2023 1 year, 138 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 105 days
jennymoloney.co.uk jennymoloney.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
johncharper.co.uk johncharper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 21 days
klcfinancial.co.uk klcfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 23 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
kmcwealthmanagement.co.uk kmcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 23 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
kingsforestwealth.co.uk kingsforestwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
klafp.co.uk klafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 23 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
leowealth.co.uk leowealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
lfp.co.uk lfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
lockwoodwealth.co.uk lockwoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 326 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
markingarfield.co.uk markingarfield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 26 days
matthewwilkeswealthmanagement.co.uk matthewwilkeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mbjj.co.uk mbjj.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 27 days
moranwealthmanagement.co.uk moranwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 28 days
ninewealth.co.uk ninewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 37 days
odellwealth.com odellwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
redoakwealth.co.uk redoakwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2022 1 year, 88 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 37 days
regencywealthltd.co.uk regencywealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 240 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
pdprivateclient.co.uk pdprivateclient.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 33 days
prestfieldwm.co.uk prestfieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
prjfinancialplanning.co.uk prjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
pswm.co.uk pswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 130 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
pwmni.co.uk pwmni.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rherbert.co.uk rherbert.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
richardpaddle.com richardpaddle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
rjfinancialplanning.co.uk rjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rogerswealthmanagement.co.uk rogerswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 344 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rossmitchellwm.com rossmitchellwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
russellfairbrass.co.uk russellfairbrass.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
ruthhomberger.co.uk ruthhomberger.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 40 days
bowbrookfp.co.uk bowbrookfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
adamjameswm.co.uk adamjameswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
samuelsfinancial.co.uk samuelsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
saragray.co.uk saragray.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sarahquirkassociates.co.uk sarahquirkassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sarahsiddons.co.uk sarahsiddons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 126 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
allardwhiteley.co.uk allardwhiteley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jul 2023 1 year, 261 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sharpfs.co.uk sharpfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 70 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 42 days
sheebapadman.co.uk sheebapadman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2023 1 year, 338 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 42 days
simonroffey.co.uk simonroffey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 53 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
deptagency.com sjp-partner-nginx-prd-asia.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 70 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 113 days
amgwealthmanagement.com amgwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 10 days
sleightwm.co.uk sleightwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
anthonyanderson.co.uk anthonyanderson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 60 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
smithhobbswealth.co.uk smithhobbswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
solentwealth.co.uk solentwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2022 208 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
andrewhugheswm.co.uk andrewhugheswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
speightwealthmanagement.co.uk speightwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 56 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
spwealth.co.uk spwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 244 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
sterlingfa.co.uk sterlingfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 313 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
sterlingsolutionsltd.co.uk sterlingsolutionsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stevejoyce.co.uk stevejoyce.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
GTM GTM-TJPPJ8 Aug 2020 Aug 2020 One Off
stringermann.com stringermann.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 58 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
swhfp.co.uk swhfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 305 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
swiftsurewealthmanagement.co.uk swiftsurewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 59 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
tandhfinancialplanning.co.uk tandhfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 171 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 63 days
avocetwealth.co.uk avocetwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 6 days
avonwoodfinancialplanning.co.uk avonwoodfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 339 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
theplattpartnership.com theplattpartnership.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
thompstonewm.co.uk thompstonewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2022 1 year, 95 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
tywm.co.uk tywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 99 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
victoredmonds.co.uk victoredmonds.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 52 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
victoria-lawson.co.uk victoria-lawson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 109 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
vtwealth.co.uk vtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 71 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
wallwm.co.uk wallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2023 1 year, 304 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
wardwealthmanagement.co.uk wardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
watersdaywm.co.uk watersdaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
btmwealth.co.uk btmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
willgrasswealthmanagement.co.uk willgrasswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
williamsandassociatesfa.co.uk williamsandassociatesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 195 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
carringtonbond.co.uk carringtonbond.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2022 1 year, 7 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
zenithfinancial.co.uk zenithfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
crusewealth.com crusewealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 4 days
frcfinancialplanning.co.uk frcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2024 2 years, 127 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
hargreaveswealth.co.uk hargreaveswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
hillcrestwm.co.uk hillcrestwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 107 days
ianbellwm.co.uk ianbellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
ingramwealthmanagement.co.uk ingramwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 29 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
joethomas.info joethomas.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2023 2 years, 102 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
rcawealth.co.uk rcawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
robertpilnick.co.uk robertpilnick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rollowm.co.uk rollowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rosspenman.co.uk rosspenman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 282 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rozsimcockwealthmanagement.co.uk rozsimcockwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 68 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
rsr-wm.co.uk rsr-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
russellpikefinancial.co.uk russellpikefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 40 days
salterwm.co.uk salterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
samuellukeswm.co.uk samuellukeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sandgatewealth.co.uk sandgatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 185 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sarahbuckwealthmanagement.co.uk sarahbuckwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 311 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
advisorycube.co.uk advisorycube.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 192 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
selectinvestors.sg selectinvestors.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 347 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
deptagency.com sjp-partner-nginx-prd.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 70 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 113 days
sjpfoundation.co.uk sjpfoundation.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 67 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
antlerwealth.com antlerwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 170 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
apwealth.co.uk apwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 64 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
srjwm.co.uk srjwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
sterlingwealthmanagement.co.uk sterlingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 318 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stevenheyes.co.uk stevenheyes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 313 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
storercfp.co.uk storercfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
avonwoodfinancialplanning.com avonwoodfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jul 2022 339 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
avonwoodfinancialplanning.uk avonwoodfinancialplanning.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
GTM GTM-W2ZFB5N Aug 2021 Aug 2021 One Off
awwealth.co.uk awwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 1 day
thegroveprivatewealthltd.co.uk thegroveprivatewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 315 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
thinkfinancialwealthmanagement.co.uk thinkfinancialwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 268 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
thomas-rigg.co.uk thomas-rigg.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 315 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
tomricketts.co.uk tomricketts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 245 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
birchwealthmanagement.co.uk birchwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
GTM GTM-W2ZFB5N Aug 2021 Aug 2021 One Off
vibrantwealthmanagement.co.uk vibrantwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 70 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
vswealth.co.uk vswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 71 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
bridgegatewm.co.uk bridgegatewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
whitepeakwm.uk whitepeakwm.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 82 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
calderwoodswm.co.uk calderwoodswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 56 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
catherinerichardson.co.uk catherinerichardson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 11 days
chartsmorewealthltd.co.uk chartsmorewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 55 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cheshirelifestyle.com cheshirelifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 41 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
clachanviewwm.co.uk clachanviewwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 52 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
claremont-financial.co.uk claremont-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 53 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cogentfinancial.co.uk cogentfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
demellowandco.com demellowandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
eawealth.co.uk eawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
gardnerwealthmanagement.co.uk gardnerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
hayesfinancialplanning.com hayesfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
glencastlefs.co.uk glencastlefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 36 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
gqwm.co.uk gqwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 35 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
gregjmiddleton.co.uk gregjmiddleton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
hartfordwealth.co.uk hartfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 357 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
jacksonfinancial.co.uk jacksonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2024 2 years, 230 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jeremybarrett.co.uk jeremybarrett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 20 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jonpittey.co.uk jonpittey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 238 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
julianspencerwm.co.uk julianspencerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 22 days
lionbridgewealth.co.uk lionbridgewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2023 2 years, 69 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
lisaeveritt.co.uk lisaeveritt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 21 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
ltcsolutionsltd.co.uk ltcsolutionsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jun 2022 74 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
marknieldwm.co.uk marknieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 26 days
marquewealth.co.uk marquewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 26 days
matthewgreenhalgh.co.uk matthewgreenhalgh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mbarclay.co.uk mbarclay.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
mglwealthmanagement.co.uk mglwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 27 days
mooreforwealth.co.uk mooreforwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 30 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
njwealthplanning.co.uk njwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rickettsfp.co.uk rickettsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
perowealthmanagement.co.uk perowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 34 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
ptrembeth.co.uk ptrembeth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 43 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
rajivprabhakar.co.uk rajivprabhakar.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 183 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 36 days
richardcbooth.co.uk richardcbooth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rodneyspillerwm.co.uk rodneyspillerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
acjordanwealthmanagement.co.uk acjordanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2022 245 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
ryleywm.co.uk ryleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2022 1 year, 47 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
samrawm.co.uk samrawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
scottjamesandassociates.co.uk scottjamesandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 50 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
shaunajhappan.co.uk shaunajhappan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 51 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
alfristonwealth.co.uk alfristonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 277 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
simonbraywm.co.uk simonbraywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
silvertreewm.co.uk silvertreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 53 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
smithjackson.co.uk smithjackson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 54 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 122 days
carterlane.co.uk carterlane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 58 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
steggleswm.co.uk steggleswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 43 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stevensonwealthplanning.co.uk stevensonwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 134 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stricklandwealthmanagement.co.uk stricklandwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
stuartdavieswealthconsultancy.co.uk stuartdavieswealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 58 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sutherlandmayfairwm.co.uk sutherlandmayfairwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
GTM GTM-W2ZFB5N Dec 2021 Dec 2021 One Off
swindonfinancialservices.com swindonfinancialservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 60 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
tarnwealthmanagement.co.uk tarnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
tcolleyassociates.co.uk tcolleyassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 60 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 44 days
avfp.co.uk avfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
GTM GTM-W2ZFB5N Aug 2021 Aug 2021 One Off
avonwoodfinancial.com avonwoodfinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
avonwoodfinancial.uk avonwoodfinancial.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
GTM GTM-W2ZFB5N Aug 2021 Aug 2021 One Off
baggermanwm.co.uk baggermanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
towerhousewm.co.uk towerhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 65 days
GTM GTM-58PXN8T May 2021 Jun 2021 9 days
treskelionfp.co.uk treskelionfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2024 2 years, 217 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
villageestatesfc.co.uk villageestatesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 70 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
wadewealthmanagement.co.uk wadewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 141 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
waltierwealthmanagement.co.uk waltierwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 72 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
boundstonewm.co.uk boundstonewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 9 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
whcfp.co.uk whcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
whitfeldfinancialplanning.co.uk whitfeldfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
whittowwilliamswalkerllp.co.uk whittowwilliamswalkerllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 116 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
brightsidewealthmanagement.co.uk brightsidewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
williamsbirley.co.uk williamsbirley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 356 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 111 days
chrishillsfc.co.uk chrishillsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 54 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
coleridgewm.co.uk coleridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
consiliumwmltd.co.uk consiliumwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 99 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
equinoxfinancialplanning.co.uk equinoxfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
havenwealthmanagement.co.uk havenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 281 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
