Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

GILLESPIEFINANCIAL.COM

GILLESPIEFINANCIAL.COM
Shared Attributes
Domain
laurencewilkinson.co.uk laurencewilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 310 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
lcwealth.co.uk lcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
ldbwealth.co.uk ldbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 8 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
lewiswealthmanagement.co.uk lewiswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lhfp.co.uk lhfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
lifeandlegacywm.co.uk lifeandlegacywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Nov 2020 Nov 2020 One Off
linleyblack.com linleyblack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 148 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
llewellynfs.co.uk llewellynfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
lmcfinancialplanning.co.uk lmcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
lochviewfinancialplanning.co.uk lochviewfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 108 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
lombardwealthassociates.co.uk lombardwealthassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
lowesawyerfp.co.uk lowesawyerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 152 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
lsmwealth.co.uk lsmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
macintyrewealth.co.uk macintyrewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 351 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
macleodandmaccallumwm.co.uk macleodandmaccallumwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 68 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mainewealth.co.uk mainewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 293 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
mandersfinancialservices.co.uk mandersfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
mansionhousefp.co.uk mansionhousefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-946865 Nov 2020 Nov 2020 21 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
marionsiddall.co.uk marionsiddall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 197 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
martenwm.co.uk martenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
maskerywealthmanagement.com maskerywealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
masonswealthassociates.co.uk masonswealthassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
mastersfinancial.co.uk mastersfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
mathieson-financial-services.co.uk mathieson-financial-services.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
melluter.co.uk melluter.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 101 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
merlinwealthmanagement.co.uk merlinwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
michaeljcookwm.co.uk michaeljcookwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
michellesheppard.co.uk michellesheppard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 347 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mitchellwm.co.uk mitchellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mktwealthmanagement.co.uk mktwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
moorgatefp.co.uk moorgatefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 144 days
HJ HJ-946865 Oct 2020 Nov 2020 41 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mwm-sjp.co.uk mwm-sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 93 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 41 days
napiersharpe.com napiersharpe.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jan 2022 104 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 42 days
narwalwm.co.uk narwalwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
nathanind.co.uk nathanind.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
naziahaquewm.co.uk naziahaquewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 106 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 42 days
neathercoat.com neathercoat.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
niceassociates.co.uk niceassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
norfolkwealthmanagement.co.uk norfolkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 41 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
northumbriafm.co.uk northumbriafm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
norwoodfp.com norwoodfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
nowfinancial.co.uk nowfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 303 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
oakdalefinancialservices.co.uk oakdalefinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 41 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
oakroomwealth.co.uk oakroomwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
ocswealthmanagement.co.uk ocswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Jan 2021 14 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 14 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
olcotelappin.co.uk olcotelappin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 14 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
oliverwronski.co.uk oliverwronski.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 48 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
orangetreewm.co.uk orangetreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 126 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rbawealthmanagement.com rbawealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
parkswm.co.uk parkswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 139 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
patmclaughlin.co.uk patmclaughlin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
GTM GTM-W2ZFB5N Sep 2021 Oct 2021 25 days
paton-feaver.com paton-feaver.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 112 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
paulthorntonsjp.co.uk paulthorntonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 1 year, 7 days
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
paulwardwealth.co.uk paulwardwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 42 days
pcfaltd.co.uk pcfaltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2022 329 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
pcfinancialplanning.com pcfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
pentelow-wealth-management.co.uk pentelow-wealth-management.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 17 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
peterhardingwm.co.uk peterhardingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
petermulronefp.co.uk petermulronefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
pettengellwealth.co.uk pettengellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 114 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
pfswm.co.uk pfswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 114 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
philiphamilton.co.uk philiphamilton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
pollardwealthmanagement.co.uk pollardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 100 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
poolegrahamwc.co.uk poolegrahamwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 74 days
UA UA-5583714 Jan 2021 Jan 2021 16 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
portbrae.co.uk portbrae.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
priteshpankhania.co.uk priteshpankhania.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 18 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
reddingswm.co.uk reddingswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
renoufwmltd.co.uk renoufwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
chapel-wealth.co.uk chapel-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
bwfconsultants.com bwfconsultants.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
rmwmllp.co.uk rmwmllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
roburwm.co.uk roburwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
robinson-porteous.co.uk robinson-porteous.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
brownlow.co.uk brownlow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
robinsonwealth.co.uk robinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
acsfinancialplanning.co.uk acsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 46 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