hearndenandwestonwm.co.uk hearndenandwestonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
hemmensfinancial.co.uk hemmensfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2023 2 years, 39 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 107 days
howefinancialadvisers.co.uk howefinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
ianhuntwm.co.uk ianhuntwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
jamesbarnett.co.uk jamesbarnett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2024 2 years, 122 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 29 days
kevinmunrofp.co.uk kevinmunrofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
kpwoodandassociates.co.uk kpwoodandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 23 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
littlewickwealthmanagement.co.uk littlewickwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 24 days
maclennanwealth.co.uk maclennanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 19 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
mandyrodgers.co.uk mandyrodgers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 104 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
markproberts.co.uk markproberts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mcleanandpartnerswm.co.uk mcleanandpartnerswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 27 days
millfieldwm.com millfieldwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
nigelhelen.co.uk nigelhelen.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 31 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
oloughlinandco.co.uk oloughlinandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 108 days
palmerwealth.co.uk palmerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 308 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 33 days
sjp.asia partnership.sjp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 104 days
sjp.co.uk partnership.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
paulabicknellwealth.co.uk paulabicknellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 33 days
pdavisfinancial.co.uk pdavisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
GTM GTM-58PXN8T Feb 2021 May 2021 74 days
pfpswm.com pfpswm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
queenssquarewealth.co.uk queenssquarewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 256 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
reeswealthmanagement.co.uk reeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
ksfinancialadvisers.co.uk ksfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 206 days
kwmfp.co.uk kwmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2024 2 years, 129 days
lansdownplace.co.uk lansdownplace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 69 days
lauriefp.co.uk lauriefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2023 175 days
legatumwealthmanagement.co.uk legatumwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 May 2024 2 years, 6 days
lewingtonwealth.co.uk lewingtonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Oct 2024 2 years, 243 days
linkswealthmanagement.co.uk linkswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 38 days
malcolmgibsonwealthmanagement.co.uk malcolmgibsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Oct 2024 1 year, 237 days
lochranzawealth.co.uk lochranzawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2024 Oct 2024 134 days
loswealth.co.uk loswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 20 days
mackiewealthmanagement.co.uk mackiewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
macphail-kennedy.co.uk macphail-kennedy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 131 days
malikzadafp.co.uk malikzadafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Oct 2024 2 years, 61 days
markgolesworthy.co.uk markgolesworthy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 17 days
mbfinancial-planning.co.uk mbfinancial-planning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jun 2023 One Off
mdslackwealthmanagement.co.uk mdslackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Oct 2024 2 years, 32 days
middletonfp.co.uk middletonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
milnewealth.co.uk milnewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Oct 2024 325 days
mjwsjp.co.uk mjwsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
monteaglewm.co.uk monteaglewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 1 year, 355 days
mrfinancial.info mrfinancial.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
mulberrytreewealth.co.uk mulberrytreewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 34 days
municipalfp.co.uk municipalfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 34 days
neilmorrisfinancial.co.uk neilmorrisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 240 days
centurywealthmanagement.co.uk centurywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 10 days
maplewoodwealth.co.uk maplewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 190 days
northwealthmanagement.co.uk northwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2024 2 years, 286 days
npswealth.co.uk npswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
marcnorris.co.uk marcnorris.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
oaktreefinancial.asia oaktreefinancial.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
ockendenfp.co.uk ockendenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 125 days
ocswealthmanagement.co.uk ocswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
oliverwm.co.uk oliverwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Feb 2023 1 year, 145 days
opawealthmanagement.co.uk opawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
markeldor.co.uk markeldor.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Oct 2024 1 year, 237 days
orchardfinancialassociates.co.uk orchardfinancialassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2024 1 year, 7 days
paulgschofield.co.uk paulgschofield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
paulmwilliams.co.uk paulmwilliams.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
peakfifteenfp.co.uk peakfifteenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2024 1 year, 200 days
peakpf.co.uk peakpf.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 20 days
pennygatefinancialassociates.co.uk pennygatefinancialassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2024 1 year, 321 days
philippotterwealth.co.uk philippotterwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 344 days
markpattersonfp.co.uk markpattersonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 316 days
quartzfinancialplanning.co.uk quartzfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Sep 2024 279 days
quaylifewm.co.uk quaylifewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2024 2 years, 217 days
reddingswm.co.uk reddingswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
rhodianwm.co.uk rhodianwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
richardtidy.co.uk richardtidy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2024 2 years, 96 days
rickardsfinancialplanning.com rickardsfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 1 day
abacuswealthservices.co.uk abacuswealthservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 47 days
robertshawsidlow-wealth.co.uk robertshawsidlow-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
robinsonfp.co.uk robinsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
rodgersfamilywealth.co.uk rodgersfamilywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2024 1 year, 211 days
abfinancialplanning.co.uk abfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 15 days
bwfinancialplanning.co.uk bwfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 2 years, 8 days
rubywealth.co.uk rubywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
bullferguson.co.uk bullferguson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Oct 2024 332 days
adnfp.co.uk adnfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 299 days
agilepensions.uk agilepensions.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 May 2024 305 days
schofieldassociatesfp.co.uk schofieldassociatesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 50 days
sdhandawealthmanagement.co.uk sdhandawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2024 2 years, 292 days
ahwm.co.uk ahwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 291 days
seandownswealthmanagement.co.uk seandownswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 50 days
searlesfinancial.co.uk searlesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
selectinvestors.asia selectinvestors.asia
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
shenleyprivatewealth.co.uk shenleyprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 52 days
sjp.co.uk alumni.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2022 1 year, 91 days
machanwealthmanagement.co.uk machanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 37 days
silverdomefinancial.co.uk silverdomefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2023 2 years, 133 days
skeltons.co.uk skeltons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2024 2 years, 187 days
deptagency.com sjp-partner-nginx-stg.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 187 days
deptagency.com sjp-partner-nginx-uat.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Apr 2024 One Off
antaris.asia antaris.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2024 Oct 2024 94 days
capriwealth.co.uk capriwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 181 days
snwfinancialplanning.co.uk snwfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 10 days
solastawm.co.uk solastawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2024 1 year, 82 days
solebayfp.co.uk solebayfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Sep 2024 324 days
andrewdaldrywm.co.uk andrewdaldrywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 221 days
andrewpaynewm.co.uk andrewpaynewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 5 days
andrewvarleyfinancialplanning.co.uk andrewvarleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 5 days
spirewealth.co.uk spirewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 56 days
springwealth.co.uk springwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2024 2 years, 272 days
srmfinancial.co.uk srmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2024 2 years, 78 days
stanfordwealth.co.uk stanfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2024 363 days
steeleaspire.co.uk steeleaspire.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2024 1 year, 253 days
steelewealthmanagement.co.uk steelewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
stephenkingwealthmanagement.co.uk stephenkingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 11 days
stephenpitcher.co.uk stephenpitcher.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
stephensonfp.co.uk stephensonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
sullivanwealthmanagement.co.uk sullivanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 170 days
swanwealthmanagement.co.uk swanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2024 1 year, 209 days
careyandcofinancialsolutions.co.uk careyandcofinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 181 days
swindonfinancialadvisers.uk swindonfinancialadvisers.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 60 days
swindonfinancialservices.co.uk swindonfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 59 days
swindonfinancialservices.uk swindonfinancialservices.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 60 days
taffetsaufferwm.co.uk taffetsaufferwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 60 days
aswwm.co.uk aswwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 6 days
tarporleywealth.co.uk tarporleywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2024 2 years, 181 days
aureliaprivatewealth.co.uk aureliaprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 183 days
templemewsfp.co.uk templemewsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 236 days
terryhartley.co.uk terryhartley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
averywealthmanagement.co.uk averywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 6 days
awfwm.co.uk awfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
thederouetpartnership.co.uk thederouetpartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 350 days
thestrainpractice.co.uk thestrainpractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
bainfa.co.uk bainfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 286 days
thompsonnorburyfinancialplanning.co.uk thompsonnorburyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Oct 2023 1 year, 53 days
tmcfc.co.uk tmcfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Jun 2024 1 year, 262 days
beaconfp.co.uk beaconfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 May 2024 261 days
towcester-fp.co.uk towcester-fp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Jun 2024 218 days
benhiles.co.uk benhiles.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 207 days
truitywealth.co.uk truitywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jun 2024 2 years, 70 days
tsfinancialplanning.co.uk tsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 48 days
ubuntuwealthmanagement.co.uk ubuntuwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 May 2023 296 days
beverleyfinancialmanagement.co.uk beverleyfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
bhwml.com bhwml.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Feb 2022 171 days
unaking.co.uk unaking.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 256 days
vfcwealthmanagement.co.uk vfcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 188 days
vinewealth.co.uk vinewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 222 days
blythswood.com blythswood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Oct 2024 2 years, 96 days
walfordwealth.co.uk walfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 110 days
bradnickwealth.co.uk bradnickwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 11 days
bredonhillwm.co.uk bredonhillwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 234 days
whistonwealth.com whistonwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 225 days
willcoxwealthmanagement.co.uk willcoxwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jul 2023 1 year, 96 days
rafflesplaceprivatewealth.com rafflesplaceprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
wylliewealth.co.uk wylliewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 134 days
calderwoodfinancial.co.uk calderwoodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 204 days
xiiim.com xiiim.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2021 One Off
cheshirewealthconsultancy.co.uk cheshirewealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 11 days
clareclarkson.co.uk clareclarkson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 294 days
colewealthmanagement.co.uk colewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Oct 2024 1 year, 329 days
cormackwealth.co.uk cormackwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 67 days
darcyfp.co.uk darcyfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2024 2 years, 62 days
dfwealthmanagement.co.uk dfwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Oct 2024 2 years, 46 days
dlwm.co.uk dlwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2022 1 year, 121 days
dowdallwealthmanagement.co.uk dowdallwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 15 days
drpwm.com drpwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 44 days
drsaqibkarim.co.uk drsaqibkarim.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
duncanmaw.co.uk duncanmaw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Aug 2022 133 days
eastgatewealthmanagementltd.co.uk eastgatewealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
edgintonstanley.co.uk edgintonstanley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 106 days
ennveefinancial.co.uk ennveefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 42 days
eonegreen.com eonegreen.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
evermore.financial evermore.financial
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Oct 2024 324 days
excavationexcavate.com excavationexcavate.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
farisnori.co.uk farisnori.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
fifteenfinancialplanning.co.uk fifteenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Oct 2024 1 year, 77 days
firmstonewealth.co.uk firmstonewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Oct 2024 1 year, 246 days
foresightfs.co.uk foresightfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 198 days
forte-financial.co.uk forte-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 39 days
fortisfinancial.co.uk fortisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Oct 2024 224 days
fortresswealthpartnership.com fortresswealthpartnership.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
fortveritaswealth.co.uk fortveritaswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Jan 2024 84 days
freddieansah.co.uk freddieansah.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
frizzellandpartners.co.uk frizzellandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
futureperfectwealthmanagement.co.uk futureperfectwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jun 2022 203 days
gewealthmanagement.co.uk gewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Oct 2024 275 days
gkbfinancialplanning.co.uk gkbfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 36 days
goldenacornfp.co.uk goldenacornfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Oct 2024 1 year, 244 days
gpfp.co.uk gpfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
grahamlavinwealthmanagement.co.uk grahamlavinwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
graysonlewis.co.uk graysonlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jun 2023 79 days
grazianolongo.co.uk grazianolongo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 63 days
greenfortpw.com greenfortpw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
gritstone-fp.co.uk gritstone-fp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 312 days
hallamwealth.co.uk hallamwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 364 days
hannonfinancialplanning.co.uk hannonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 50 days
haydnlewis.co.uk haydnlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 32 days
heideswiftfinancialplanning.co.uk heideswiftfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Oct 2024 342 days
hendredfinancialpartners.co.uk hendredfinancialpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
heyesassociates.co.uk heyesassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 2 days
hipstagram.com hipstagram.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
hoadley-financial.co.uk hoadley-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 284 days
holmesfinancialplanning.co.uk holmesfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
hudsonandrogersfinancial.co.uk hudsonandrogersfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 72 days
hummingbirdprivateclients.co.uk hummingbirdprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Oct 2024 219 days
ipswichfs.co.uk ipswichfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 28 days
jameshunwickewealthmanagement.co.uk jameshunwickewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jamiecalder.co.uk jamiecalder.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jcrwealth.co.uk jcrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 113 days
jensenwealth.co.uk jensenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
jgriverwealth.co.uk jgriverwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 355 days
joebointon.co.uk joebointon.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jonesregan.co.uk jonesregan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 330 days
jopowis.co.uk jopowis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Oct 2024 2 years, 101 days
julianhoweswealthmanagement.co.uk julianhoweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
justicewealth.co.uk justicewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 280 days
karlbadrick.co.uk karlbadrick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 354 days
kathrynshearsfinancialplanning.co.uk kathrynshearsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Oct 2024 215 days
kfhwm.co.uk kfhwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 168 days
kieranfowley.co.uk kieranfowley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Oct 2024 2 years, 242 days
kinlifetimeplanning.co.uk kinlifetimeplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 161 days
mentmorefp.co.uk mentmorefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 204 days
michellegermain.co.uk michellegermain.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 351 days
monriewm.co.uk monriewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 188 days
kaplan-planwell.co.uk kaplan-planwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
keyhavenwealth.co.uk keyhavenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 28 days
keyplanwealth.co.uk keyplanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 1 year, 361 days
kneefinancialplanning.co.uk kneefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Oct 2024 267 days
knightturnerprivateclients.co.uk knightturnerprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 276 days
knightwealthmanagement.co.uk knightwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Oct 2024 267 days
krc-wealth-management.co.uk krc-wealth-management.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
lafirmasantana.com lafirmasantana.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
lawcapitalwealth.co.uk lawcapitalwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
leonnasalmon.co.uk leonnasalmon.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Oct 2024 213 days
lisacalvertfw.com lisacalvertfw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 38 days
louisemoorewealthmanagement.co.uk louisemoorewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2023 One Off
lpfinancial.co.uk lpfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2024 2 years, 194 days
lucernawealth.com lucernawealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 255 days
malcolmodonovan.co.uk malcolmodonovan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 57 days
marginsfinancialsolutions.co.uk marginsfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
marklowewm.co.uk marklowewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
markwheatleywealth.co.uk markwheatleywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2021 113 days
martastonesfm.co.uk martastonesfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 25 days
michaelkylewm.co.uk michaelkylewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
midlandswealthmanagement.co.uk midlandswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 278 days
minsterfinancialplanning.co.uk minsterfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 315 days
mjonesandco.co.uk mjonesandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
moorefinancialwellbeing.co.uk moorefinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 250 days
murfittwealth.co.uk murfittwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Oct 2024 2 years, 74 days
myleschurchill.com myleschurchill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2024 2 years, 230 days
nandsfp.co.uk nandsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2022 One Off
ncfa.uk ncfa.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 159 days
neptunefinancialmanagement.co.uk neptunefinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
nightingalewealth.co.uk nightingalewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
marathonwm.co.uk marathonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 160 days
oakwood-capital.co.uk oakwood-capital.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 125 days
oconnorwm.co.uk oconnorwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Sep 2024 173 days
onewealthltd.co.uk onewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2024 2 years, 64 days
markcosgrave.co.uk markcosgrave.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 189 days
orangetreefs.co.uk orangetreefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2024 1 year, 200 days
paulmageewealthmanagement.co.uk paulmageewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
reliancewealth.co.uk reliancewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
powerfinancialmanagement.co.uk powerfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2024 1 year, 200 days
primaryfinancialplanning.co.uk primaryfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 127 days
priteshpankhania.com priteshpankhania.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2023 2 years, 13 days
marlowwealth.co.uk marlowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Oct 2024 2 years, 239 days
richardburchnall.co.uk richardburchnall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
richardsonhewittfp.co.uk richardsonhewittfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
charterededgefp.co.uk charterededgefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 10 days
rnpwealth.co.uk rnpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2024 2 years, 290 days
robertbutler-sjp.com robertbutler-sjp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Sep 2024 228 days
robertcompton.co.uk robertcompton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
roxburghonline.co.uk roxburghonline.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 155 days
russellgreer.co.uk russellgreer.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 48 days
bradbyswm.co.uk bradbyswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 206 days
ryanmcguinnesswm.co.uk ryanmcguinnesswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 243 days
sjp-cloud.info accelerator.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 95 days
saltandlightfs.co.uk saltandlightfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Feb 2024 292 days
adeptiowm.co.uk adeptiowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 3 days
sarahmcgurkwealthmanagement.co.uk sarahmcgurkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Dec 2023 2 years, 62 days
seekerfinancial.co.uk seekerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2024 1 year, 34 days
sfwm.co.uk sfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 3 years, 3 days
shandandburnsfinancial.co.uk shandandburnsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2024 1 year, 285 days
sherpawealth.uk sherpawealth.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 250 days
allensykeswm.com allensykeswm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 4 days
albionhousewm.co.uk albionhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 111 days
mimigom.co.uk mimigom.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 250 days
siddonsand.co siddonsand.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 248 days
sigmafp.co.uk sigmafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2024 2 years, 101 days
silverlinewealth.co.uk silverlinewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 6 days
silverthornwealth.co.uk silverthornwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 53 days
sjp-cloud.info sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Sep 2024 175 days
skylarkwealth.co.uk skylarkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 312 days
andrewgrayafp.co.uk andrewgrayafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 114 days
sophiederouet.co.uk sophiederouet.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2021 73 days
southgatewm.co.uk southgatewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Sep 2024 177 days
spco.co.uk spco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
viewcreative.agency spillane.viewcreative.agency
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Sep 2024 318 days
srgwealthmanagement.co.uk srgwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2024 1 year, 82 days
arvanwealth.co.uk arvanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 289 days
steadfastwm.co.uk steadfastwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 247 days
stoneswealth.co.uk stoneswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
stowwm.co.uk stowwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
stpetersfinancialplanning.co.uk stpetersfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
adamlordwm.co.uk adamlordwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 186 days
suffolkfp.co.uk suffolkfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2022 One Off
summitfinancial.asia summitfinancial.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jun 2024 2 years, 139 days
agilelife.uk agilelife.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Oct 2024 1 year, 90 days
asmwealth.com asmwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 63 days
tedreesltd.co.uk tedreesltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
templewoodwealth.co.uk templewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 350 days
availfinancialplanning.co.uk availfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Dec 2023 1 year, 186 days
thamesvalleyfinancialplanning.co.uk thamesvalleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 236 days
thelockyerpartnership.co.uk thelockyerpartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Jun 2024 1 year, 143 days
tomworley.co.uk tomworley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
torweybridge.co.uk torweybridge.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 13 days
beaconswealth.co.uk beaconswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 183 days
truenorthfp.co.uk truenorthfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 296 days
twmfinancialplanning.co.uk twmfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 3 days
valkyriefinancialadvice.co.uk valkyriefinancialadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 295 days
vantagewm.co.uk vantagewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 303 days
vaughanwealth.co.uk vaughanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 346 days
vinetreefinancialservices.co.uk vinetreefinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 18 days
virtusfp.co.uk virtusfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 70 days
vividfp.co.uk vividfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 242 days
blueoceanwm.co.uk blueoceanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Oct 2024 200 days
walmsleyfinancialplanning.co.uk walmsleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 356 days
whfinancialwellbeing.co.uk whfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
whitehousecapital.co.uk whitehousecapital.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 189 days
wholewealth.com wholewealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 296 days
whrwealthmanagement.co.uk whrwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 337 days
brwm.org.uk brwm.org.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 125 days
woodmitchellfp.com woodmitchellfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 153 days
calderdaviswealthmanagement.co.uk calderdaviswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Jul 2024 1 year, 342 days
cambridgefinancialadvisers.co.uk cambridgefinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 125 days
carefeeadvice.co.uk carefeeadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
carrfinancialplanning.co.uk carrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 345 days
charlesjoneswealthmanagement.co.uk charlesjoneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 345 days
chwwealth.co.uk chwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 146 days
clarkwm.co.uk clarkwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 1 year, 354 days
claytonprofessionalwealth.co.uk claytonprofessionalwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 68 days
cooperassociateswm.com cooperassociateswm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
covewealth.co.uk covewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 299 days
danielgreenwm.co.uk danielgreenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
danmorganfinancialassociates.co.uk danmorganfinancialassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 175 days
darienwilliams.co.uk darienwilliams.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 65 days
darrenknibbwealthmanagement.co.uk darrenknibbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 180 days
davesouthbyfp.co.uk davesouthbyfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 179 days
davidbilantzwm.co.uk davidbilantzwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 364 days
davidjohnsonfp.co.uk davidjohnsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 14 days
davidsonfinancialplanning.co.uk davidsonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 216 days
denmanwealthmanagement.co.uk denmanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 48 days
dianacooper.co.uk dianacooper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 166 days
doweswealth.co.uk doweswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 7 days
dynamicws.co.uk dynamicws.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Oct 2024 280 days
earleywm.co.uk earleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 221 days
edwardswealth.co.uk edwardswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 227 days
edwardtrehearne.co.uk edwardtrehearne.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Oct 2024 2 years, 44 days
ellisonwealth.co.uk ellisonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 43 days
ellorawealth.co.uk ellorawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 227 days
emeraldassociates.co.uk emeraldassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 339 days
evolvefinancialplanning.co.uk evolvefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 165 days
ewartandbridgemanadvisers.co.uk ewartandbridgemanadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 362 days
ewenharris.co.uk ewenharris.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 41 days
excaliburwm.co.uk excaliburwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 160 days
familytreewealthmanagement.co.uk familytreewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Oct 2024 2 years, 248 days
farrierrose.co.uk farrierrose.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 287 days
fearndalewealth.co.uk fearndalewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 5 days
fernbankwealth.co.uk fernbankwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
financialmerrett.co.uk financialmerrett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 167 days
finessefinancialplanning.co.uk finessefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 57 days
formanwealthmanagement.co.uk formanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 39 days
formfinancialclarity.co.uk formfinancialclarity.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
macaulaywm.co.uk macaulaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 19 days
francefinancial.co.uk francefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 287 days
frontierwealth.co.uk frontierwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 159 days
futurumfa.co.uk futurumfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 180 days
gapstowwealth.co.uk gapstowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
gardnerwealthmanagement.com gardnerwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
ghfinancialsolutions.co.uk ghfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 37 days
gillespiefinancialconsultancy.com gillespiefinancialconsultancy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
greatoakfp.co.uk greatoakfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Oct 2024 2 years, 41 days
greenparkwm.com greenparkwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 53 days
greenswardfp.co.uk greenswardfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 164 days
gregorhowitt.co.uk gregorhowitt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 336 days
hamiltonpullenfp.co.uk hamiltonpullenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 364 days
hillsidefinancialplanning.co.uk hillsidefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 31 days
hjpcfp.com hjpcfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 209 days
hodgewealthmanagement.co.uk hodgewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 210 days
horshamfinancial.co.uk horshamfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Oct 2024 2 years, 136 days
huntminasfinancial.co.uk huntminasfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 72 days
integralwm.co.uk integralwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 28 days
ivanhoefp.co.uk ivanhoefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 154 days
iwplanning.com iwplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 44 days
jamesbournewm.com jamesbournewm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 27 days
jayramfinancialservices.co.uk jayramfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jenkinsfinancialpartnership.co.uk jenkinsfinancialpartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 42 days
jgriver.co jgriver.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 70 days
jmkwealthmanagement.co.uk jmkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 29 days
cordnerwealthmanagement.co.uk cordnerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 163 days
eatonwealthmanagement.co.uk eatonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Oct 2024 2 years, 141 days
gnkwealthmanagement.co.uk gnkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 2 years, 1 day
reasonwilliamspartnership.co.uk reasonwilliamspartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 257 days
rebeccabailey.co.uk rebeccabailey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 310 days
reflectfp.co.uk reflectfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
repositorywealth.co.uk repositorywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jun 2024 1 year, 53 days
brownandcofp.co.uk brownandcofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 234 days
rjvaughanwealth.co.uk rjvaughanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 39 days
rmcfp.co.uk rmcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
robingram.co.uk robingram.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Sep 2024 228 days
acwwealthmanagement.co.uk acwwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 3 days
bywaterwealth.co.uk bywaterwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 233 days
hauxwellwealthmanagement.co.uk hauxwellwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Oct 2024 2 years, 40 days
sagewm.co.uk sagewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 16 days
samuelcroudacewm.co.uk samuelcroudacewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 49 days
saxtonfp.co.uk saxtonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2024 2 years, 228 days
scottjameswealthmanagement.co.uk scottjameswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2024 2 years, 292 days
scrimgerandoakes.co.uk scrimgerandoakes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 50 days
sedgwickwm.co.uk sedgwickwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 94 days
seven-wealth.co.uk seven-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 346 days
allardwealth.co.uk allardwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 46 days
shawfieldwealthmanagement.co.uk shawfieldwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2024 1 year, 327 days
shearwoodfinancialmanagement.co.uk shearwoodfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 52 days
shireswm.co.uk shireswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 52 days
silveroakfs.co.uk silveroakfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 53 days
simplicityfp.co.uk simplicityfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 53 days
sjmfinancial.co.uk sjmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 347 days
sjp.asia sjp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 312 days
skwealthsolutions.co.uk skwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Sep 2024 136 days
autuswealth.co.uk autuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jul 2024 2 years, 94 days
antlerwealth.asia antlerwealth.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 113 days
andersonbellfinancial.co.uk andersonbellfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 290 days
srmfs.co.uk srmfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 3 years, 5 days
appartnerswealth.co.uk appartnerswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 168 days
stagwealthmanagement.co.uk stagwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Sep 2024 234 days
stellenboschfp.co.uk stellenboschfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 154 days
stephenboylewealthmanagement.co.uk stephenboylewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2024 1 year, 38 days
stephenhopewealthmanagement.com stephenhopewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
stephenhydewealthmanagement.co.uk stephenhydewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 59 days
sterlingadvice.co.uk sterlingadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
stevereeswealthmanagement.co.uk stevereeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
strakerfp.co.uk strakerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Nov 2023 1 year, 89 days
aspirelane.co.uk aspirelane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 185 days
stuartthom.co.uk stuartthom.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sullivanandcofp.co.uk sullivanandcofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2024 1 year, 208 days
swannfinancial.com swannfinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2023 2 years, 60 days
swindonfinancialadvisers.co.uk swindonfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 314 days
angieaddisonfinancial.co.uk angieaddisonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 186 days
athelisfinancial.co.uk athelisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Oct 2024 2 years, 48 days
aureliaprivatewealth.com aureliaprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 May 2024 34 days
aurorafinancialservices.co.uk aurorafinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 6 days
terencegoddardassociates.co.uk terencegoddardassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 61 days
thameswealth.co.uk thameswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2024 1 year, 283 days
axtruwealth.co.uk axtruwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2024 Oct 2024 89 days