brightwm.co.uk brightwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
broadhurstfm.co.uk broadhurstfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
sandafinancialservice.com sandafinancialservice.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 79 days
UA UA-5583714 Jan 2021 Feb 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
admitchellfinancialplanning.co.uk admitchellfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 46 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
aflfinancial.co.uk aflfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
scharpwm.co.uk scharpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
afswm.co.uk afswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 107 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
agfp.co.uk agfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
seandownswealthmanagement.co.uk seandownswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 22 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 22 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
seifertdunk.co.uk seifertdunk.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Nov 2020 55 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sevenhillswealth.co.uk sevenhillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 55 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
argentwm.co.uk argentwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 50 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
alanrutherfordwealth.co.uk alanrutherfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
alexanderswm.co.uk alexanderswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
shenleyprivatewealth.co.uk shenleyprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
shiptonwealth.co.uk shiptonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
albrightonwm.co.uk albrightonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
ambersmithwc.co.uk ambersmithwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
armstrongswealth.co.uk armstrongswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 273 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 50 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
andersonwealthplanning.co.uk andersonwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 317 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andrewcummingwm.co.uk andrewcummingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andrewswealth.co.uk andrewswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
srbwm.co.uk srbwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
stephendawsonfp.co.uk stephendawsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-W2ZFB5N Sep 2021 Oct 2021 37 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
stephenpitcher.co.uk stephenpitcher.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
stephensonfp.co.uk stephensonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
suepickeringwealth.co.uk suepickeringwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 57 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sycamorealliance.com sycamorealliance.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ashleyjai.co.uk ashleyjai.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
atkinsfinancialmanagement.co.uk atkinsfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
thederouetpartnership.co.uk thederouetpartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 328 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 8 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
thestrainpractice.co.uk thestrainpractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 29 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
thetdp.co.uk thetdp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2021 91 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 7 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
thomashallwm.co.uk thomashallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 58 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
UA UA-5583714 Jan 2021 Feb 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
barbaracopeland.co.uk barbaracopeland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
timmswealthmanagement.co.uk timmswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
tinaowenfp.co.uk tinaowenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
barneswealthmanagement.co.uk barneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
bderose.co.uk bderose.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
beauchampwealth.co.uk beauchampwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
tpcwealth.co.uk tpcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2023 1 year, 181 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
beechcroftwm.co.uk beechcroftwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
trbarbour.co.uk trbarbour.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bellamywealthmanagement.co.uk bellamywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
trowlockwm.co.uk trowlockwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
benningfm.com benningfm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
bglwealth.co.uk bglwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
boardmanwealth.co.uk boardmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
blancowealthmanagement.co.uk blancowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 235 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
boagenglandfp.co.uk boagenglandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
wbwealth.co.uk wbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
wdwealth.co.uk wdwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
wealthandfinancematterslimited.co.uk wealthandfinancematterslimited.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
bpcwealth.co.uk bpcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
bracewealth.co.uk bracewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
wellsandcompanywm.co.uk wellsandcompanywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 309 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
whitehousefm.co.uk whitehousefm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
whitelockfinancialplanning.co.uk whitelockfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
GTM GTM-W2ZFB5N Sep 2021 Dec 2021 95 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
wickenswealthmanagement.co.uk wickenswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
buchanwm.co.uk buchanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
wmcinvestment.com wmcinvestment.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
woodfallwealth.co.uk woodfallwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 138 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
cadmanandco.co.uk cadmanandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 236 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
yiotawilkinsonwm.co.uk yiotawilkinsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 151 days
UA UA-5583714 Jan 2021 Feb 2021 40 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
cedarfp.co.uk cedarfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
cfswp.co.uk cfswp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
chatsworthwm.co.uk chatsworthwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
chrisjwilkinson.co.uk chrisjwilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
cliftonwealthmanagement.co.uk cliftonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
collinswm.co.uk collinswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
colyerassociates.co.uk colyerassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 311 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
coronationwealth.co.uk coronationwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
dfsfinancialconsultancy.co.uk dfsfinancialconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidhannonwealthmanagement.co.uk davidhannonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidmccollwealthmanagement.co.uk davidmccollwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
derekmillswealth.co.uk derekmillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
derekscott.co.uk derekscott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
dilasserprivateclients.co.uk dilasserprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
dmcwm.co.uk dmcwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
duncanwealth.co.uk duncanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
ecclesgreenwood.co.uk ecclesgreenwood.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