thegrahamharmspractice.co.uk thegrahamharmspractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 62 days
bardenwealthmanagement.co.uk bardenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2023 1 year, 303 days
beaglefinancialadvice.co.uk beaglefinancialadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 12 days
trueselfwealth.co.uk trueselfwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jun 2024 2 years, 105 days
berryfinancial.co.uk berryfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
watchhousefp.co.uk watchhousefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 311 days
waymarkerfinancial.co.uk waymarkerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
wellbankwm.co.uk wellbankwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 357 days
westwellwm.co.uk westwellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-TJPPJ8 Jul 2020 Oct 2020 99 days
whittinghamprivateclients.com whittinghamprivateclients.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 190 days
wokingfinancialadviser.co.uk wokingfinancialadviser.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2024 1 year, 30 days
bullivantwealth.co.uk bullivantwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 107 days
woodwealth.co.uk woodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 One Off
wpwfinancial.co.uk wpwfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 One Off
cgafinancial.co.uk cgafinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 11 days
chapmansfinancial.co.uk chapmansfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 1 year, 1 day
christopherpughwealthmanagement.co.uk christopherpughwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 344 days
claywealth.co.uk claywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 203 days
cleevefinancialplanning.co.uk cleevefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Jan 2024 1 year, 46 days
colebridgefs.co.uk colebridgefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 41 days
compoundwealth.uk compoundwealth.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Oct 2024 2 years, 35 days
conclusiondivorce.com conclusiondivorce.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2021 One Off
coralfp.co.uk coralfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Oct 2024 1 year, 329 days
cowgillwealthmanagement.co.uk cowgillwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Oct 2024 2 years, 251 days
cpfc.org.uk cpfc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 50 days
craigcrawfordfinancial.co.uk craigcrawfordfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 May 2023 39 days
craigsaxtonwm.co.uk craigsaxtonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 122 days
creativelp.co.uk creativelp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 65 days
crossleythompson.co.uk crossleythompson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 49 days
sjp-cloud.info custom.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Nov 2023 2 years, 95 days
dalemurtenwealthmanagement.co.uk dalemurtenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 14 days
declankiely.co.uk declankiely.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Oct 2024 1 year, 328 days
destinationwealth.co.uk destinationwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 64 days
dmcfp.co.uk dmcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 161 days
dunnewealthmanagement.co.uk dunnewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Oct 2024 2 years, 141 days
dwwealthplanning.co.uk dwwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 180 days
eastlakewm.co.uk eastlakewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Oct 2024 2 years, 141 days
emilyman.com emilyman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 120 days
farrfinancialplanning.co.uk farrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 198 days
fenlandfinancialplanning.co.uk fenlandfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Oct 2024 225 days
filsellwealth.co.uk filsellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Oct 2024 2 years, 43 days
financialplanningformedics.co.uk financialplanningformedics.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
finlaywealth.co.uk finlaywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 198 days
forethoughtfinancial.co.uk forethoughtfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 337 days
fortitudewealthmanagement.co.uk fortitudewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 175 days
fskfinancialplanning.co.uk fskfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Oct 2024 1 year, 246 days
gillespiefinancial.co.uk gillespiefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 36 days
gillespiefinancialconsultancy.co.uk gillespiefinancialconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
gillespiefinancialconsultants.com gillespiefinancialconsultants.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
gittinsandco.com gittinsandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 36 days
goldenacornfp.com goldenacornfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Oct 2024 1 year, 244 days
goldreflectwm.co.uk goldreflectwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Oct 2024 222 days
grantcharlesfp.co.uk grantcharlesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 53 days
hartfp.co.uk hartfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
herfinancialplanning.co.uk herfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 48 days
hfkwealth.co.uk hfkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jan 2022 One Off
highfieldwealth.co.uk highfieldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Oct 2024 272 days
majoroakwm.co.uk majoroakwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 316 days
hsprivatewealth.co.uk hsprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
innoviawm.co.uk innoviawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 356 days
ironbarkwm.co.uk ironbarkwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 29 days
isaacwealth.co.uk isaacwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
isherwoodfinancialservices.co.uk isherwoodfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 163 days
jamesdrowley.co.uk jamesdrowley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jamesonwealthmanagement.co.uk jamesonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jamielewington.co.uk jamielewington.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2022 50 days
jasonbellissimo.co.uk jasonbellissimo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 184 days
jdcfinancialplanning.co.uk jdcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 207 days
jenkinsonwealth.co.uk jenkinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Oct 2024 2 years, 79 days
jkb-wealth.co.uk jkb-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 169 days
joannefogowm.co.uk joannefogowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
joejoblingwealthmanagement.co.uk joejoblingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
johngoldiewm.co.uk johngoldiewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
johnhomewealthmanagement.co.uk johnhomewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
johnpeoples.co.uk johnpeoples.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Feb 2022 37 days
jpwealthmanagement.co.uk jpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
kenwoodwealthmanagement.co.uk kenwoodwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
kilsaranfp.co.uk kilsaranfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
lamymanandco.co.uk lamymanandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Oct 2024 1 year, 239 days
langwealthmanagement.co.uk langwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 109 days
laurajoycewealthmanagement.co.uk laurajoycewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
lemontfp.co.uk lemontfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
libertywm.co.uk libertywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
longsandsfp.co.uk longsandsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 151 days
malcolmfrost.co.uk malcolmfrost.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mantafp.co.uk mantafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 109 days
markbeverley.co.uk markbeverley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 103 days
martaderpenska.co.uk martaderpenska.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mattimorewealth.co.uk mattimorewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 65 days
mcgarveyjones.co.uk mcgarveyjones.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 177 days
mcgillwm.co.uk mcgillwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 130 days
michaelheard.co.uk michaelheard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mjrfinancialplanning.co.uk mjrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Oct 2024 2 years, 166 days
mkm-wm.co.uk mkm-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2023 2 years, 9 days
mollamwm.co.uk mollamwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 188 days
morrinsonwealth.co.uk morrinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mwandpartners.co.uk mwandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jan 2024 290 days
naomihaynes.co.uk naomihaynes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
nauticalwealth.co.uk nauticalwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 344 days
nbwealthmanagement.co.uk nbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 39 days
ncoprivateclients.co.uk ncoprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Jan 2024 126 days
neilforeman.co.uk neilforeman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Mar 2022 236 days
nicholasbonefinancial.co.uk nicholasbonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2024 1 year, 73 days
manganfp.co.uk manganfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 352 days
norfolkwealth.co.uk norfolkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 51 days
norifinancial.co.uk norifinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
northernspire.co.uk northernspire.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 One Off
oaksmithfinancialplanning.co.uk oaksmithfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2024 2 years, 288 days
oakwaywm.co.uk oakwaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
originwm.co.uk originwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2024 2 years, 173 days
oxfordwm.co.uk oxfordwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2024 Sep 2024 98 days
oysterwealthplanning.com oysterwealthplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Sep 2024 173 days
revolutionwealth.co.uk revolutionwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
pantheonwealthpartners.co.uk pantheonwealthpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2024 1 year, 18 days
pardeepnarwal.co.uk pardeepnarwal.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 53 days
parnellfinancialmanagement.com parnellfinancialmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
richardmarshall.uk richardmarshall.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
pearsonfinancialwellbeing.co.uk pearsonfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 152 days
website-testing-link.net penrose.website-testing-link.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Jun 2024 295 days
ripplewealth.co.uk ripplewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2024 1 year, 246 days
peter-walmsley.co.uk peter-walmsley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Mar 2021 34 days
peterallensjp.co.uk peterallensjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
petrichorfinancialsolutions.com petrichorfinancialsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2024 1 year, 243 days
philipblackwealthmanagement.co.uk philipblackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2024 1 year, 362 days
placidgonzales.co.uk placidgonzales.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 2 days
planitfuture.co.uk planitfuture.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2021 4 days
planned-wealth.co.uk planned-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2024 2 years, 360 days
portsdownwealthmanagement.co.uk portsdownwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
potterfp.co.uk potterfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2024 354 days
priteshkabawala.co.uk priteshkabawala.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
progressivewealth.co.uk progressivewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
psrwm.co.uk psrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 124 days
rabeyaislam.co.uk rabeyaislam.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 241 days
patrickmckeownwm.co.uk patrickmckeownwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-TJPPJ8 Aug 2020 Aug 2020 One Off
mcqueenwealth.co.uk mcqueenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Oct 2024 2 years, 165 days
mcgwealth.co.uk mcgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 108 days
crockerandpartners.co.uk crockerandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Oct 2024 332 days
mendipwm.co.uk mendipwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Oct 2024 2 years, 276 days
midlandfp.co.uk midlandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Oct 2024 2 years, 32 days
rexwealth.co.uk rexwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2024 1 year, 302 days
rheawm.co.uk rheawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Sep 2024 172 days
richardjhewlett.co.uk richardjhewlett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
richardjkbrown.co.uk richardjkbrown.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 46 days
richardreith.co.uk richardreith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
rkpwealthmanagement.co.uk rkpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 258 days
rjmfp.co.uk rjmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 2 days
bybrookwm.co.uk bybrookwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 181 days
sapphirefinancialplanning.com sapphirefinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
sarahspraguewealthmanagement.co.uk sarahspraguewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
adastrafinancial.co.uk adastrafinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2024 Oct 2024 105 days
savvideswealthmanagement.co.uk savvideswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 346 days
advice-on-line.co.uk advice-on-line.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 4 days
akrwealth.co.uk akrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Oct 2024 1 year, 336 days
altairfp.co.uk altairfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2024 2 years, 350 days
sgwealth.co.uk sgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Jun 2024 2 years, 32 days
sharpwm.co.uk sharpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2024 2 years, 312 days
sherwoodsolutions.com sherwoodsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 52 days
simplewealthsolutions.co.uk simplewealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 347 days
smartinfinancialplanning.co.uk smartinfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 259 days
annsandgrange.co.uk annsandgrange.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 252 days
solebayfp.com solebayfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2023 Sep 2024 324 days
southoverwealth.co.uk southoverwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Jul 2023 1 year, 214 days
andertonfinancialplanning.co.uk andertonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 1 year, 5 days
sparkwealth.co.uk sparkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2024 2 years, 6 days
andyheyes.co.uk andyheyes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 129 days
spinnaker-wealth.co.uk spinnaker-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 56 days
spinnakerwealth.co.uk spinnakerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Aug 2023 2 years, 18 days
spinningfieldswealth.co.uk spinningfieldswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Sep 2024 233 days
sjp-cloud.info ssl-test.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 47 days
stephendawsonwealthmanagement.co.uk stephendawsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Dec 2021 126 days
stephensonwealthmanagement.co.uk stephensonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
stevenswealthmanagement.co.uk stevenswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 57 days
stjulienfp.co.uk stjulienfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2024 1 year, 114 days
atlasprivatewealth.co.uk atlasprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 13 days
sunflowerfinancialplanning.co.uk sunflowerfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 58 days
abreyprivateclients.com abreyprivateclients.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 335 days
surreyoakswm.co.uk surreyoakswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 May 2024 2 years, 284 days
alderleyfinancialplanning.co.uk alderleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 May 2024 2 years, 200 days
swfsltd.co.uk swfsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2024 2 years, 80 days
swilcanfinancialpartners.co.uk swilcanfinancialpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 339 days
amicafinancialwellbeing.co.uk amicafinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 186 days
tait.financial tait.financial
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
taitfinancialservices.co.uk taitfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 60 days
taylorfinancial.co.uk taylorfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 60 days
taylorwealthmanagement.co.uk taylorwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 60 days
templepiper.co.uk templepiper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 164 days
avongreenfinancial.co.uk avongreenfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 131 days
theethicalwealthproject.co.uk theethicalwealthproject.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 340 days
thinkwealth.co.uk thinkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Jun 2024 69 days
tiffanybeardfinancialadvisers.co.uk tiffanybeardfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jun 2024 2 years, 138 days
balmerfinancialplanning.co.uk balmerfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2024 Oct 2024 183 days
tilikumwealth.co.uk tilikumwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
belgravefinancial.com belgravefinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jun 2023 1 year, 225 days
bentleybrownandco.co.uk bentleybrownandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Oct 2024 2 years, 254 days
tullochwealthmanagement.co.uk tullochwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 240 days
twachartered.co.uk twachartered.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 130 days
twcfinancial.co.uk twcfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Oct 2024 2 years, 87 days
tweedieandwyllie.co.uk tweedieandwyllie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Nov 2023 162 days
venturawealth.co.uk venturawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Oct 2024 2 years, 188 days
blackfinwm.co.uk blackfinwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 297 days
vivawealth.co.uk vivawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 1 year, 355 days
wellsandcofinancialplanning.co.uk wellsandcofinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Nov 2022 124 days
brcwm.co.uk brcwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
brewardfp.co.uk brewardfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2023 Oct 2024 1 year, 2 days
whitstablefp.co.uk whitstablefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 217 days
wildandwildwm.co.uk wildandwildwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2024 1 year, 352 days
bromleyrahlke.co.uk bromleyrahlke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
bromptonprivatewealth.co.uk bromptonprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 134 days
williamstreetwealth.co.uk williamstreetwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Oct 2024 2 years, 306 days
williamswealthconsultancy.co.uk williamswealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Oct 2024 1 year, 172 days
woodmitchellfp.co.uk woodmitchellfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 153 days
bwwm.uk bwwm.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2024 Oct 2024 74 days
yasutoarai.co.uk yasutoarai.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2024 2 years, 242 days
yltwealthmanagement.co.uk yltwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2024 2 years, 99 days
chalicefinancialplanning.co.uk chalicefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Oct 2024 284 days
challonerwealth.com challonerwealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 11 days
chequersfinancialplanning.co.uk chequersfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 345 days
sjp.co.uk choices.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2023 1 year, 259 days
chrisbromiley.co.uk chrisbromiley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
chriswordsworthfinancialplanning.co.uk chriswordsworthfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Oct 2024 1 year, 331 days
ciaranpreshurwm.co.uk ciaranpreshurwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Oct 2024 2 years, 88 days
compass-fs.org compass-fs.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 291 days
comptonfinancialadvice.co.uk comptonfinancialadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 51 days
connectedfinancial.co.uk connectedfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 202 days
copfordfinancialplanning.co.uk copfordfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2024 Oct 2024 231 days
cotterell-wilkie.co.uk cotterell-wilkie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 13 days
crescentwm.co.uk crescentwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Apr 2024 1 year, 72 days
crownwealth.co.uk crownwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Apr 2024 2 years, 247 days
cthfinancialplanning.co.uk cthfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Aug 2022 54 days
cuthbertsonwealthmanagement.com cuthbertsonwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 13 days
davidjoneswealthmanagement.co.uk davidjoneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Oct 2024 1 year, 290 days
davidwilkinsonsjp.co.uk davidwilkinsonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 14 days
davieswealthmanagement.uk davieswealthmanagement.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Oct 2024 2 years, 47 days
debenprivatewealth.co.uk debenprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 48 days
denmanfp.com denmanfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2023 2 years, 9 days
easternhorizonwealth.co.uk easternhorizonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 62 days
ellisonwealthmanagement.co.uk ellisonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 160 days
ellisonwwm.co.uk ellisonwwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Oct 2024 2 years, 106 days
elmhurstfinancialplanning.co.uk elmhurstfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 160 days
etteca.asia etteca.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2024 2 years, 265 days
ffwm.co.uk ffwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Feb 2023 121 days
finative.co.uk finative.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Oct 2024 1 year, 198 days
fordhamfinancialplanning.co.uk fordhamfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Oct 2024 2 years, 247 days
forest-oak.co.uk forest-oak.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Oct 2024 1 year, 286 days
fortispw.co.uk fortispw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Oct 2024 2 years, 337 days
frostwealthmanagement.co.uk frostwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 38 days
futuruswealth.co.uk futuruswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 55 days
gillespiefinancialconsultants.co.uk gillespiefinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
godivafinancialplanning.co.uk godivafinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 35 days
gothamwealth.co.uk gothamwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2024 Oct 2024 3 days
grindalwealthmanagement.co.uk grindalwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 34 days
gwwealth.co.uk gwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Oct 2024 1 year, 323 days
hamesassociates.co.uk hamesassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 33 days
hamiltonbennett.co.uk hamiltonbennett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 33 days
hansawealthmanagement.co.uk hansawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Apr 2023 169 days
harmoneyfinancialpartners.co.uk harmoneyfinancialpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 163 days
helenmrogers.co.uk helenmrogers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
hexafinancialplanning.co.uk hexafinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
hivefp.co.uk hivefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2024 Oct 2024 46 days
hutchesonfinancial.co.uk hutchesonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Oct 2024 1 year, 322 days
hwmfinancial.co.uk hwmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 30 days
iriswm.co.uk iriswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 114 days
jafp.co.uk jafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Oct 2024 2 years, 208 days
jamesfullerwm.co.uk jamesfullerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 162 days
jdwealthmanagement.co.uk jdwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
jeremydavieswm.co.uk jeremydavieswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 26 days
joblingwm.co.uk joblingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 113 days
jonathanstorrwm.co.uk jonathanstorrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
jpafinancialplanning.co.uk jpafinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 29 days
jrmwealth.co.uk jrmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 25 days
julianmobsby.co.uk julianmobsby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 162 days
kbruce.co.uk kbruce.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2022 50 days
kevindenman.co.uk kevindenman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 24 days
kilbrinfinancial.co.uk kilbrinfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Oct 2024 1 year, 69 days
kingsfordwealthmanagement.co.uk kingsfordwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Oct 2024 1 year, 153 days
lainstonwm.co.uk lainstonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 27 days
lainstonwm.com lainstonwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Oct 2024 1 year, 27 days
lawrenceneilwealthmanagement.co.uk lawrenceneilwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
leeperkes.co.uk leeperkes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
legacycm.co.uk legacycm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Oct 2024 39 days
lethbridgewm.co.uk lethbridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2024 3 years, 22 days
limestonefp.co.uk limestonefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Oct 2024 2 years, 100 days
lisamccreadiewealthmanagement.co.uk lisamccreadiewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 108 days
ljgwealth.co.uk ljgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2022 One Off
lochriefp.co.uk lochriefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Oct 2024 1 year, 279 days
lordstonefinancial.co.uk lordstonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Oct 2024 1 year, 238 days
luwerowealthadvisers.co.uk luwerowealthadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Oct 2024 212 days
macleodfinancial.co.uk macleodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Oct 2024 1 year, 113 days
majorcontext.com majorcontext.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
marktigwell.co.uk marktigwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Oct 2024 2 years, 239 days
masonbrownfp.co.uk masonbrownfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Oct 2024 315 days
matthewjohnrowland.co.uk matthewjohnrowland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2022 161 days
michaelmacauley.co.uk michaelmacauley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Oct 2024 3 years, 73 days
milesnovotny.co.uk milesnovotny.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mphwealthmanagement.co.uk mphwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
mwwealth.co.uk mwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jun 2022 309 days
nickhowells.co.uk nickhowells.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
nineoak.co.uk nineoak.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2024 2 years, 183 days
njhwealth.co.uk njhwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2024 Sep 2024 98 days
obwealth.co.uk obwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 40 days
ocsfinancialplanning.co.uk ocsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2024 1 year, 151 days
oliumfinancial.co.uk oliumfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2024 Sep 2024 One Off
oneillwealth.co.uk oneillwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2024 2 years, 203 days
orangetreewealthmanagement.co.uk orangetreewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Jan 2023 1 year, 163 days
ovalwealthpartners.co.uk ovalwealthpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 41 days
ovieo.co.uk ovieo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
pamw.co.uk pamw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2024 Oct 2024 158 days
paragonwealth.co.uk paragonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Apr 2023 211 days
parallelwealthmanagement.co.uk parallelwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Aug 2022 247 days
parksidefinancialplanning.co.uk parksidefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2024 1 year, 114 days
parrettfinancial.co.uk parrettfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2024 1 year, 243 days
pathfinderpw.co.uk pathfinderpw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2024 2 years, 345 days
pearcesargent.co.uk pearcesargent.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2024 354 days
pearwoodfinancial.co.uk pearwoodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2024 Sep 2024 172 days
petrichorfinancialsolutions.co.uk petrichorfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2024 1 year, 114 days
pineapplefp.co.uk pineapplefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 42 days
qafp.co.uk qafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2024 Oct 2024 256 days
quintessentialwealthmanagement.co.uk quintessentialwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2023 Dec 2023 One Off
rebeccapope.co.uk rebeccapope.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
reddingswmltd.co.uk reddingswmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 16 days
regencywm.co.uk regencywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2021 Sep 2024 3 years, 45 days
regentdow.co.uk regentdow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2024 2 years, 205 days
WILLIAMSONWM.CO.UK
Non IP Attributes
Attribute First Last
GTM GTM-W2ZFB5N Aug 2021 Oct 2024
GTM GTM-58PXN8T Feb 2021 Jun 2021
GTM GTM-TJPPJ8 Jul 2020 Oct 2020
HJ HJ-946865 Oct 2020 Oct 2020
UA UA-5583714 Feb 2021 Feb 2021
WILLIAMSONWM.CO.UK
Overlap Attribute Domains
wmcinvestment.com wmcinvestment.com
woodfallwealth.co.uk woodfallwealth.co.uk
yiotawilkinsonwm.co.uk yiotawilkinsonwm.co.uk
langleyparkwealth.co.uk langleyparkwealth.co.uk
williamsonwm.co.uk williamsonwm.co.uk
williamswealthmanagement.co.uk williamswealthmanagement.co.uk
willingalewealthmanagement.co.uk willingalewealthmanagement.co.uk
wronskiwealthmanagement.co.uk wronskiwealthmanagement.co.uk
wilcoxday.co.uk wilcoxday.co.uk
wiltshirewm.co.uk wiltshirewm.co.uk
wilkinsonwealth.co.uk wilkinsonwealth.co.uk
greavesfinancialservices.co.uk greavesfinancialservices.co.uk
lehmannfinancialmanagement.co.uk lehmannfinancialmanagement.co.uk
wilsonwealthmanagement.co.uk wilsonwealthmanagement.co.uk
wjpickering.co.uk wjpickering.co.uk
wolfewealth.co.uk wolfewealth.co.uk
woodstockwealthmanagement.co.uk woodstockwealthmanagement.co.uk
wyefieldwm.co.uk wyefieldwm.co.uk
laurencewilkinson.co.uk laurencewilkinson.co.uk
lcwealth.co.uk lcwealth.co.uk
lhfp.co.uk lhfp.co.uk
linleyblack.com linleyblack.com
llewellynfs.co.uk llewellynfs.co.uk
lmcfinancialplanning.co.uk lmcfinancialplanning.co.uk
lochviewfinancialplanning.co.uk lochviewfinancialplanning.co.uk
lombardwealthassociates.co.uk lombardwealthassociates.co.uk
lowesawyerfp.co.uk lowesawyerfp.co.uk
lsmwealth.co.uk lsmwealth.co.uk
mainewealth.co.uk mainewealth.co.uk
mandersfinancialservices.co.uk mandersfinancialservices.co.uk
martenwm.co.uk martenwm.co.uk
maskerywealthmanagement.com maskerywealthmanagement.com
masonswealthassociates.co.uk masonswealthassociates.co.uk
mathieson-financial-services.co.uk mathieson-financial-services.co.uk
melluter.co.uk melluter.co.uk
merlinwealthmanagement.co.uk merlinwealthmanagement.co.uk
michaeljcookwm.co.uk michaeljcookwm.co.uk
mktwealthmanagement.co.uk mktwealthmanagement.co.uk
mwm-sjp.co.uk mwm-sjp.co.uk
napiersharpe.com napiersharpe.com
narwalwm.co.uk narwalwm.co.uk
naziahaquewm.co.uk naziahaquewm.co.uk
niceassociates.co.uk niceassociates.co.uk
northumbriafm.co.uk northumbriafm.co.uk
norwoodfp.com norwoodfp.com
oakroomwealth.co.uk oakroomwealth.co.uk
patmclaughlin.co.uk patmclaughlin.co.uk
paton-feaver.com paton-feaver.com
paulthorntonsjp.co.uk paulthorntonsjp.co.uk
paulwardwealth.co.uk paulwardwealth.co.uk
pcfaltd.co.uk pcfaltd.co.uk
petermulronefp.co.uk petermulronefp.co.uk
pettengellwealth.co.uk pettengellwealth.co.uk
pfswm.co.uk pfswm.co.uk
philiphamilton.co.uk philiphamilton.co.uk
pollardwealthmanagement.co.uk pollardwealthmanagement.co.uk
chapel-wealth.co.uk chapel-wealth.co.uk
bwfconsultants.com bwfconsultants.com
brownlow.co.uk brownlow.co.uk
acsfinancialplanning.co.uk acsfinancialplanning.co.uk
brightwm.co.uk brightwm.co.uk
broadhurstfm.co.uk broadhurstfm.co.uk
admitchellfinancialplanning.co.uk admitchellfinancialplanning.co.uk
aflfinancial.co.uk aflfinancial.co.uk
agfp.co.uk agfp.co.uk
argentwm.co.uk argentwm.co.uk
alanrutherfordwealth.co.uk alanrutherfordwealth.co.uk
alexanderswm.co.uk alexanderswm.co.uk
albrightonwm.co.uk albrightonwm.co.uk
ambersmithwc.co.uk ambersmithwc.co.uk
armstrongswealth.co.uk armstrongswealth.co.uk
andersonwealthplanning.co.uk andersonwealthplanning.co.uk
andrewcummingwm.co.uk andrewcummingwm.co.uk
andrewswealth.co.uk andrewswealth.co.uk
ashleyjai.co.uk ashleyjai.co.uk
atkinsfinancialmanagement.co.uk atkinsfinancialmanagement.co.uk
barbaracopeland.co.uk barbaracopeland.co.uk
barneswealthmanagement.co.uk barneswealthmanagement.co.uk
bderose.co.uk bderose.co.uk
beauchampwealth.co.uk beauchampwealth.co.uk
bellamywealthmanagement.co.uk bellamywealthmanagement.co.uk
benningfm.com benningfm.com
bglwealth.co.uk bglwealth.co.uk
boardmanwealth.co.uk boardmanwealth.co.uk
blancowealthmanagement.co.uk blancowealthmanagement.co.uk
boagenglandfp.co.uk boagenglandfp.co.uk
bpcwealth.co.uk bpcwealth.co.uk
bracewealth.co.uk bracewealth.co.uk
buchanwm.co.uk buchanwm.co.uk
cadmanandco.co.uk cadmanandco.co.uk
cedarfp.co.uk cedarfp.co.uk
cfswp.co.uk cfswp.co.uk
chatsworthwm.co.uk chatsworthwm.co.uk
chrisjwilkinson.co.uk chrisjwilkinson.co.uk
cliftonwealthmanagement.co.uk cliftonwealthmanagement.co.uk
collinswm.co.uk collinswm.co.uk
colyerassociates.co.uk colyerassociates.co.uk
coronationwealth.co.uk coronationwealth.co.uk
dfsfinancialconsultancy.co.uk dfsfinancialconsultancy.co.uk
davidhannonwealthmanagement.co.uk davidhannonwealthmanagement.co.uk
davidmccollwealthmanagement.co.uk davidmccollwealthmanagement.co.uk
derekmillswealth.co.uk derekmillswealth.co.uk
derekscott.co.uk derekscott.co.uk
dilasserprivateclients.co.uk dilasserprivateclients.co.uk
dmcwm.co.uk dmcwm.co.uk
duncanwealth.co.uk duncanwealth.co.uk
ecclesgreenwood.co.uk ecclesgreenwood.co.uk
eswaranstone.com eswaranstone.com
executivewealth.co.uk executivewealth.co.uk
fawcettwm.co.uk fawcettwm.co.uk
firstchoicefinancial.co.uk firstchoicefinancial.co.uk
fowlerfp.co.uk fowlerfp.co.uk
franciswealth.co.uk franciswealth.co.uk
gainsboroughwealthmanagement.co.uk gainsboroughwealthmanagement.co.uk
garyhewett.co.uk garyhewett.co.uk
gdtwealthmanagement.co.uk gdtwealthmanagement.co.uk
gibsonlaingwealth.co.uk gibsonlaingwealth.co.uk
gillespiefinancial.com gillespiefinancial.com
godridgewealth.co.uk godridgewealth.co.uk
gofp.co.uk gofp.co.uk
goldbywealth.com goldbywealth.com
gpswealthmanagement.co.uk gpswealthmanagement.co.uk
grahamtiney.co.uk grahamtiney.co.uk
grovewealthmanagement.info grovewealthmanagement.info
gsqwealth.co.uk gsqwealth.co.uk
harmansmith.co.uk harmansmith.co.uk
harrisonjamesfp.co.uk harrisonjamesfp.co.uk
henshallwm.co.uk henshallwm.co.uk
hfinancialplanning.co.uk hfinancialplanning.co.uk
hfwealthplanning.co.uk hfwealthplanning.co.uk
hindleandjepsonfs.co.uk hindleandjepsonfs.co.uk
hjwealthplanning.co.uk hjwealthplanning.co.uk
honeycroftwm.co.uk honeycroftwm.co.uk
hugocraggs.co.uk hugocraggs.co.uk
hwmwealth.co.uk hwmwealth.co.uk
hylandfp.co.uk hylandfp.co.uk
janineedwards.co.uk janineedwards.co.uk
jenybeardsley.co.uk jenybeardsley.co.uk
johnsherlock.co.uk johnsherlock.co.uk
johntavender.co.uk johntavender.co.uk
jolyonroderickfp.co.uk jolyonroderickfp.co.uk
jsawealthmanagement.co.uk jsawealthmanagement.co.uk
kanishkswarup.co.uk kanishkswarup.co.uk
kimgeorge.co.uk kimgeorge.co.uk
krfinancialplanning.co.uk krfinancialplanning.co.uk
jpprivateclients.co.uk jpprivateclients.co.uk
jsfinancialplanning.co.uk jsfinancialplanning.co.uk
juliantrumper.co.uk juliantrumper.co.uk
justinredwards.co.uk justinredwards.co.uk
jwhwealth.co.uk jwhwealth.co.uk
kcwealth.co.uk kcwealth.co.uk
keithmarwick.co.uk keithmarwick.co.uk
kevinwhite.co.uk kevinwhite.co.uk
kpfinancialwellbeing.co.uk kpfinancialwellbeing.co.uk
ktwm.co.uk ktwm.co.uk
leversedgewm.co.uk leversedgewm.co.uk
lyonsfinancialmanagement.co.uk lyonsfinancialmanagement.co.uk
marktimmins.com marktimmins.com
martinjonesfinancialservices.co.uk martinjonesfinancialservices.co.uk
mckenzieandco.co.uk mckenzieandco.co.uk
mcknightassociates.co.uk mcknightassociates.co.uk
mercuryfinancial.co.uk mercuryfinancial.co.uk
mlfinancialconsultants.co.uk mlfinancialconsultants.co.uk
moranprivateclientpractice.co.uk moranprivateclientpractice.co.uk
murrowwealthmanagement.co.uk murrowwealthmanagement.co.uk
neilloveitt.co.uk neilloveitt.co.uk
newforestwealthmanagement.co.uk newforestwealthmanagement.co.uk
newsomewealthmanagement.co.uk newsomewealthmanagement.co.uk
nigelwd.co.uk nigelwd.co.uk
oundlewealthmanagement.co.uk oundlewealthmanagement.co.uk
paulsamoilys.co.uk paulsamoilys.co.uk
paulsmithwm.co.uk paulsmithwm.co.uk
penrosewealthmanagement.co.uk penrosewealthmanagement.co.uk
penvearnwealthmanagement.co.uk penvearnwealthmanagement.co.uk
petersimonsfinancialservices.co.uk petersimonsfinancialservices.co.uk
phillipsparham.co.uk phillipsparham.co.uk
pickeringandryefinancial.co.uk pickeringandryefinancial.co.uk
pjlwealthmanagement.com pjlwealthmanagement.com
pointtopointfm.co.uk pointtopointfm.co.uk
perchardwealthmanagement.co.uk perchardwealthmanagement.co.uk
buttercrossfp.co.uk buttercrossfp.co.uk
castlerockwealth.co.uk castlerockwealth.co.uk
buchananfp.co.uk buchananfp.co.uk
bpwealthmanagement.co.uk bpwealthmanagement.co.uk
britannicfp.co.uk britannicfp.co.uk
adwfinancialsolutions.co.uk adwfinancialsolutions.co.uk
adrianwhitewm.co.uk adrianwhitewm.co.uk
adamsonross.co.uk adamsonross.co.uk
akfm.co.uk akfm.co.uk
alanfilsell.co.uk alanfilsell.co.uk
altonwealth.co.uk altonwealth.co.uk
alexanderdannwealthmanagementltd.co.uk alexanderdannwealthmanagementltd.co.uk
alexcaulder.co.uk alexcaulder.co.uk
alistairblack.com alistairblack.com
cambriawealth.co.uk cambriawealth.co.uk
cameronjonesfm.com cameronjonesfm.com
amandaredmanfp.co.uk amandaredmanfp.co.uk
amberleyhulmewm.co.uk amberleyhulmewm.co.uk
anchorwmltd.co.uk anchorwmltd.co.uk
andrewdavid.co.uk andrewdavid.co.uk
andrewskinnerwealth.co.uk andrewskinnerwealth.co.uk
andrewvrettos.co.uk andrewvrettos.co.uk
atlanticwc.co.uk atlanticwc.co.uk
beckwealth.co.uk beckwealth.co.uk
benchapmanwealth.co.uk benchapmanwealth.co.uk
berkleysquarepc.co.uk berkleysquarepc.co.uk
bffinancialplanning.co.uk bffinancialplanning.co.uk
bfpwealthmanagement.co.uk bfpwealthmanagement.co.uk
blackdownwealthmanagement.co.uk blackdownwealthmanagement.co.uk
vinitmehta.co.uk vinitmehta.co.uk
bloomerwealth.co.uk bloomerwealth.co.uk
bowcliffewm.co.uk bowcliffewm.co.uk
wentworthwm.co.uk wentworthwm.co.uk
welshandtaylorwealth.co.uk welshandtaylorwealth.co.uk
brittonassociates.co.uk brittonassociates.co.uk
brooksfinancialplanning.co.uk brooksfinancialplanning.co.uk
woodruffhill.co.uk woodruffhill.co.uk
calderwoodwm.co.uk calderwoodwm.co.uk
carlcrossfield.co.uk carlcrossfield.co.uk
chalkfarmfinancial.co.uk chalkfarmfinancial.co.uk
chapman-associates.co.uk chapman-associates.co.uk
chrisbuckland.co.uk chrisbuckland.co.uk
chromaticwealth.co.uk chromaticwealth.co.uk
circlewealth.co.uk circlewealth.co.uk
clarenceplace.co.uk clarenceplace.co.uk
claywarden.co.uk claywarden.co.uk
cmpfinancial.co.uk cmpfinancial.co.uk
coecapital.co.uk coecapital.co.uk
comfortfinancial.co.uk comfortfinancial.co.uk
constantiawealthandfinance.co.uk constantiawealthandfinance.co.uk
copperrock.co.uk copperrock.co.uk
cordata.co.uk cordata.co.uk
cormackwealthmanagement.co.uk cormackwealthmanagement.co.uk
cornerstonewealthmanagement.co.uk cornerstonewealthmanagement.co.uk
cruddenfinancialplanning.co.uk cruddenfinancialplanning.co.uk
denhamwm.co.uk denhamwm.co.uk
djswealthadviser.co.uk djswealthadviser.co.uk
eamonncassidy.co.uk eamonncassidy.co.uk
flackwellfs.com flackwellfs.com
frazerwealth.co.uk frazerwealth.co.uk
garyshieldswealthmanagementllp.co.uk garyshieldswealthmanagementllp.co.uk
gbwealthmanagement.co.uk gbwealthmanagement.co.uk
goldingandpartners.co.uk goldingandpartners.co.uk
goldwealthmanagement.co.uk goldwealthmanagement.co.uk
gravitaswm.co.uk gravitaswm.co.uk
greenwealthplanning.co.uk greenwealthplanning.co.uk
greenwoodwealthsolutions.co.uk greenwoodwealthsolutions.co.uk
guthriefps.co.uk guthriefps.co.uk
hackettwealth.co.uk hackettwealth.co.uk
hamptonjamesfa.co.uk hamptonjamesfa.co.uk
hawkinsthomas.co.uk hawkinsthomas.co.uk
hawwm.co.uk hawwm.co.uk
holleronwm.co.uk holleronwm.co.uk
hutchinsonfinancialplanningltd.co.uk hutchinsonfinancialplanningltd.co.uk
ianrennardfp.co.uk ianrennardfp.co.uk
jamieweller.co.uk jamieweller.co.uk
jbedwards.co.uk jbedwards.co.uk
jenningsfp.co.uk jenningsfp.co.uk
johnpigott.co.uk johnpigott.co.uk
jolyonhankinson.co.uk jolyonhankinson.co.uk
adhwealthmanagement.co.uk adhwealthmanagement.co.uk
ajwwealth.co.uk ajwwealth.co.uk
ajtwealth.co.uk ajtwealth.co.uk
ajgwealthmanagement.co.uk ajgwealthmanagement.co.uk
ajbarnesfinancial.co.uk ajbarnesfinancial.co.uk
campbellcainwm.co.uk campbellcainwm.co.uk
alwealthmanagement.co.uk alwealthmanagement.co.uk
aleksjeromel.co.uk aleksjeromel.co.uk
alisonwright.co.uk alisonwright.co.uk
macfarlanewealthpartners.com macfarlanewealthpartners.com
annegibsonsjp.co.uk annegibsonsjp.co.uk
antlerwealth.co.uk antlerwealth.co.uk
antonyearley.co.uk antonyearley.co.uk
andrewclarey.co.uk andrewclarey.co.uk
andrewoliverfinancial.co.uk andrewoliverfinancial.co.uk
andrewrogerswm.co.uk andrewrogerswm.co.uk
andybarrettsjp.co.uk andybarrettsjp.co.uk
adambentonwm.co.uk adambentonwm.co.uk
aswealthmanagement.co.uk aswealthmanagement.co.uk
athertonandassociates.co.uk athertonandassociates.co.uk
avonwoodfinancial.co.uk avonwoodfinancial.co.uk
ballantinewm.co.uk ballantinewm.co.uk
beckfordandlewis.co.uk beckfordandlewis.co.uk
bennisonyates.co.uk bennisonyates.co.uk
bhtwealthmanagement.co.uk bhtwealthmanagement.co.uk
uwmwealth.co.uk uwmwealth.co.uk
blackwaterwealthmanagement.co.uk blackwaterwealthmanagement.co.uk
blenheimwealthmanagement.co.uk blenheimwealthmanagement.co.uk
blossomwealth.co.uk blossomwealth.co.uk
vittyalexander.co.uk vittyalexander.co.uk
bootefinancial.co.uk bootefinancial.co.uk
watchhousewm.co.uk watchhousewm.co.uk
breretonjacksonfinancial.co.uk breretonjacksonfinancial.co.uk
westerhamfs.co.uk westerhamfs.co.uk
burfieldshousewm.co.uk burfieldshousewm.co.uk
cedarswm.co.uk cedarswm.co.uk
christianjohnwm.co.uk christianjohnwm.co.uk
chronoswm.co.uk chronoswm.co.uk
cockbainassociates.co.uk cockbainassociates.co.uk
coenandclark.co.uk coenandclark.co.uk
cooksonwm.co.uk cooksonwm.co.uk
corneliuswealth.co.uk corneliuswealth.co.uk
countrysidefs.co.uk countrysidefs.co.uk
cranwellws.co.uk cranwellws.co.uk
crawforddean.co.uk crawforddean.co.uk
cyrpaillard.co.uk cyrpaillard.co.uk
davewalkerwealthmanagement.co.uk davewalkerwealthmanagement.co.uk
davidhillwealth.co.uk davidhillwealth.co.uk
davidmakin.co.uk davidmakin.co.uk
davidmelrosewm.co.uk davidmelrosewm.co.uk
dbsfinancial.co.uk dbsfinancial.co.uk
ddlwealthmanagement.co.uk ddlwealthmanagement.co.uk
deltawealth.co.uk deltawealth.co.uk
denmanfp.co.uk denmanfp.co.uk
doreewm.co.uk doreewm.co.uk
drewharperfinancialconsultants.co.uk drewharperfinancialconsultants.co.uk
duncannunnwm.co.uk duncannunnwm.co.uk
dwjwealth.co.uk dwjwealth.co.uk
dyerandcowm.co.uk dyerandcowm.co.uk
financialwealthsolutions.co.uk financialwealthsolutions.co.uk
flavellwm.co.uk flavellwm.co.uk
florastamato.co.uk florastamato.co.uk
forbesfinancial.co.uk forbesfinancial.co.uk
haycockandgricefp.co.uk haycockandgricefp.co.uk
gillisfinancial.co.uk gillisfinancial.co.uk
ginderswm.co.uk ginderswm.co.uk
godfreywealthmanagement.co.uk godfreywealthmanagement.co.uk
grahamwealthmanagement.co.uk grahamwealthmanagement.co.uk
guthriewealthconsultancy.co.uk guthriewealthconsultancy.co.uk
hadlowedwards.co.uk hadlowedwards.co.uk
harnhill.com harnhill.com
harriesfinancial.co.uk harriesfinancial.co.uk
hartleywm.co.uk hartleywm.co.uk
heritagefc.co.uk heritagefc.co.uk
hesslewoodwm.co.uk hesslewoodwm.co.uk
hillandcofa.co.uk hillandcofa.co.uk
houghtonwm.co.uk houghtonwm.co.uk
howardfinancialplanning.co.uk howardfinancialplanning.co.uk
hutchinsonwealthmanagement.co.uk hutchinsonwealthmanagement.co.uk
hwlwm.co.uk hwlwm.co.uk
igwm.co.uk igwm.co.uk
investasure.co.im investasure.co.im
jeanlamb.co.uk jeanlamb.co.uk
jerimeattah.co.uk jerimeattah.co.uk
jmswealthmanagement.co.uk jmswealthmanagement.co.uk
johncummingswm.co.uk johncummingswm.co.uk
jon-paulhardy.co.uk jon-paulhardy.co.uk
jopottsfinancialplanning.co.uk jopottsfinancialplanning.co.uk
juliedaweswealthmanagement.co.uk juliedaweswealthmanagement.co.uk
juliehowiesonwealthmanagement.co.uk juliehowiesonwealthmanagement.co.uk
kathwilkinson.co.uk kathwilkinson.co.uk
kennettwealthmanagement.co.uk kennettwealthmanagement.co.uk
kevindavieswm.co.uk kevindavieswm.co.uk
kineticwealthmanagement.co.uk kineticwealthmanagement.co.uk
kudoswealth.com kudoswealth.com
lenwalters.co.uk lenwalters.co.uk
lfhwealthmanagement.co.uk lfhwealthmanagement.co.uk
lisaleewealthmanagement.co.uk lisaleewealthmanagement.co.uk
littlepebbles.co.uk littlepebbles.co.uk
lockingtonfinancial.co.uk lockingtonfinancial.co.uk
louisewoollardfinancial.co.uk louisewoollardfinancial.co.uk
lukecarless.co.uk lukecarless.co.uk
lynnanderson.co.uk lynnanderson.co.uk
marsonwm.co.uk marsonwm.co.uk
martellowealth.co.uk martellowealth.co.uk
masperoassociates.co.uk masperoassociates.co.uk
maylamfinancial.co.uk maylamfinancial.co.uk
meadwm.co.uk meadwm.co.uk
mercianwm.co.uk mercianwm.co.uk
michaelkiener.co.uk michaelkiener.co.uk
mjbfp.co.uk mjbfp.co.uk
mkm-wealth.co.uk mkm-wealth.co.uk
mountstuartwm.co.uk mountstuartwm.co.uk
myerswealthmanagement.co.uk myerswealthmanagement.co.uk
newmanrea.com newmanrea.com
nickspence.co.uk nickspence.co.uk
oakmerewealth.co.uk oakmerewealth.co.uk
paularodriguez.co.uk paularodriguez.co.uk
paulbutlerwm.co.uk paulbutlerwm.co.uk
paulmkavanagh.co.uk paulmkavanagh.co.uk
paulmorganwealthmanagement.co.uk paulmorganwealthmanagement.co.uk
petermooresjp.co.uk petermooresjp.co.uk
peterwildwealth.co.uk peterwildwealth.co.uk
portburywealth.co.uk portburywealth.co.uk
prudentfpa.co.uk prudentfpa.co.uk
pwandpartners.co.uk pwandpartners.co.uk
lorrainecoaton.co.uk lorrainecoaton.co.uk
lucialangella.co.uk lucialangella.co.uk
adamsandbowleswm.co.uk adamsandbowleswm.co.uk
alanhillfp.co.uk alanhillfp.co.uk
alisongregorywm.co.uk alisongregorywm.co.uk
alexziff.com alexziff.com
almavalewealthmanagement.co.uk almavalewealthmanagement.co.uk
askwealthmanagement.co.uk askwealthmanagement.co.uk
anderson-wealthmanagement.co.uk anderson-wealthmanagement.co.uk
andersonfinancial.co.uk andersonfinancial.co.uk
andrewconnolly.co.uk andrewconnolly.co.uk
carterlegrand.co.uk carterlegrand.co.uk
casewealth.co.uk casewealth.co.uk
bathandwestwealth.co.uk bathandwestwealth.co.uk
twelvewm.co.uk twelvewm.co.uk
twomeywm.co.uk twomeywm.co.uk
bhwml.co.uk bhwml.co.uk
valantineassociates.co.uk valantineassociates.co.uk
watchoakpw.co.uk watchoakpw.co.uk
bowaterwealth.co.uk bowaterwealth.co.uk
wharfebank.co.uk wharfebank.co.uk
brianemslie.co.uk brianemslie.co.uk
bricknellwealth.co.uk bricknellwealth.co.uk
bridgesandco.co.uk bridgesandco.co.uk
broadcharepartners.co.uk broadcharepartners.co.uk
wilkinsonfinancialmgt.co.uk wilkinsonfinancialmgt.co.uk
willowbrooklfp.co.uk willowbrooklfp.co.uk
woodheadwm.co.uk woodheadwm.co.uk
wrightshadwell.co.uk wrightshadwell.co.uk
burn-joneswealthmanagement.co.uk burn-joneswealthmanagement.co.uk
burtonhills.co.uk burtonhills.co.uk
castellwm.co.uk castellwm.co.uk
cathedralgreenfinancialplanning.co.uk cathedralgreenfinancialplanning.co.uk
claytondenefp.co.uk claytondenefp.co.uk
clearwaterwealthmanagement.co.uk clearwaterwealthmanagement.co.uk
coldfairwealthmanagement.co.uk coldfairwealthmanagement.co.uk
colefinancial.co.uk colefinancial.co.uk
colinjessopp.co.uk colinjessopp.co.uk
colinrexwm.co.uk colinrexwm.co.uk
corinthianwealthmanagement.co.uk corinthianwealthmanagement.co.uk
cotswoldwealth.co.uk cotswoldwealth.co.uk
ctpwm.co.uk ctpwm.co.uk
dalejohnsonwealthmanagement.co.uk dalejohnsonwealthmanagement.co.uk
daleycroft.co.uk daleycroft.co.uk
dalviwealth.co.uk dalviwealth.co.uk
davidgallagherwm.com davidgallagherwm.com
daviswealth.co.uk daviswealth.co.uk
deltachelmsford.co.uk deltachelmsford.co.uk
djbrewsterfcs.co.uk djbrewsterfcs.co.uk
duleypractice.co.uk duleypractice.co.uk
dwbwealth.co.uk dwbwealth.co.uk
dwmfp.co.uk dwmfp.co.uk
eadenwm.co.uk eadenwm.co.uk
educate-financial.co.uk educate-financial.co.uk
farrowwealth.co.uk farrowwealth.co.uk
fortemfm.co.uk fortemfm.co.uk
heraldwealth.co.uk heraldwealth.co.uk
fyldewealthmanagement.co.uk fyldewealthmanagement.co.uk
genoawealthmanagement.co.uk genoawealthmanagement.co.uk
goldsmithwm.co.uk goldsmithwm.co.uk
goodallsmith.co.uk goodallsmith.co.uk
gregorywm.co.uk gregorywm.co.uk
gregthomsonwealth.co.uk gregthomsonwealth.co.uk
griersonwm.co.uk griersonwm.co.uk
hallandcostellowealthmanagement.co.uk hallandcostellowealthmanagement.co.uk
hamwicwealth.co.uk hamwicwealth.co.uk
hetalpatelwealth.co.uk hetalpatelwealth.co.uk
highhousewealth.co.uk highhousewealth.co.uk
hilljohnstone.co.uk hilljohnstone.co.uk
islinwm.co.uk islinwm.co.uk
jameselliottwealthmanagement.co.uk jameselliottwealthmanagement.co.uk
jfwealth.co.uk jfwealth.co.uk
johnclementswealthmanagement.co.uk johnclementswealthmanagement.co.uk
jpswealthmanagement.co.uk jpswealthmanagement.co.uk
kearsleyfinancialmanagement.co.uk kearsleyfinancialmanagement.co.uk
kevinprobertwealthmanagement.co.uk kevinprobertwealthmanagement.co.uk
kmosbyfinancial.co.uk kmosbyfinancial.co.uk
las-wealth.co.uk las-wealth.co.uk
latorrewealthmanagement.co.uk latorrewealthmanagement.co.uk
leedowdall.com leedowdall.com
leeswm.co.uk leeswm.co.uk
mardons.co.uk mardons.co.uk
marshallwealthmanagement.co.uk marshallwealthmanagement.co.uk
martinkeyte.co.uk martinkeyte.co.uk
matrixwp.co.uk matrixwp.co.uk
matthewwykes.co.uk matthewwykes.co.uk
metcalfewealth.co.uk metcalfewealth.co.uk
murraywealthmanagement.co.uk murraywealthmanagement.co.uk
navigationwm.co.uk navigationwm.co.uk
networkventuresfs.co.uk networkventuresfs.co.uk
nicholsonwm.co.uk nicholsonwm.co.uk
nickclarkwm.co.uk nickclarkwm.co.uk
nickcumminswealthmanagement.co.uk nickcumminswealthmanagement.co.uk
osmanwealth.co.uk osmanwealth.co.uk
papewealthmanagement.co.uk papewealthmanagement.co.uk
paulasherlock-cross.co.uk paulasherlock-cross.co.uk
paulgeddeswm.co.uk paulgeddeswm.co.uk
persellewart.co.uk persellewart.co.uk
plummerandassociates.co.uk plummerandassociates.co.uk
leeblissettwealthmanagement.co.uk leeblissettwealthmanagement.co.uk
lewiswealthmanagement.co.uk lewiswealthmanagement.co.uk
lifeandlegacywm.co.uk lifeandlegacywm.co.uk
lisawickenswm.co.uk lisawickenswm.co.uk
macintyrewealth.co.uk macintyrewealth.co.uk
macleodandmaccallumwm.co.uk macleodandmaccallumwm.co.uk
marclbennett.co.uk marclbennett.co.uk
michellesheppard.co.uk michellesheppard.co.uk
minsterwealthmanagement.co.uk minsterwealthmanagement.co.uk
mitchellwm.co.uk mitchellwm.co.uk
moorewealth.co.uk moorewealth.co.uk
moorgatefp.co.uk moorgatefp.co.uk
nathanind.co.uk nathanind.co.uk
norfolkwealthmanagement.co.uk norfolkwealthmanagement.co.uk
nowfinancial.co.uk nowfinancial.co.uk
npfc.co.uk npfc.co.uk
rbawealthmanagement.com rbawealthmanagement.com
parkswm.co.uk parkswm.co.uk
pcfinancialplanning.com pcfinancialplanning.com
petergavin.net petergavin.net
peterhardingwm.co.uk peterhardingwm.co.uk
poolegrahamwc.co.uk poolegrahamwc.co.uk
portbrae.co.uk portbrae.co.uk
ridlandwealth.co.uk ridlandwealth.co.uk
rmwmllp.co.uk rmwmllp.co.uk
roburwm.co.uk roburwm.co.uk
rppw.co.uk rppw.co.uk
scharpwm.co.uk scharpwm.co.uk
afswm.co.uk afswm.co.uk
seifertdunk.co.uk seifertdunk.co.uk
smtwealth.co.uk smtwealth.co.uk
stephendawsonfp.co.uk stephendawsonfp.co.uk
suepickeringwealth.co.uk suepickeringwealth.co.uk
sycamorealliance.com sycamorealliance.com
timmswealthmanagement.co.uk timmswealthmanagement.co.uk
tinaowenfp.co.uk tinaowenfp.co.uk
barnesrobertson.com barnesrobertson.com
tpcwealth.co.uk tpcwealth.co.uk
bedfordwm.co.uk bedfordwm.co.uk
beechcroftwm.co.uk beechcroftwm.co.uk
trbarbour.co.uk trbarbour.co.uk
trowlockwm.co.uk trowlockwm.co.uk
vcpc.co.uk vcpc.co.uk
wellsandcompanywm.co.uk wellsandcompanywm.co.uk
whitehousefm.co.uk whitehousefm.co.uk
whitelockfinancialplanning.co.uk whitelockfinancialplanning.co.uk
whitfieldwealth.co.uk whitfieldwealth.co.uk
wickenswealthmanagement.co.uk wickenswealthmanagement.co.uk
willgrace.co.uk willgrace.co.uk
bullwm.co.uk bullwm.co.uk
chasebridgewm.co.uk chasebridgewm.co.uk
coulterweir.co.uk coulterweir.co.uk
davidbeanwealth.co.uk davidbeanwealth.co.uk
deanstevenswm.co.uk deanstevenswm.co.uk
easternwealth.co.uk easternwealth.co.uk
eatlywm.co.uk eatlywm.co.uk
experiumfinancialservices.co.uk experiumfinancialservices.co.uk
hartyltd.co.uk hartyltd.co.uk
irpwealth.co.uk irpwealth.co.uk
iwmwealth.co.uk iwmwealth.co.uk
jenkinsandcofm.co.uk jenkinsandcofm.co.uk
kimdevinefp.co.uk kimdevinefp.co.uk
joybarden.co.uk joybarden.co.uk
keithwilliamsfinancial.co.uk keithwilliamsfinancial.co.uk
kenbinniefinancialltd.co.uk kenbinniefinancialltd.co.uk
leemerrettwealthmanagement.co.uk leemerrettwealthmanagement.co.uk
leonardwealthsolutions.co.uk leonardwealthsolutions.co.uk
lettswealthmanagement.co.uk lettswealthmanagement.co.uk
mandyknox.co.uk mandyknox.co.uk
miwealth.co.uk miwealth.co.uk
moifc.co.uk moifc.co.uk
rectorygreenfs.co.uk rectorygreenfs.co.uk
oliverreeve.co.uk oliverreeve.co.uk
patrickwardconsulting.co.uk patrickwardconsulting.co.uk
pbfwm.co.uk pbfwm.co.uk
pfpwealth.co.uk pfpwealth.co.uk
polarisfp.co.uk polarisfp.co.uk
pricefp.co.uk pricefp.co.uk
provestfs.co.uk provestfs.co.uk
rhodesbrook.co.uk rhodesbrook.co.uk
ridley-jones.co.uk ridley-jones.co.uk
scottsymeswm.co.uk scottsymeswm.co.uk
sjbettridgefp.co.uk sjbettridgefp.co.uk
sjpp.asia sjpp.asia
sldwealth.co.uk sldwealth.co.uk
anglianwealthmanagement.co.uk anglianwealthmanagement.co.uk
solosywm.co.uk solosywm.co.uk
andrewspillane.co.uk andrewspillane.co.uk
andrewtodd-sjp.co.uk andrewtodd-sjp.co.uk
sussexwealthmanagement.com sussexwealthmanagement.com
swannfinancial.co.uk swannfinancial.co.uk
templemewswm.co.uk templemewswm.co.uk
avantiwm.co.uk avantiwm.co.uk
ayeshakhanfinancialplanning.co.uk ayeshakhanfinancialplanning.co.uk
themjp.co.uk themjp.co.uk
thompsonfinancialplanning.co.uk thompsonfinancialplanning.co.uk
threehillswealth.co.uk threehillswealth.co.uk
bassantfs.co.uk bassantfs.co.uk
berkeleystjames-wm.co.uk berkeleystjames-wm.co.uk
walbrookfinancial.co.uk walbrookfinancial.co.uk
bromileyandpartners.co.uk bromileyandpartners.co.uk
willsfinancial.co.uk willsfinancial.co.uk
willgrasscornishwealthmanagement.co.uk willgrasscornishwealthmanagement.co.uk
cassidyfinancial.co.uk cassidyfinancial.co.uk
darrenford.co.uk darrenford.co.uk
davidmasonfp.com davidmasonfp.com
davidsonpert.co.uk davidsonpert.co.uk
dmbwealthmanagement.co.uk dmbwealthmanagement.co.uk
dpfinplan.com dpfinplan.com
ellisonedwardswm.co.uk ellisonedwardswm.co.uk
gallimorewealthmanagement.co.uk gallimorewealthmanagement.co.uk
gayworrow.co.uk gayworrow.co.uk
hawthornewealthmanagement.com hawthornewealthmanagement.com
ifswealth.co.uk ifswealth.co.uk
illingworthseddon.co.uk illingworthseddon.co.uk
iqandco.com iqandco.com
jlwealthconsultancy.co.uk jlwealthconsultancy.co.uk
jonathanjgibbons.co.uk jonathanjgibbons.co.uk
rcwealthmanagement.co.uk rcwealthmanagement.co.uk
reedmanwm.co.uk reedmanwm.co.uk
reeffc.com reeffc.com
robertapugh.co.uk robertapugh.co.uk
rwafp.com rwafp.com
schoolfeessolutions.co.uk schoolfeessolutions.co.uk
scottwallace.co.uk scottwallace.co.uk
scrivenerfinancial.co.uk scrivenerfinancial.co.uk
shubhokunduwm.co.uk shubhokunduwm.co.uk
southdownsfp.co.uk southdownsfp.co.uk
arw-wm.com arw-wm.com
stefaniepricewealth.co.uk stefaniepricewealth.co.uk
abacuswm.co.uk abacuswm.co.uk
carpenterwealthmanagement.co.uk carpenterwealthmanagement.co.uk
tailoredsolutionswm.co.uk tailoredsolutionswm.co.uk
throgmortonassociates.co.uk throgmortonassociates.co.uk
batchworthwealth.co.uk batchworthwealth.co.uk
bathwealth.co.uk bathwealth.co.uk
whitepeakwm.co.uk whitepeakwm.co.uk
bryantassociates.co.uk bryantassociates.co.uk
callumleachwm.co.uk callumleachwm.co.uk
cedarvalegroup.co.uk cedarvalegroup.co.uk
cmjfinancialplanning.co.uk cmjfinancialplanning.co.uk
curzonwm.com curzonwm.com
davidjwalsh.co.uk davidjwalsh.co.uk
dominicmarcus.co.uk dominicmarcus.co.uk
doweswealthmanagement.co.uk doweswealthmanagement.co.uk
dsmcdermottfinancialplanning.co.uk dsmcdermottfinancialplanning.co.uk
edenwoodwealth.com edenwoodwealth.com
edmundwilson.co.uk edmundwilson.co.uk
elliottwealthmanagement.co.uk elliottwealthmanagement.co.uk
enverwm.co.uk enverwm.co.uk
firmitasfs.co.uk firmitasfs.co.uk
foremostfinancial.net foremostfinancial.net
frankmcmillan.co.uk frankmcmillan.co.uk
garryjohnsonwealthmanagement.co.uk garryjohnsonwealthmanagement.co.uk
garymorrisonwm.co.uk garymorrisonwm.co.uk
gcadurham.co.uk gcadurham.co.uk
hayeswealthmanagement.co.uk hayeswealthmanagement.co.uk
gildedwealth.co.uk gildedwealth.co.uk
guildfordfinancial.co.uk guildfordfinancial.co.uk
hampshirefinancialplanning.co.uk hampshirefinancialplanning.co.uk
horizonwealthconsultancy.co.uk horizonwealthconsultancy.co.uk
impactwm.co.uk impactwm.co.uk
jacquinorman.co.uk jacquinorman.co.uk
jennerwm.co.uk jennerwm.co.uk
jonathangrantwealth.co.uk jonathangrantwealth.co.uk
jpnfinancial.co.uk jpnfinancial.co.uk
keystonefinancial.co.uk keystonefinancial.co.uk
kirbyknott.co.uk kirbyknott.co.uk
lesterbrunt.co.uk lesterbrunt.co.uk
lizmaudsleyfinancialplanning.co.uk lizmaudsleyfinancialplanning.co.uk
mbwwealthmanagement.co.uk mbwwealthmanagement.co.uk
mellingfp.co.uk mellingfp.co.uk
meridianadvice.co.uk meridianadvice.co.uk
mwcarefeesadvice.co.uk mwcarefeesadvice.co.uk
nigelcookewm.co.uk nigelcookewm.co.uk
oakridge-partners.co.uk oakridge-partners.co.uk
oreillywealthmanagement.co.uk oreillywealthmanagement.co.uk
richardjdavies.co.uk richardjdavies.co.uk
richardmarshall.co.uk richardmarshall.co.uk
pdfinancialmanagement.co.uk pdfinancialmanagement.co.uk
penninewealthmanagement.co.uk penninewealthmanagement.co.uk
pjwwealth.co.uk pjwwealth.co.uk
primusfinancial.co.uk primusfinancial.co.uk
priorywealthmanagement.co.uk priorywealthmanagement.co.uk
prosperawealth.co.uk prosperawealth.co.uk
puxleypartnership.co.uk puxleypartnership.co.uk
rachaelbellwealthmanagement.co.uk rachaelbellwealthmanagement.co.uk
randallwm.co.uk randallwm.co.uk
richardbrewster.co.uk richardbrewster.co.uk
rmbfc.co.uk rmbfc.co.uk
abbeywealthmanagement.co.uk abbeywealthmanagement.co.uk
roseassociatesfp.co.uk roseassociatesfp.co.uk
rppw.sg rppw.sg
rsrobertsonfp.co.uk rsrobertsonfp.co.uk
rtwwealth.co.uk rtwwealth.co.uk
accessionrwm.co.uk accessionrwm.co.uk
sarahmhughes.co.uk sarahmhughes.co.uk
alpewealthmanagement.co.uk alpewealthmanagement.co.uk
allenfinancial.co.uk allenfinancial.co.uk
simonlipp.co.uk simonlipp.co.uk
sneddonfp.co.uk sneddonfp.co.uk
spillaneandcompany.co.uk spillaneandcompany.co.uk
apexfinancialservices.co.uk apexfinancialservices.co.uk
stanleyfinancial.co.uk stanleyfinancial.co.uk
stilgoefm.co.uk stilgoefm.co.uk
stwwealth.co.uk stwwealth.co.uk
atlanticwealth.co.uk atlanticwealth.co.uk
aagwealthmanagement.co.uk aagwealthmanagement.co.uk
thindwealthadvisory.co.uk thindwealthadvisory.co.uk
thomaswealthadvisory.co.uk thomaswealthadvisory.co.uk
thomlinsonwealthmanagement.co.uk thomlinsonwealthmanagement.co.uk
trevorngraham.co.uk trevorngraham.co.uk
virtuewealthsolutions.co.uk virtuewealthsolutions.co.uk
westbrookfs.co.uk westbrookfs.co.uk
westgatewealth.co.uk westgatewealth.co.uk
whitewm.co.uk whitewm.co.uk
willgcunningham.co.uk willgcunningham.co.uk
capitalplanningpartners.co.uk capitalplanningpartners.co.uk
capitolfinancial.co.uk capitolfinancial.co.uk
capstone-financial.co.uk capstone-financial.co.uk
craigjameswm.co.uk craigjameswm.co.uk
danielburnswm.co.uk danielburnswm.co.uk
darronchildspractice.co.uk darronchildspractice.co.uk
davidkeddie.co.uk davidkeddie.co.uk
edwardjowilson.co.uk edwardjowilson.co.uk
ejwm.co.uk ejwm.co.uk
fisherwealthconsultancy.co.uk fisherwealthconsultancy.co.uk
flynnwealthmanagement.co.uk flynnwealthmanagement.co.uk
garywalker.co.uk garywalker.co.uk
gdcfinancialadvisers.co.uk gdcfinancialadvisers.co.uk
germainfinancial.co.uk germainfinancial.co.uk
gilsongrayfinancial.co.uk gilsongrayfinancial.co.uk
grovewoodwealth.co.uk grovewoodwealth.co.uk
hydewealthmanagement.co.uk hydewealthmanagement.co.uk
invictuswealth.co.uk invictuswealth.co.uk
iptucker.co.uk iptucker.co.uk
jamescurriefinancialsolutions.co.uk jamescurriefinancialsolutions.co.uk
jamestrickett.co.uk jamestrickett.co.uk
kgrwealth.co.uk kgrwealth.co.uk
lambert-wealth.co.uk lambert-wealth.co.uk
liztuccy.co.uk liztuccy.co.uk
ljwealthmanagement.co.uk ljwealthmanagement.co.uk
lombardprivateclients.co.uk lombardprivateclients.co.uk
louisewarland.co.uk louisewarland.co.uk
magorwealthmanagement.co.uk magorwealthmanagement.co.uk
markkidd.co.uk markkidd.co.uk
mayflowerfinancialplanning.co.uk mayflowerfinancialplanning.co.uk
mccuewealthmanagement.co.uk mccuewealthmanagement.co.uk
mercerandassociates.co.uk mercerandassociates.co.uk
mikestarkeywealthmanagement.co.uk mikestarkeywealthmanagement.co.uk
modus-wealth.co.uk modus-wealth.co.uk
napierlane.com napierlane.com
newmanlangley.co.uk newmanlangley.co.uk
pathwaywealthmanagement.co.uk pathwaywealthmanagement.co.uk
pellegriniandbarlowassociates.co.uk pellegriniandbarlowassociates.co.uk
poundburywealth.co.uk poundburywealth.co.uk
probertwealthmanagement.co.uk probertwealthmanagement.co.uk
psgwealth.co.uk psgwealth.co.uk
quantumprivateclients.co.uk quantumprivateclients.co.uk
quaysidewealthmanagement.co.uk quaysidewealthmanagement.co.uk
ldbwealth.co.uk ldbwealth.co.uk
legacywealth.sg legacywealth.sg
lifetimeconnections.co.uk lifetimeconnections.co.uk
lpwealth.co.uk lpwealth.co.uk
mansionhousefp.co.uk mansionhousefp.co.uk
marionsiddall.co.uk marionsiddall.co.uk
mastersfinancial.co.uk mastersfinancial.co.uk
neathercoat.com neathercoat.com
oakdalefinancialservices.co.uk oakdalefinancialservices.co.uk
olcotelappin.co.uk olcotelappin.co.uk
oliverwronski.co.uk oliverwronski.co.uk
one-wealth.co.uk one-wealth.co.uk
orangetreewm.co.uk orangetreewm.co.uk
pentelow-wealth-management.co.uk pentelow-wealth-management.co.uk
pricewhitinghodgson.co.uk pricewhitinghodgson.co.uk
priteshpankhania.co.uk priteshpankhania.co.uk
renoufwmltd.co.uk renoufwmltd.co.uk
rhiannongoghfp.co.uk rhiannongoghfp.co.uk
robinson-porteous.co.uk robinson-porteous.co.uk
robinsonwealth.co.uk robinsonwealth.co.uk
bruceandassociates.co.uk bruceandassociates.co.uk
sandafinancialservice.com sandafinancialservice.com
mgwealth.co.uk mgwealth.co.uk
selectinvestors.hk selectinvestors.hk
sevenhillswealth.co.uk sevenhillswealth.co.uk
shiptonwealth.co.uk shiptonwealth.co.uk
amwm.co.uk amwm.co.uk
sjp.co.uk sjp.co.uk
andrewwhiting.co.uk andrewwhiting.co.uk
spillaneassociates.co.uk spillaneassociates.co.uk
srbwm.co.uk srbwm.co.uk
stroudwm.co.uk stroudwm.co.uk
templecloudwm.co.uk templecloudwm.co.uk
thetdp.co.uk thetdp.co.uk
thomashallwm.co.uk thomashallwm.co.uk
tim-watts.co.uk tim-watts.co.uk
timramptonwealthmanagement.com timramptonwealthmanagement.com
tmpwealthmanagement.co.uk tmpwealthmanagement.co.uk
beyondwm.co.uk beyondwm.co.uk
blakebrooke.co.uk blakebrooke.co.uk
vickykleboe.co.uk vickykleboe.co.uk
walkerwm.co.uk walkerwm.co.uk
wbwealth.co.uk wbwealth.co.uk
wdwealth.co.uk wdwealth.co.uk
wealthandfinancematterslimited.co.uk wealthandfinancematterslimited.co.uk
brecklandfinancialmanagement.co.uk brecklandfinancialmanagement.co.uk
brewsterfinancialplanning.co.uk brewsterfinancialplanning.co.uk
westwealthmanagement.co.uk westwealthmanagement.co.uk
bsjfinancialplanning.co.uk bsjfinancialplanning.co.uk
calderwealthmanagement.co.uk calderwealthmanagement.co.uk
charlottepoolegraham.co.uk charlottepoolegraham.co.uk
clearwaterwm.co.uk clearwaterwm.co.uk
douglasrowefs.co.uk douglasrowefs.co.uk
frizzellwm.co.uk frizzellwm.co.uk
graywealth.co.uk graywealth.co.uk
hallwealth.co.uk hallwealth.co.uk
huntminaswm.co.uk huntminaswm.co.uk
iccwealthmanagement.co.uk iccwealthmanagement.co.uk
jennymoloney.co.uk jennymoloney.co.uk
johncharper.co.uk johncharper.co.uk
klcfinancial.co.uk klcfinancial.co.uk
kmcwealthmanagement.co.uk kmcwealthmanagement.co.uk
kingsforestwealth.co.uk kingsforestwealth.co.uk
klafp.co.uk klafp.co.uk
leowealth.co.uk leowealth.co.uk
lfp.co.uk lfp.co.uk
lockwoodwealth.co.uk lockwoodwealth.co.uk
markingarfield.co.uk markingarfield.co.uk
matthewwilkeswealthmanagement.co.uk matthewwilkeswealthmanagement.co.uk
mbjj.co.uk mbjj.co.uk
moranwealthmanagement.co.uk moranwealthmanagement.co.uk
ninewealth.co.uk ninewealth.co.uk
odellwealth.com odellwealth.com
redoakwealth.co.uk redoakwealth.co.uk
regencywealthltd.co.uk regencywealthltd.co.uk
pdprivateclient.co.uk pdprivateclient.co.uk
prestfieldwm.co.uk prestfieldwm.co.uk
prjfinancialplanning.co.uk prjfinancialplanning.co.uk
pswm.co.uk pswm.co.uk
pwmni.co.uk pwmni.co.uk
rherbert.co.uk rherbert.co.uk
richardpaddle.com richardpaddle.com
rjfinancialplanning.co.uk rjfinancialplanning.co.uk
rogerswealthmanagement.co.uk rogerswealthmanagement.co.uk
rossmitchellwm.com rossmitchellwm.com
russellfairbrass.co.uk russellfairbrass.co.uk
ruthhomberger.co.uk ruthhomberger.co.uk
bowbrookfp.co.uk bowbrookfp.co.uk
adamjameswm.co.uk adamjameswm.co.uk
samuelsfinancial.co.uk samuelsfinancial.co.uk
saragray.co.uk saragray.co.uk
sarahquirkassociates.co.uk sarahquirkassociates.co.uk
sarahsiddons.co.uk sarahsiddons.co.uk
allardwhiteley.co.uk allardwhiteley.co.uk
sharpfs.co.uk sharpfs.co.uk
sheebapadman.co.uk sheebapadman.co.uk
simonroffey.co.uk simonroffey.co.uk
sjp-partner-nginx-prd-asia.uk.deptagency.com sjp-partner-nginx-prd-asia.uk.deptagency.com
amgwealthmanagement.com amgwealthmanagement.com
sleightwm.co.uk sleightwm.co.uk
anthonyanderson.co.uk anthonyanderson.co.uk
smithhobbswealth.co.uk smithhobbswealth.co.uk
solentwealth.co.uk solentwealth.co.uk
andrewhugheswm.co.uk andrewhugheswm.co.uk
speightwealthmanagement.co.uk speightwealthmanagement.co.uk
spwealth.co.uk spwealth.co.uk
sterlingfa.co.uk sterlingfa.co.uk
sterlingsolutionsltd.co.uk sterlingsolutionsltd.co.uk
stevejoyce.co.uk stevejoyce.co.uk
stringermann.com stringermann.com
swhfp.co.uk swhfp.co.uk
swiftsurewealthmanagement.co.uk swiftsurewealthmanagement.co.uk
tandhfinancialplanning.co.uk tandhfinancialplanning.co.uk
avocetwealth.co.uk avocetwealth.co.uk
avonwoodfinancialplanning.co.uk avonwoodfinancialplanning.co.uk
theplattpartnership.com theplattpartnership.com
thompstonewm.co.uk thompstonewm.co.uk
tywm.co.uk tywm.co.uk
victoredmonds.co.uk victoredmonds.co.uk
victoria-lawson.co.uk victoria-lawson.co.uk
vtwealth.co.uk vtwealth.co.uk
wallwm.co.uk wallwm.co.uk
wardwealthmanagement.co.uk wardwealthmanagement.co.uk
watersdaywm.co.uk watersdaywm.co.uk
btmwealth.co.uk btmwealth.co.uk
willgrasswealthmanagement.co.uk willgrasswealthmanagement.co.uk
williamsandassociatesfa.co.uk williamsandassociatesfa.co.uk
carringtonbond.co.uk carringtonbond.co.uk
zenithfinancial.co.uk zenithfinancial.co.uk
crusewealth.com crusewealth.com
frcfinancialplanning.co.uk frcfinancialplanning.co.uk
hargreaveswealth.co.uk hargreaveswealth.co.uk
hillcrestwm.co.uk hillcrestwm.co.uk
ianbellwm.co.uk ianbellwm.co.uk
ingramwealthmanagement.co.uk ingramwealthmanagement.co.uk
joethomas.info joethomas.info
rcawealth.co.uk rcawealth.co.uk
robertpilnick.co.uk robertpilnick.co.uk
rollowm.co.uk rollowm.co.uk
rosspenman.co.uk rosspenman.co.uk
rozsimcockwealthmanagement.co.uk rozsimcockwealthmanagement.co.uk
rsr-wm.co.uk rsr-wm.co.uk
russellpikefinancial.co.uk russellpikefinancial.co.uk
salterwm.co.uk salterwm.co.uk
samuellukeswm.co.uk samuellukeswm.co.uk
sandgatewealth.co.uk sandgatewealth.co.uk
sarahbuckwealthmanagement.co.uk sarahbuckwealthmanagement.co.uk
advisorycube.co.uk advisorycube.co.uk
selectinvestors.sg selectinvestors.sg
sjp-partner-nginx-prd.uk.deptagency.com sjp-partner-nginx-prd.uk.deptagency.com
sjpfoundation.co.uk sjpfoundation.co.uk
antlerwealth.com antlerwealth.com
apwealth.co.uk apwealth.co.uk
srjwm.co.uk srjwm.co.uk
sterlingwealthmanagement.co.uk sterlingwealthmanagement.co.uk
stevenheyes.co.uk stevenheyes.co.uk
storercfp.co.uk storercfp.co.uk
avonwoodfinancialplanning.com avonwoodfinancialplanning.com
avonwoodfinancialplanning.uk avonwoodfinancialplanning.uk
awwealth.co.uk awwealth.co.uk
thegroveprivatewealthltd.co.uk thegroveprivatewealthltd.co.uk
thinkfinancialwealthmanagement.co.uk thinkfinancialwealthmanagement.co.uk
thomas-rigg.co.uk thomas-rigg.co.uk
tomricketts.co.uk tomricketts.co.uk
birchwealthmanagement.co.uk birchwealthmanagement.co.uk
vibrantwealthmanagement.co.uk vibrantwealthmanagement.co.uk
vswealth.co.uk vswealth.co.uk
bridgegatewm.co.uk bridgegatewm.co.uk
whitepeakwm.uk whitepeakwm.uk
calderwoodswm.co.uk calderwoodswm.co.uk
catherinerichardson.co.uk catherinerichardson.co.uk
chartsmorewealthltd.co.uk chartsmorewealthltd.co.uk
cheshirelifestyle.com cheshirelifestyle.com
clachanviewwm.co.uk clachanviewwm.co.uk
claremont-financial.co.uk claremont-financial.co.uk
cogentfinancial.co.uk cogentfinancial.co.uk
demellowandco.com demellowandco.com
eawealth.co.uk eawealth.co.uk
gardnerwealthmanagement.co.uk gardnerwealthmanagement.co.uk
hayesfinancialplanning.com hayesfinancialplanning.com
glencastlefs.co.uk glencastlefs.co.uk
gqwm.co.uk gqwm.co.uk
gregjmiddleton.co.uk gregjmiddleton.co.uk
hartfordwealth.co.uk hartfordwealth.co.uk
jacksonfinancial.co.uk jacksonfinancial.co.uk
jeremybarrett.co.uk jeremybarrett.co.uk
jonpittey.co.uk jonpittey.co.uk
julianspencerwm.co.uk julianspencerwm.co.uk
lionbridgewealth.co.uk lionbridgewealth.co.uk
lisaeveritt.co.uk lisaeveritt.co.uk
ltcsolutionsltd.co.uk ltcsolutionsltd.co.uk
marknieldwm.co.uk marknieldwm.co.uk
marquewealth.co.uk marquewealth.co.uk
matthewgreenhalgh.co.uk matthewgreenhalgh.co.uk
mbarclay.co.uk mbarclay.co.uk
mglwealthmanagement.co.uk mglwealthmanagement.co.uk
mooreforwealth.co.uk mooreforwealth.co.uk
njwealthplanning.co.uk njwealthplanning.co.uk
rickettsfp.co.uk rickettsfp.co.uk
perowealthmanagement.co.uk perowealthmanagement.co.uk
ptrembeth.co.uk ptrembeth.co.uk
rajivprabhakar.co.uk rajivprabhakar.co.uk
richardcbooth.co.uk richardcbooth.co.uk
rodneyspillerwm.co.uk rodneyspillerwm.co.uk
acjordanwealthmanagement.co.uk acjordanwealthmanagement.co.uk
ryleywm.co.uk ryleywm.co.uk
samrawm.co.uk samrawm.co.uk
scottjamesandassociates.co.uk scottjamesandassociates.co.uk
shaunajhappan.co.uk shaunajhappan.co.uk
alfristonwealth.co.uk alfristonwealth.co.uk
simonbraywm.co.uk simonbraywm.co.uk
silvertreewm.co.uk silvertreewm.co.uk
smithjackson.co.uk smithjackson.co.uk
carterlane.co.uk carterlane.co.uk
steggleswm.co.uk steggleswm.co.uk
stevensonwealthplanning.co.uk stevensonwealthplanning.co.uk
stricklandwealthmanagement.co.uk stricklandwealthmanagement.co.uk
stuartdavieswealthconsultancy.co.uk stuartdavieswealthconsultancy.co.uk
sutherlandmayfairwm.co.uk sutherlandmayfairwm.co.uk
swindonfinancialservices.com swindonfinancialservices.com
tarnwealthmanagement.co.uk tarnwealthmanagement.co.uk
tcolleyassociates.co.uk tcolleyassociates.co.uk
avfp.co.uk avfp.co.uk
avonwoodfinancial.com avonwoodfinancial.com
avonwoodfinancial.uk avonwoodfinancial.uk
baggermanwm.co.uk baggermanwm.co.uk
towerhousewm.co.uk towerhousewm.co.uk
treskelionfp.co.uk treskelionfp.co.uk
villageestatesfc.co.uk villageestatesfc.co.uk
wadewealthmanagement.co.uk wadewealthmanagement.co.uk
waltierwealthmanagement.co.uk waltierwealthmanagement.co.uk
boundstonewm.co.uk boundstonewm.co.uk
whcfp.co.uk whcfp.co.uk
whitfeldfinancialplanning.co.uk whitfeldfinancialplanning.co.uk
whittowwilliamswalkerllp.co.uk whittowwilliamswalkerllp.co.uk
brightsidewealthmanagement.co.uk brightsidewealthmanagement.co.uk
williamsbirley.co.uk williamsbirley.co.uk
chrishillsfc.co.uk chrishillsfc.co.uk
coleridgewm.co.uk coleridgewm.co.uk
consiliumwmltd.co.uk consiliumwmltd.co.uk
equinoxfinancialplanning.co.uk equinoxfinancialplanning.co.uk
havenwealthmanagement.co.uk havenwealthmanagement.co.uk
hearndenandwestonwm.co.uk hearndenandwestonwm.co.uk
hemmensfinancial.co.uk hemmensfinancial.co.uk
howefinancialadvisers.co.uk howefinancialadvisers.co.uk
ianhuntwm.co.uk ianhuntwm.co.uk
jamesbarnett.co.uk jamesbarnett.co.uk
kevinmunrofp.co.uk kevinmunrofp.co.uk
kpwoodandassociates.co.uk kpwoodandassociates.co.uk
littlewickwealthmanagement.co.uk littlewickwealthmanagement.co.uk
maclennanwealth.co.uk maclennanwealth.co.uk
mandyrodgers.co.uk mandyrodgers.co.uk
markproberts.co.uk markproberts.co.uk
mcleanandpartnerswm.co.uk mcleanandpartnerswm.co.uk
millfieldwm.com millfieldwm.com
nigelhelen.co.uk nigelhelen.co.uk
oloughlinandco.co.uk oloughlinandco.co.uk
palmerwealth.co.uk palmerwealth.co.uk
partnership.sjp.asia partnership.sjp.asia
partnership.sjp.co.uk partnership.sjp.co.uk
paulabicknellwealth.co.uk paulabicknellwealth.co.uk
pdavisfinancial.co.uk pdavisfinancial.co.uk
pfpswm.com pfpswm.com
queenssquarewealth.co.uk queenssquarewealth.co.uk
reeswealthmanagement.co.uk reeswealthmanagement.co.uk
ksfinancialadvisers.co.uk ksfinancialadvisers.co.uk
kwmfp.co.uk kwmfp.co.uk
lansdownplace.co.uk lansdownplace.co.uk
lauriefp.co.uk lauriefp.co.uk
legatumwealthmanagement.co.uk legatumwealthmanagement.co.uk
lewingtonwealth.co.uk lewingtonwealth.co.uk
linkswealthmanagement.co.uk linkswealthmanagement.co.uk
malcolmgibsonwealthmanagement.co.uk malcolmgibsonwealthmanagement.co.uk
lochranzawealth.co.uk lochranzawealth.co.uk
loswealth.co.uk loswealth.co.uk
mackiewealthmanagement.co.uk mackiewealthmanagement.co.uk
macphail-kennedy.co.uk macphail-kennedy.co.uk
malikzadafp.co.uk malikzadafp.co.uk
markgolesworthy.co.uk markgolesworthy.co.uk
mbfinancial-planning.co.uk mbfinancial-planning.co.uk
mdslackwealthmanagement.co.uk mdslackwealthmanagement.co.uk
middletonfp.co.uk middletonfp.co.uk
milnewealth.co.uk milnewealth.co.uk
mjwsjp.co.uk mjwsjp.co.uk
monteaglewm.co.uk monteaglewm.co.uk
mrfinancial.info mrfinancial.info
mulberrytreewealth.co.uk mulberrytreewealth.co.uk
municipalfp.co.uk municipalfp.co.uk
neilmorrisfinancial.co.uk neilmorrisfinancial.co.uk
centurywealthmanagement.co.uk centurywealthmanagement.co.uk
maplewoodwealth.co.uk maplewoodwealth.co.uk
northwealthmanagement.co.uk northwealthmanagement.co.uk
npswealth.co.uk npswealth.co.uk
marcnorris.co.uk marcnorris.co.uk
oaktreefinancial.asia oaktreefinancial.asia
ockendenfp.co.uk ockendenfp.co.uk
ocswealthmanagement.co.uk ocswealthmanagement.co.uk
oliverwm.co.uk oliverwm.co.uk
opawealthmanagement.co.uk opawealthmanagement.co.uk
markeldor.co.uk markeldor.co.uk
orchardfinancialassociates.co.uk orchardfinancialassociates.co.uk
paulgschofield.co.uk paulgschofield.co.uk
paulmwilliams.co.uk paulmwilliams.co.uk
peakfifteenfp.co.uk peakfifteenfp.co.uk
peakpf.co.uk peakpf.co.uk
pennygatefinancialassociates.co.uk pennygatefinancialassociates.co.uk
philippotterwealth.co.uk philippotterwealth.co.uk
markpattersonfp.co.uk markpattersonfp.co.uk
quartzfinancialplanning.co.uk quartzfinancialplanning.co.uk
quaylifewm.co.uk quaylifewm.co.uk
reddingswm.co.uk reddingswm.co.uk
rhodianwm.co.uk rhodianwm.co.uk
richardtidy.co.uk richardtidy.co.uk
rickardsfinancialplanning.com rickardsfinancialplanning.com
abacuswealthservices.co.uk abacuswealthservices.co.uk
robertshawsidlow-wealth.co.uk robertshawsidlow-wealth.co.uk
robinsonfp.co.uk robinsonfp.co.uk
rodgersfamilywealth.co.uk rodgersfamilywealth.co.uk
abfinancialplanning.co.uk abfinancialplanning.co.uk
bwfinancialplanning.co.uk bwfinancialplanning.co.uk
rubywealth.co.uk rubywealth.co.uk
bullferguson.co.uk bullferguson.co.uk
adnfp.co.uk adnfp.co.uk
agilepensions.uk agilepensions.uk
schofieldassociatesfp.co.uk schofieldassociatesfp.co.uk
sdhandawealthmanagement.co.uk sdhandawealthmanagement.co.uk
ahwm.co.uk ahwm.co.uk
seandownswealthmanagement.co.uk seandownswealthmanagement.co.uk
searlesfinancial.co.uk searlesfinancial.co.uk
selectinvestors.asia selectinvestors.asia
shenleyprivatewealth.co.uk shenleyprivatewealth.co.uk
alumni.sjp.co.uk alumni.sjp.co.uk
machanwealthmanagement.co.uk machanwealthmanagement.co.uk
silverdomefinancial.co.uk silverdomefinancial.co.uk
skeltons.co.uk skeltons.co.uk
sjp-partner-nginx-stg.uk.deptagency.com sjp-partner-nginx-stg.uk.deptagency.com
sjp-partner-nginx-uat.uk.deptagency.com sjp-partner-nginx-uat.uk.deptagency.com
antaris.asia antaris.asia
capriwealth.co.uk capriwealth.co.uk
snwfinancialplanning.co.uk snwfinancialplanning.co.uk
solastawm.co.uk solastawm.co.uk
solebayfp.co.uk solebayfp.co.uk
andrewdaldrywm.co.uk andrewdaldrywm.co.uk
andrewpaynewm.co.uk andrewpaynewm.co.uk
andrewvarleyfinancialplanning.co.uk andrewvarleyfinancialplanning.co.uk
spirewealth.co.uk spirewealth.co.uk
springwealth.co.uk springwealth.co.uk
srmfinancial.co.uk srmfinancial.co.uk
stanfordwealth.co.uk stanfordwealth.co.uk
steeleaspire.co.uk steeleaspire.co.uk
steelewealthmanagement.co.uk steelewealthmanagement.co.uk
stephenkingwealthmanagement.co.uk stephenkingwealthmanagement.co.uk
stephenpitcher.co.uk stephenpitcher.co.uk
stephensonfp.co.uk stephensonfp.co.uk
sullivanwealthmanagement.co.uk sullivanwealthmanagement.co.uk
swanwealthmanagement.co.uk swanwealthmanagement.co.uk
careyandcofinancialsolutions.co.uk careyandcofinancialsolutions.co.uk
swindonfinancialadvisers.uk swindonfinancialadvisers.uk
swindonfinancialservices.co.uk swindonfinancialservices.co.uk
swindonfinancialservices.uk swindonfinancialservices.uk
taffetsaufferwm.co.uk taffetsaufferwm.co.uk
aswwm.co.uk aswwm.co.uk
tarporleywealth.co.uk tarporleywealth.co.uk
aureliaprivatewealth.co.uk aureliaprivatewealth.co.uk
templemewsfp.co.uk templemewsfp.co.uk
terryhartley.co.uk terryhartley.co.uk
averywealthmanagement.co.uk averywealthmanagement.co.uk
awfwm.co.uk awfwm.co.uk
thederouetpartnership.co.uk thederouetpartnership.co.uk
thestrainpractice.co.uk thestrainpractice.co.uk
bainfa.co.uk bainfa.co.uk
thompsonnorburyfinancialplanning.co.uk thompsonnorburyfinancialplanning.co.uk
tmcfc.co.uk tmcfc.co.uk
beaconfp.co.uk beaconfp.co.uk
towcester-fp.co.uk towcester-fp.co.uk
benhiles.co.uk benhiles.co.uk
truitywealth.co.uk truitywealth.co.uk
tsfinancialplanning.co.uk tsfinancialplanning.co.uk
ubuntuwealthmanagement.co.uk ubuntuwealthmanagement.co.uk
beverleyfinancialmanagement.co.uk beverleyfinancialmanagement.co.uk
bhwml.com bhwml.com
unaking.co.uk unaking.co.uk
vfcwealthmanagement.co.uk vfcwealthmanagement.co.uk
vinewealth.co.uk vinewealth.co.uk
blythswood.com blythswood.com
walfordwealth.co.uk walfordwealth.co.uk
bradnickwealth.co.uk bradnickwealth.co.uk
bredonhillwm.co.uk bredonhillwm.co.uk
whistonwealth.com whistonwealth.com
willcoxwealthmanagement.co.uk willcoxwealthmanagement.co.uk
rafflesplaceprivatewealth.com rafflesplaceprivatewealth.com
wylliewealth.co.uk wylliewealth.co.uk
calderwoodfinancial.co.uk calderwoodfinancial.co.uk
xiiim.com xiiim.com
cheshirewealthconsultancy.co.uk cheshirewealthconsultancy.co.uk
clareclarkson.co.uk clareclarkson.co.uk
colewealthmanagement.co.uk colewealthmanagement.co.uk
cormackwealth.co.uk cormackwealth.co.uk
darcyfp.co.uk darcyfp.co.uk
dfwealthmanagement.co.uk dfwealthmanagement.co.uk
dlwm.co.uk dlwm.co.uk
dowdallwealthmanagement.co.uk dowdallwealthmanagement.co.uk
drpwm.com drpwm.com
drsaqibkarim.co.uk drsaqibkarim.co.uk
duncanmaw.co.uk duncanmaw.co.uk
eastgatewealthmanagementltd.co.uk eastgatewealthmanagementltd.co.uk
edgintonstanley.co.uk edgintonstanley.co.uk
ennveefinancial.co.uk ennveefinancial.co.uk
eonegreen.com eonegreen.com
evermore.financial evermore.financial
excavationexcavate.com excavationexcavate.com
farisnori.co.uk farisnori.co.uk
fifteenfinancialplanning.co.uk fifteenfinancialplanning.co.uk
firmstonewealth.co.uk firmstonewealth.co.uk
foresightfs.co.uk foresightfs.co.uk
forte-financial.co.uk forte-financial.co.uk
fortisfinancial.co.uk fortisfinancial.co.uk
fortresswealthpartnership.com fortresswealthpartnership.com
fortveritaswealth.co.uk fortveritaswealth.co.uk
freddieansah.co.uk freddieansah.co.uk
frizzellandpartners.co.uk frizzellandpartners.co.uk
futureperfectwealthmanagement.co.uk futureperfectwealthmanagement.co.uk
gewealthmanagement.co.uk gewealthmanagement.co.uk
gkbfinancialplanning.co.uk gkbfinancialplanning.co.uk
goldenacornfp.co.uk goldenacornfp.co.uk
gpfp.co.uk gpfp.co.uk
grahamlavinwealthmanagement.co.uk grahamlavinwealthmanagement.co.uk
graysonlewis.co.uk graysonlewis.co.uk
grazianolongo.co.uk grazianolongo.co.uk
greenfortpw.com greenfortpw.com
gritstone-fp.co.uk gritstone-fp.co.uk
hallamwealth.co.uk hallamwealth.co.uk
hannonfinancialplanning.co.uk hannonfinancialplanning.co.uk
haydnlewis.co.uk haydnlewis.co.uk
heideswiftfinancialplanning.co.uk heideswiftfinancialplanning.co.uk
hendredfinancialpartners.co.uk hendredfinancialpartners.co.uk
heyesassociates.co.uk heyesassociates.co.uk
hipstagram.com hipstagram.com
hoadley-financial.co.uk hoadley-financial.co.uk
holmesfinancialplanning.co.uk holmesfinancialplanning.co.uk
hudsonandrogersfinancial.co.uk hudsonandrogersfinancial.co.uk
hummingbirdprivateclients.co.uk hummingbirdprivateclients.co.uk
ipswichfs.co.uk ipswichfs.co.uk
jameshunwickewealthmanagement.co.uk jameshunwickewealthmanagement.co.uk
jamiecalder.co.uk jamiecalder.co.uk
jcrwealth.co.uk jcrwealth.co.uk
jensenwealth.co.uk jensenwealth.co.uk
jgriverwealth.co.uk jgriverwealth.co.uk
joebointon.co.uk joebointon.co.uk
jonesregan.co.uk jonesregan.co.uk
jopowis.co.uk jopowis.co.uk
julianhoweswealthmanagement.co.uk julianhoweswealthmanagement.co.uk
justicewealth.co.uk justicewealth.co.uk
karlbadrick.co.uk karlbadrick.co.uk
kathrynshearsfinancialplanning.co.uk kathrynshearsfinancialplanning.co.uk
kfhwm.co.uk kfhwm.co.uk
kieranfowley.co.uk kieranfowley.co.uk
kinlifetimeplanning.co.uk kinlifetimeplanning.co.uk
mentmorefp.co.uk mentmorefp.co.uk
michellegermain.co.uk michellegermain.co.uk
monriewm.co.uk monriewm.co.uk
kaplan-planwell.co.uk kaplan-planwell.co.uk
keyhavenwealth.co.uk keyhavenwealth.co.uk
keyplanwealth.co.uk keyplanwealth.co.uk
kneefinancialplanning.co.uk kneefinancialplanning.co.uk
knightturnerprivateclients.co.uk knightturnerprivateclients.co.uk
knightwealthmanagement.co.uk knightwealthmanagement.co.uk
krc-wealth-management.co.uk krc-wealth-management.co.uk
lafirmasantana.com lafirmasantana.com
lawcapitalwealth.co.uk lawcapitalwealth.co.uk
leonnasalmon.co.uk leonnasalmon.co.uk
lisacalvertfw.com lisacalvertfw.com
louisemoorewealthmanagement.co.uk louisemoorewealthmanagement.co.uk
lpfinancial.co.uk lpfinancial.co.uk
lucernawealth.com lucernawealth.com
malcolmodonovan.co.uk malcolmodonovan.co.uk
marginsfinancialsolutions.co.uk marginsfinancialsolutions.co.uk
marklowewm.co.uk marklowewm.co.uk
markwheatleywealth.co.uk markwheatleywealth.co.uk
martastonesfm.co.uk martastonesfm.co.uk
michaelkylewm.co.uk michaelkylewm.co.uk
midlandswealthmanagement.co.uk midlandswealthmanagement.co.uk
minsterfinancialplanning.co.uk minsterfinancialplanning.co.uk
mjonesandco.co.uk mjonesandco.co.uk
moorefinancialwellbeing.co.uk moorefinancialwellbeing.co.uk
murfittwealth.co.uk murfittwealth.co.uk
myleschurchill.com myleschurchill.com
nandsfp.co.uk nandsfp.co.uk
ncfa.uk ncfa.uk
neptunefinancialmanagement.co.uk neptunefinancialmanagement.co.uk
nightingalewealth.co.uk nightingalewealth.co.uk
marathonwm.co.uk marathonwm.co.uk
oakwood-capital.co.uk oakwood-capital.co.uk
oconnorwm.co.uk oconnorwm.co.uk
onewealthltd.co.uk onewealthltd.co.uk
markcosgrave.co.uk markcosgrave.co.uk
orangetreefs.co.uk orangetreefs.co.uk
paulmageewealthmanagement.co.uk paulmageewealthmanagement.co.uk
reliancewealth.co.uk reliancewealth.co.uk
powerfinancialmanagement.co.uk powerfinancialmanagement.co.uk
primaryfinancialplanning.co.uk primaryfinancialplanning.co.uk
priteshpankhania.com priteshpankhania.com
marlowwealth.co.uk marlowwealth.co.uk
richardburchnall.co.uk richardburchnall.co.uk
richardsonhewittfp.co.uk richardsonhewittfp.co.uk
charterededgefp.co.uk charterededgefp.co.uk
rnpwealth.co.uk rnpwealth.co.uk
robertbutler-sjp.com robertbutler-sjp.com
robertcompton.co.uk robertcompton.co.uk
roxburghonline.co.uk roxburghonline.co.uk
russellgreer.co.uk russellgreer.co.uk
bradbyswm.co.uk bradbyswm.co.uk
ryanmcguinnesswm.co.uk ryanmcguinnesswm.co.uk
accelerator.sjp-cloud.info accelerator.sjp-cloud.info
saltandlightfs.co.uk saltandlightfs.co.uk
adeptiowm.co.uk adeptiowm.co.uk
sarahmcgurkwealthmanagement.co.uk sarahmcgurkwealthmanagement.co.uk
seekerfinancial.co.uk seekerfinancial.co.uk
sfwm.co.uk sfwm.co.uk
shandandburnsfinancial.co.uk shandandburnsfinancial.co.uk
sherpawealth.uk sherpawealth.uk
allensykeswm.com allensykeswm.com
albionhousewm.co.uk albionhousewm.co.uk
mimigom.co.uk mimigom.co.uk
siddonsand.co siddonsand.co
sigmafp.co.uk sigmafp.co.uk
silverlinewealth.co.uk silverlinewealth.co.uk
silverthornwealth.co.uk silverthornwealth.co.uk
sjp-cloud.info sjp-cloud.info
skylarkwealth.co.uk skylarkwealth.co.uk
andrewgrayafp.co.uk andrewgrayafp.co.uk
sophiederouet.co.uk sophiederouet.co.uk
southgatewm.co.uk southgatewm.co.uk
spco.co.uk spco.co.uk
spillane.viewcreative.agency spillane.viewcreative.agency
srgwealthmanagement.co.uk srgwealthmanagement.co.uk
arvanwealth.co.uk arvanwealth.co.uk
steadfastwm.co.uk steadfastwm.co.uk
stoneswealth.co.uk stoneswealth.co.uk
stowwm.co.uk stowwm.co.uk
stpetersfinancialplanning.co.uk stpetersfinancialplanning.co.uk
adamlordwm.co.uk adamlordwm.co.uk
suffolkfp.co.uk suffolkfp.co.uk
summitfinancial.asia summitfinancial.asia
agilelife.uk agilelife.uk
asmwealth.com asmwealth.com
tedreesltd.co.uk tedreesltd.co.uk
templewoodwealth.co.uk templewoodwealth.co.uk
availfinancialplanning.co.uk availfinancialplanning.co.uk
thamesvalleyfinancialplanning.co.uk thamesvalleyfinancialplanning.co.uk
thelockyerpartnership.co.uk thelockyerpartnership.co.uk
tomworley.co.uk tomworley.co.uk
torweybridge.co.uk torweybridge.co.uk
beaconswealth.co.uk beaconswealth.co.uk
truenorthfp.co.uk truenorthfp.co.uk
twmfinancialplanning.co.uk twmfinancialplanning.co.uk
valkyriefinancialadvice.co.uk valkyriefinancialadvice.co.uk
vantagewm.co.uk vantagewm.co.uk
vaughanwealth.co.uk vaughanwealth.co.uk
vinetreefinancialservices.co.uk vinetreefinancialservices.co.uk
virtusfp.co.uk virtusfp.co.uk
vividfp.co.uk vividfp.co.uk
blueoceanwm.co.uk blueoceanwm.co.uk
walmsleyfinancialplanning.co.uk walmsleyfinancialplanning.co.uk
whfinancialwellbeing.co.uk whfinancialwellbeing.co.uk
whitehousecapital.co.uk whitehousecapital.co.uk
wholewealth.com wholewealth.com
whrwealthmanagement.co.uk whrwealthmanagement.co.uk
brwm.org.uk brwm.org.uk
woodmitchellfp.com woodmitchellfp.com
calderdaviswealthmanagement.co.uk calderdaviswealthmanagement.co.uk
cambridgefinancialadvisers.co.uk cambridgefinancialadvisers.co.uk
carefeeadvice.co.uk carefeeadvice.co.uk
carrfinancialplanning.co.uk carrfinancialplanning.co.uk
charlesjoneswealthmanagement.co.uk charlesjoneswealthmanagement.co.uk
chwwealth.co.uk chwwealth.co.uk
clarkwm.co.uk clarkwm.co.uk
claytonprofessionalwealth.co.uk claytonprofessionalwealth.co.uk
cooperassociateswm.com cooperassociateswm.com
covewealth.co.uk covewealth.co.uk
danielgreenwm.co.uk danielgreenwm.co.uk
danmorganfinancialassociates.co.uk danmorganfinancialassociates.co.uk
darienwilliams.co.uk darienwilliams.co.uk
darrenknibbwealthmanagement.co.uk darrenknibbwealthmanagement.co.uk
davesouthbyfp.co.uk davesouthbyfp.co.uk
davidbilantzwm.co.uk davidbilantzwm.co.uk
davidjohnsonfp.co.uk davidjohnsonfp.co.uk
davidsonfinancialplanning.co.uk davidsonfinancialplanning.co.uk
denmanwealthmanagement.co.uk denmanwealthmanagement.co.uk
dianacooper.co.uk dianacooper.co.uk
doweswealth.co.uk doweswealth.co.uk
dynamicws.co.uk dynamicws.co.uk
earleywm.co.uk earleywm.co.uk
edwardswealth.co.uk edwardswealth.co.uk
edwardtrehearne.co.uk edwardtrehearne.co.uk
ellisonwealth.co.uk ellisonwealth.co.uk
ellorawealth.co.uk ellorawealth.co.uk
emeraldassociates.co.uk emeraldassociates.co.uk
evolvefinancialplanning.co.uk evolvefinancialplanning.co.uk
ewartandbridgemanadvisers.co.uk ewartandbridgemanadvisers.co.uk
ewenharris.co.uk ewenharris.co.uk
excaliburwm.co.uk excaliburwm.co.uk
familytreewealthmanagement.co.uk familytreewealthmanagement.co.uk
farrierrose.co.uk farrierrose.co.uk
fearndalewealth.co.uk fearndalewealth.co.uk
fernbankwealth.co.uk fernbankwealth.co.uk
financialmerrett.co.uk financialmerrett.co.uk
finessefinancialplanning.co.uk finessefinancialplanning.co.uk
formanwealthmanagement.co.uk formanwealthmanagement.co.uk
formfinancialclarity.co.uk formfinancialclarity.co.uk
macaulaywm.co.uk macaulaywm.co.uk
francefinancial.co.uk francefinancial.co.uk
frontierwealth.co.uk frontierwealth.co.uk
futurumfa.co.uk futurumfa.co.uk
gapstowwealth.co.uk gapstowwealth.co.uk
gardnerwealthmanagement.com gardnerwealthmanagement.com
ghfinancialsolutions.co.uk ghfinancialsolutions.co.uk
gillespiefinancialconsultancy.com gillespiefinancialconsultancy.com
greatoakfp.co.uk greatoakfp.co.uk
greenparkwm.com greenparkwm.com
greenswardfp.co.uk greenswardfp.co.uk
gregorhowitt.co.uk gregorhowitt.co.uk
hamiltonpullenfp.co.uk hamiltonpullenfp.co.uk
hillsidefinancialplanning.co.uk hillsidefinancialplanning.co.uk
hjpcfp.com hjpcfp.com
hodgewealthmanagement.co.uk hodgewealthmanagement.co.uk
horshamfinancial.co.uk horshamfinancial.co.uk
huntminasfinancial.co.uk huntminasfinancial.co.uk
integralwm.co.uk integralwm.co.uk
ivanhoefp.co.uk ivanhoefp.co.uk
iwplanning.com iwplanning.com
jamesbournewm.com jamesbournewm.com
jayramfinancialservices.co.uk jayramfinancialservices.co.uk
jenkinsfinancialpartnership.co.uk jenkinsfinancialpartnership.co.uk
jgriver.co jgriver.co
jmkwealthmanagement.co.uk jmkwealthmanagement.co.uk
cordnerwealthmanagement.co.uk cordnerwealthmanagement.co.uk
eatonwealthmanagement.co.uk eatonwealthmanagement.co.uk
gnkwealthmanagement.co.uk gnkwealthmanagement.co.uk
reasonwilliamspartnership.co.uk reasonwilliamspartnership.co.uk
rebeccabailey.co.uk rebeccabailey.co.uk
reflectfp.co.uk reflectfp.co.uk
repositorywealth.co.uk repositorywealth.co.uk
brownandcofp.co.uk brownandcofp.co.uk
rjvaughanwealth.co.uk rjvaughanwealth.co.uk
rmcfp.co.uk rmcfp.co.uk
robingram.co.uk robingram.co.uk
acwwealthmanagement.co.uk acwwealthmanagement.co.uk
bywaterwealth.co.uk bywaterwealth.co.uk
hauxwellwealthmanagement.co.uk hauxwellwealthmanagement.co.uk
sagewm.co.uk sagewm.co.uk
samuelcroudacewm.co.uk samuelcroudacewm.co.uk
saxtonfp.co.uk saxtonfp.co.uk
scottjameswealthmanagement.co.uk scottjameswealthmanagement.co.uk
scrimgerandoakes.co.uk scrimgerandoakes.co.uk
sedgwickwm.co.uk sedgwickwm.co.uk
seven-wealth.co.uk seven-wealth.co.uk
allardwealth.co.uk allardwealth.co.uk
shawfieldwealthmanagement.co.uk shawfieldwealthmanagement.co.uk
shearwoodfinancialmanagement.co.uk shearwoodfinancialmanagement.co.uk
shireswm.co.uk shireswm.co.uk
silveroakfs.co.uk silveroakfs.co.uk
simplicityfp.co.uk simplicityfp.co.uk
sjmfinancial.co.uk sjmfinancial.co.uk
sjp.asia sjp.asia
skwealthsolutions.co.uk skwealthsolutions.co.uk
autuswealth.co.uk autuswealth.co.uk
antlerwealth.asia antlerwealth.asia
andersonbellfinancial.co.uk andersonbellfinancial.co.uk
srmfs.co.uk srmfs.co.uk
appartnerswealth.co.uk appartnerswealth.co.uk
stagwealthmanagement.co.uk stagwealthmanagement.co.uk
stellenboschfp.co.uk stellenboschfp.co.uk
stephenboylewealthmanagement.co.uk stephenboylewealthmanagement.co.uk
stephenhopewealthmanagement.com stephenhopewealthmanagement.com
stephenhydewealthmanagement.co.uk stephenhydewealthmanagement.co.uk
sterlingadvice.co.uk sterlingadvice.co.uk
stevereeswealthmanagement.co.uk stevereeswealthmanagement.co.uk
strakerfp.co.uk strakerfp.co.uk
aspirelane.co.uk aspirelane.co.uk
stuartthom.co.uk stuartthom.co.uk
sullivanandcofp.co.uk sullivanandcofp.co.uk
swannfinancial.com swannfinancial.com
swindonfinancialadvisers.co.uk swindonfinancialadvisers.co.uk
angieaddisonfinancial.co.uk angieaddisonfinancial.co.uk
athelisfinancial.co.uk athelisfinancial.co.uk
aureliaprivatewealth.com aureliaprivatewealth.com
aurorafinancialservices.co.uk aurorafinancialservices.co.uk
terencegoddardassociates.co.uk terencegoddardassociates.co.uk
thameswealth.co.uk thameswealth.co.uk
axtruwealth.co.uk axtruwealth.co.uk
thegrahamharmspractice.co.uk thegrahamharmspractice.co.uk
bardenwealthmanagement.co.uk bardenwealthmanagement.co.uk
beaglefinancialadvice.co.uk beaglefinancialadvice.co.uk
trueselfwealth.co.uk trueselfwealth.co.uk
berryfinancial.co.uk berryfinancial.co.uk
watchhousefp.co.uk watchhousefp.co.uk
waymarkerfinancial.co.uk waymarkerfinancial.co.uk
wellbankwm.co.uk wellbankwm.co.uk
westwellwm.co.uk westwellwm.co.uk
whittinghamprivateclients.com whittinghamprivateclients.com
wokingfinancialadviser.co.uk wokingfinancialadviser.co.uk
bullivantwealth.co.uk bullivantwealth.co.uk
woodwealth.co.uk woodwealth.co.uk
wpwfinancial.co.uk wpwfinancial.co.uk
cgafinancial.co.uk cgafinancial.co.uk
chapmansfinancial.co.uk chapmansfinancial.co.uk
christopherpughwealthmanagement.co.uk christopherpughwealthmanagement.co.uk
claywealth.co.uk claywealth.co.uk
cleevefinancialplanning.co.uk cleevefinancialplanning.co.uk
colebridgefs.co.uk colebridgefs.co.uk
compoundwealth.uk compoundwealth.uk
conclusiondivorce.com conclusiondivorce.com
coralfp.co.uk coralfp.co.uk
cowgillwealthmanagement.co.uk cowgillwealthmanagement.co.uk
cpfc.org.uk cpfc.org.uk
craigcrawfordfinancial.co.uk craigcrawfordfinancial.co.uk
craigsaxtonwm.co.uk craigsaxtonwm.co.uk
creativelp.co.uk creativelp.co.uk
crossleythompson.co.uk crossleythompson.co.uk
custom.sjp-cloud.info custom.sjp-cloud.info
dalemurtenwealthmanagement.co.uk dalemurtenwealthmanagement.co.uk
declankiely.co.uk declankiely.co.uk
destinationwealth.co.uk destinationwealth.co.uk
dmcfp.co.uk dmcfp.co.uk
dunnewealthmanagement.co.uk dunnewealthmanagement.co.uk
dwwealthplanning.co.uk dwwealthplanning.co.uk
eastlakewm.co.uk eastlakewm.co.uk
emilyman.com emilyman.com
farrfinancialplanning.co.uk farrfinancialplanning.co.uk
fenlandfinancialplanning.co.uk fenlandfinancialplanning.co.uk
filsellwealth.co.uk filsellwealth.co.uk
financialplanningformedics.co.uk financialplanningformedics.co.uk
finlaywealth.co.uk finlaywealth.co.uk
forethoughtfinancial.co.uk forethoughtfinancial.co.uk
fortitudewealthmanagement.co.uk fortitudewealthmanagement.co.uk
fskfinancialplanning.co.uk fskfinancialplanning.co.uk
gillespiefinancial.co.uk gillespiefinancial.co.uk
gillespiefinancialconsultancy.co.uk gillespiefinancialconsultancy.co.uk
gillespiefinancialconsultants.com gillespiefinancialconsultants.com
gittinsandco.com gittinsandco.com
goldenacornfp.com goldenacornfp.com
goldreflectwm.co.uk goldreflectwm.co.uk
grantcharlesfp.co.uk grantcharlesfp.co.uk
hartfp.co.uk hartfp.co.uk
herfinancialplanning.co.uk herfinancialplanning.co.uk
hfkwealth.co.uk hfkwealth.co.uk
highfieldwealth.co.uk highfieldwealth.co.uk
majoroakwm.co.uk majoroakwm.co.uk
hsprivatewealth.co.uk hsprivatewealth.co.uk
innoviawm.co.uk innoviawm.co.uk
ironbarkwm.co.uk ironbarkwm.co.uk
isaacwealth.co.uk isaacwealth.co.uk
isherwoodfinancialservices.co.uk isherwoodfinancialservices.co.uk
jamesdrowley.co.uk jamesdrowley.co.uk
jamesonwealthmanagement.co.uk jamesonwealthmanagement.co.uk
jamielewington.co.uk jamielewington.co.uk
jasonbellissimo.co.uk jasonbellissimo.co.uk
jdcfinancialplanning.co.uk jdcfinancialplanning.co.uk
jenkinsonwealth.co.uk jenkinsonwealth.co.uk
jkb-wealth.co.uk jkb-wealth.co.uk
joannefogowm.co.uk joannefogowm.co.uk
joejoblingwealthmanagement.co.uk joejoblingwealthmanagement.co.uk
johngoldiewm.co.uk johngoldiewm.co.uk
johnhomewealthmanagement.co.uk johnhomewealthmanagement.co.uk
johnpeoples.co.uk johnpeoples.co.uk
jpwealthmanagement.co.uk jpwealthmanagement.co.uk
kenwoodwealthmanagement.co.uk kenwoodwealthmanagement.co.uk
kilsaranfp.co.uk kilsaranfp.co.uk
lamymanandco.co.uk lamymanandco.co.uk
langwealthmanagement.co.uk langwealthmanagement.co.uk
laurajoycewealthmanagement.co.uk laurajoycewealthmanagement.co.uk
lemontfp.co.uk lemontfp.co.uk
libertywm.co.uk libertywm.co.uk
longsandsfp.co.uk longsandsfp.co.uk
malcolmfrost.co.uk malcolmfrost.co.uk
mantafp.co.uk mantafp.co.uk
markbeverley.co.uk markbeverley.co.uk
martaderpenska.co.uk martaderpenska.co.uk
mattimorewealth.co.uk mattimorewealth.co.uk
mcgarveyjones.co.uk mcgarveyjones.co.uk
mcgillwm.co.uk mcgillwm.co.uk
michaelheard.co.uk michaelheard.co.uk
mjrfinancialplanning.co.uk mjrfinancialplanning.co.uk
mkm-wm.co.uk mkm-wm.co.uk
mollamwm.co.uk mollamwm.co.uk
morrinsonwealth.co.uk morrinsonwealth.co.uk
mwandpartners.co.uk mwandpartners.co.uk
naomihaynes.co.uk naomihaynes.co.uk
nauticalwealth.co.uk nauticalwealth.co.uk
nbwealthmanagement.co.uk nbwealthmanagement.co.uk
ncoprivateclients.co.uk ncoprivateclients.co.uk
neilforeman.co.uk neilforeman.co.uk
nicholasbonefinancial.co.uk nicholasbonefinancial.co.uk
manganfp.co.uk manganfp.co.uk
norfolkwealth.co.uk norfolkwealth.co.uk
norifinancial.co.uk norifinancial.co.uk
northernspire.co.uk northernspire.co.uk
oaksmithfinancialplanning.co.uk oaksmithfinancialplanning.co.uk
oakwaywm.co.uk oakwaywm.co.uk
originwm.co.uk originwm.co.uk
oxfordwm.co.uk oxfordwm.co.uk
oysterwealthplanning.com oysterwealthplanning.com
revolutionwealth.co.uk revolutionwealth.co.uk
pantheonwealthpartners.co.uk pantheonwealthpartners.co.uk
pardeepnarwal.co.uk pardeepnarwal.co.uk
parnellfinancialmanagement.com parnellfinancialmanagement.com
richardmarshall.uk richardmarshall.uk
pearsonfinancialwellbeing.co.uk pearsonfinancialwellbeing.co.uk
penrose.website-testing-link.net penrose.website-testing-link.net
ripplewealth.co.uk ripplewealth.co.uk
peter-walmsley.co.uk peter-walmsley.co.uk
peterallensjp.co.uk peterallensjp.co.uk
petrichorfinancialsolutions.com petrichorfinancialsolutions.com
philipblackwealthmanagement.co.uk philipblackwealthmanagement.co.uk
placidgonzales.co.uk placidgonzales.co.uk
planitfuture.co.uk planitfuture.co.uk
planned-wealth.co.uk planned-wealth.co.uk
portsdownwealthmanagement.co.uk portsdownwealthmanagement.co.uk
potterfp.co.uk potterfp.co.uk
priteshkabawala.co.uk priteshkabawala.co.uk
progressivewealth.co.uk progressivewealth.co.uk
psrwm.co.uk psrwm.co.uk
rabeyaislam.co.uk rabeyaislam.co.uk
patrickmckeownwm.co.uk patrickmckeownwm.co.uk
mcqueenwealth.co.uk mcqueenwealth.co.uk
mcgwealth.co.uk mcgwealth.co.uk
crockerandpartners.co.uk crockerandpartners.co.uk
mendipwm.co.uk mendipwm.co.uk
midlandfp.co.uk midlandfp.co.uk
rexwealth.co.uk rexwealth.co.uk
rheawm.co.uk rheawm.co.uk
richardjhewlett.co.uk richardjhewlett.co.uk
richardjkbrown.co.uk richardjkbrown.co.uk
richardreith.co.uk richardreith.co.uk
rkpwealthmanagement.co.uk rkpwealthmanagement.co.uk
rjmfp.co.uk rjmfp.co.uk
bybrookwm.co.uk bybrookwm.co.uk
sapphirefinancialplanning.com sapphirefinancialplanning.com
sarahspraguewealthmanagement.co.uk sarahspraguewealthmanagement.co.uk
adastrafinancial.co.uk adastrafinancial.co.uk
savvideswealthmanagement.co.uk savvideswealthmanagement.co.uk
advice-on-line.co.uk advice-on-line.co.uk
akrwealth.co.uk akrwealth.co.uk
altairfp.co.uk altairfp.co.uk
sgwealth.co.uk sgwealth.co.uk
sharpwm.co.uk sharpwm.co.uk
sherwoodsolutions.com sherwoodsolutions.com
simplewealthsolutions.co.uk simplewealthsolutions.co.uk
smartinfinancialplanning.co.uk smartinfinancialplanning.co.uk
annsandgrange.co.uk annsandgrange.co.uk
solebayfp.com solebayfp.com
southoverwealth.co.uk southoverwealth.co.uk
andertonfinancialplanning.co.uk andertonfinancialplanning.co.uk
sparkwealth.co.uk sparkwealth.co.uk
andyheyes.co.uk andyheyes.co.uk
spinnaker-wealth.co.uk spinnaker-wealth.co.uk
spinnakerwealth.co.uk spinnakerwealth.co.uk
spinningfieldswealth.co.uk spinningfieldswealth.co.uk
ssl-test.sjp-cloud.info ssl-test.sjp-cloud.info
stephendawsonwealthmanagement.co.uk stephendawsonwealthmanagement.co.uk
stephensonwealthmanagement.co.uk stephensonwealthmanagement.co.uk
stevenswealthmanagement.co.uk stevenswealthmanagement.co.uk
stjulienfp.co.uk stjulienfp.co.uk
atlasprivatewealth.co.uk atlasprivatewealth.co.uk
sunflowerfinancialplanning.co.uk sunflowerfinancialplanning.co.uk
abreyprivateclients.com abreyprivateclients.com
surreyoakswm.co.uk surreyoakswm.co.uk
alderleyfinancialplanning.co.uk alderleyfinancialplanning.co.uk
swfsltd.co.uk swfsltd.co.uk
swilcanfinancialpartners.co.uk swilcanfinancialpartners.co.uk
amicafinancialwellbeing.co.uk amicafinancialwellbeing.co.uk
tait.financial tait.financial
taitfinancialservices.co.uk taitfinancialservices.co.uk
taylorfinancial.co.uk taylorfinancial.co.uk
taylorwealthmanagement.co.uk taylorwealthmanagement.co.uk
templepiper.co.uk templepiper.co.uk
avongreenfinancial.co.uk avongreenfinancial.co.uk
theethicalwealthproject.co.uk theethicalwealthproject.co.uk
thinkwealth.co.uk thinkwealth.co.uk
tiffanybeardfinancialadvisers.co.uk tiffanybeardfinancialadvisers.co.uk
balmerfinancialplanning.co.uk balmerfinancialplanning.co.uk
tilikumwealth.co.uk tilikumwealth.co.uk
belgravefinancial.com belgravefinancial.com
bentleybrownandco.co.uk bentleybrownandco.co.uk
tullochwealthmanagement.co.uk tullochwealthmanagement.co.uk
twachartered.co.uk twachartered.co.uk
twcfinancial.co.uk twcfinancial.co.uk
tweedieandwyllie.co.uk tweedieandwyllie.co.uk
venturawealth.co.uk venturawealth.co.uk
blackfinwm.co.uk blackfinwm.co.uk
vivawealth.co.uk vivawealth.co.uk
wellsandcofinancialplanning.co.uk wellsandcofinancialplanning.co.uk
brcwm.co.uk brcwm.co.uk
brewardfp.co.uk brewardfp.co.uk
whitstablefp.co.uk whitstablefp.co.uk
wildandwildwm.co.uk wildandwildwm.co.uk
bromleyrahlke.co.uk bromleyrahlke.co.uk
bromptonprivatewealth.co.uk bromptonprivatewealth.co.uk
williamstreetwealth.co.uk williamstreetwealth.co.uk
williamswealthconsultancy.co.uk williamswealthconsultancy.co.uk
woodmitchellfp.co.uk woodmitchellfp.co.uk
bwwm.uk bwwm.uk
yasutoarai.co.uk yasutoarai.co.uk
yltwealthmanagement.co.uk yltwealthmanagement.co.uk
chalicefinancialplanning.co.uk chalicefinancialplanning.co.uk
challonerwealth.com challonerwealth.com
chequersfinancialplanning.co.uk chequersfinancialplanning.co.uk
choices.sjp.co.uk choices.sjp.co.uk
chrisbromiley.co.uk chrisbromiley.co.uk
chriswordsworthfinancialplanning.co.uk chriswordsworthfinancialplanning.co.uk
ciaranpreshurwm.co.uk ciaranpreshurwm.co.uk
compass-fs.org compass-fs.org
comptonfinancialadvice.co.uk comptonfinancialadvice.co.uk
connectedfinancial.co.uk connectedfinancial.co.uk
copfordfinancialplanning.co.uk copfordfinancialplanning.co.uk
cotterell-wilkie.co.uk cotterell-wilkie.co.uk
crescentwm.co.uk crescentwm.co.uk
crownwealth.co.uk crownwealth.co.uk
cthfinancialplanning.co.uk cthfinancialplanning.co.uk
cuthbertsonwealthmanagement.com cuthbertsonwealthmanagement.com
davidjoneswealthmanagement.co.uk davidjoneswealthmanagement.co.uk
davidwilkinsonsjp.co.uk davidwilkinsonsjp.co.uk
davieswealthmanagement.uk davieswealthmanagement.uk
debenprivatewealth.co.uk debenprivatewealth.co.uk
denmanfp.com denmanfp.com
easternhorizonwealth.co.uk easternhorizonwealth.co.uk
ellisonwealthmanagement.co.uk ellisonwealthmanagement.co.uk
ellisonwwm.co.uk ellisonwwm.co.uk
elmhurstfinancialplanning.co.uk elmhurstfinancialplanning.co.uk
etteca.asia etteca.asia
ffwm.co.uk ffwm.co.uk
finative.co.uk finative.co.uk
fordhamfinancialplanning.co.uk fordhamfinancialplanning.co.uk
forest-oak.co.uk forest-oak.co.uk
fortispw.co.uk fortispw.co.uk
frostwealthmanagement.co.uk frostwealthmanagement.co.uk
futuruswealth.co.uk futuruswealth.co.uk
gillespiefinancialconsultants.co.uk gillespiefinancialconsultants.co.uk
godivafinancialplanning.co.uk godivafinancialplanning.co.uk
gothamwealth.co.uk gothamwealth.co.uk
grindalwealthmanagement.co.uk grindalwealthmanagement.co.uk
gwwealth.co.uk gwwealth.co.uk
hamesassociates.co.uk hamesassociates.co.uk
hamiltonbennett.co.uk hamiltonbennett.co.uk
hansawealthmanagement.co.uk hansawealthmanagement.co.uk
harmoneyfinancialpartners.co.uk harmoneyfinancialpartners.co.uk
helenmrogers.co.uk helenmrogers.co.uk
hexafinancialplanning.co.uk hexafinancialplanning.co.uk
hivefp.co.uk hivefp.co.uk
hutchesonfinancial.co.uk hutchesonfinancial.co.uk
hwmfinancial.co.uk hwmfinancial.co.uk
iriswm.co.uk iriswm.co.uk
jafp.co.uk jafp.co.uk
jamesfullerwm.co.uk jamesfullerwm.co.uk
jdwealthmanagement.co.uk jdwealthmanagement.co.uk
jeremydavieswm.co.uk jeremydavieswm.co.uk
joblingwm.co.uk joblingwm.co.uk
jonathanstorrwm.co.uk jonathanstorrwm.co.uk
jpafinancialplanning.co.uk jpafinancialplanning.co.uk
jrmwealth.co.uk jrmwealth.co.uk
julianmobsby.co.uk julianmobsby.co.uk
kbruce.co.uk kbruce.co.uk
kevindenman.co.uk kevindenman.co.uk
kilbrinfinancial.co.uk kilbrinfinancial.co.uk
kingsfordwealthmanagement.co.uk kingsfordwealthmanagement.co.uk
lainstonwm.co.uk lainstonwm.co.uk
lainstonwm.com lainstonwm.com
lawrenceneilwealthmanagement.co.uk lawrenceneilwealthmanagement.co.uk
leeperkes.co.uk leeperkes.co.uk
legacycm.co.uk legacycm.co.uk
lethbridgewm.co.uk lethbridgewm.co.uk
limestonefp.co.uk limestonefp.co.uk
lisamccreadiewealthmanagement.co.uk lisamccreadiewealthmanagement.co.uk
ljgwealth.co.uk ljgwealth.co.uk
lochriefp.co.uk lochriefp.co.uk
lordstonefinancial.co.uk lordstonefinancial.co.uk
luwerowealthadvisers.co.uk luwerowealthadvisers.co.uk
macleodfinancial.co.uk macleodfinancial.co.uk
majorcontext.com majorcontext.com
marktigwell.co.uk marktigwell.co.uk
masonbrownfp.co.uk masonbrownfp.co.uk
matthewjohnrowland.co.uk matthewjohnrowland.co.uk
michaelmacauley.co.uk michaelmacauley.co.uk
milesnovotny.co.uk milesnovotny.co.uk
mphwealthmanagement.co.uk mphwealthmanagement.co.uk
mwwealth.co.uk mwwealth.co.uk
nickhowells.co.uk nickhowells.co.uk
nineoak.co.uk nineoak.co.uk
njhwealth.co.uk njhwealth.co.uk
obwealth.co.uk obwealth.co.uk
ocsfinancialplanning.co.uk ocsfinancialplanning.co.uk
oliumfinancial.co.uk oliumfinancial.co.uk
oneillwealth.co.uk oneillwealth.co.uk
orangetreewealthmanagement.co.uk orangetreewealthmanagement.co.uk
ovalwealthpartners.co.uk ovalwealthpartners.co.uk
ovieo.co.uk ovieo.co.uk
pamw.co.uk pamw.co.uk
paragonwealth.co.uk paragonwealth.co.uk
parallelwealthmanagement.co.uk parallelwealthmanagement.co.uk
parksidefinancialplanning.co.uk parksidefinancialplanning.co.uk
parrettfinancial.co.uk parrettfinancial.co.uk
pathfinderpw.co.uk pathfinderpw.co.uk
pearcesargent.co.uk pearcesargent.co.uk
pearwoodfinancial.co.uk pearwoodfinancial.co.uk
petrichorfinancialsolutions.co.uk petrichorfinancialsolutions.co.uk
pineapplefp.co.uk pineapplefp.co.uk
qafp.co.uk qafp.co.uk
quintessentialwealthmanagement.co.uk quintessentialwealthmanagement.co.uk
rebeccapope.co.uk rebeccapope.co.uk
reddingswmltd.co.uk reddingswmltd.co.uk
regencywm.co.uk regencywm.co.uk
regentdow.co.uk regentdow.co.uk
WILLIAMSONWM.CO.UK
IP History

Click the IP addresses to see over domains using them.