eswaranstone.com eswaranstone.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 153 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
executivewealth.co.uk executivewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2022 224 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
fawcettwm.co.uk fawcettwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
firstchoicefinancial.co.uk firstchoicefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
fowlerfp.co.uk fowlerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
franciswealth.co.uk franciswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
gainsboroughwealthmanagement.co.uk gainsboroughwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
garyhewett.co.uk garyhewett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
gdtwealthmanagement.co.uk gdtwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
gibsonlaingwealth.co.uk gibsonlaingwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
godridgewealth.co.uk godridgewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 156 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
gofp.co.uk gofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
goldbywealth.com goldbywealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
gpswealthmanagement.co.uk gpswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
grahamtiney.co.uk grahamtiney.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
grovewealthmanagement.info grovewealthmanagement.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
gsqwealth.co.uk gsqwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
harmansmith.co.uk harmansmith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
harrisonjamesfp.co.uk harrisonjamesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
hartyltd.co.uk hartyltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
henshallwm.co.uk henshallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hfinancialplanning.co.uk hfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
hfwealthplanning.co.uk hfwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
hindleandjepsonfs.co.uk hindleandjepsonfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hjwealthplanning.co.uk hjwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
honeycroftwm.co.uk honeycroftwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hugocraggs.co.uk hugocraggs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
huntminaswm.co.uk huntminaswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 280 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
hwmwealth.co.uk hwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 31 days
hylandfp.co.uk hylandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
janineedwards.co.uk janineedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 32 days
jenkinsandcofm.co.uk jenkinsandcofm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
jennymoloney.co.uk jennymoloney.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 5 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
jenybeardsley.co.uk jenybeardsley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
johnsherlock.co.uk johnsherlock.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
johntavender.co.uk johntavender.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jolyonroderickfp.co.uk jolyonroderickfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jsawealthmanagement.co.uk jsawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 297 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
kanishkswarup.co.uk kanishkswarup.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 312 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
kimgeorge.co.uk kimgeorge.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
klcfinancial.co.uk klcfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 355 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
kmcwealthmanagement.co.uk kmcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 355 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 7 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
krfinancialplanning.co.uk krfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 146 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
jpprivateclients.co.uk jpprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jsfinancialplanning.co.uk jsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
juliantrumper.co.uk juliantrumper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
justinredwards.co.uk justinredwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jwhwealth.co.uk jwhwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
kcwealth.co.uk kcwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
keithmarwick.co.uk keithmarwick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
kenbinniefinancialltd.co.uk kenbinniefinancialltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
kevinwhite.co.uk kevinwhite.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
kingsforestwealth.co.uk kingsforestwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 6 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
klafp.co.uk klafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 355 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
kpfinancialwellbeing.co.uk kpfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 355 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
ktwm.co.uk ktwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 60 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
langleyparkwealth.co.uk langleyparkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
leonardwealthsolutions.co.uk leonardwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
leowealth.co.uk leowealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 8 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
lettswealthmanagement.co.uk lettswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
leversedgewm.co.uk leversedgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 109 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
lfp.co.uk lfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lockwoodwealth.co.uk lockwoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 293 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
lyonsfinancialmanagement.co.uk lyonsfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 351 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
mandyknox.co.uk mandyknox.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 292 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 5 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
markingarfield.co.uk markingarfield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
marktimmins.com marktimmins.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 89 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
martinjonesfinancialservices.co.uk martinjonesfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
matthewwilkeswealthmanagement.co.uk matthewwilkeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mbjj.co.uk mbjj.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mckenzieandco.co.uk mckenzieandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 164 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
mcknightassociates.co.uk mcknightassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
mercuryfinancial.co.uk mercuryfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
mlfinancialconsultants.co.uk mlfinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 77 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
moranprivateclientpractice.co.uk moranprivateclientpractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
moranwealthmanagement.co.uk moranwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 67 days
UA UA-5583714 Jan 2021 Jan 2021 12 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
murrowwealthmanagement.co.uk murrowwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 151 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
neilloveitt.co.uk neilloveitt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 106 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
newforestwealthmanagement.co.uk newforestwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
newsomewealthmanagement.co.uk newsomewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
nigelwd.co.uk nigelwd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 107 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
odellwealth.com odellwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 14 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rectorygreenfs.co.uk rectorygreenfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
oliverreeve.co.uk oliverreeve.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 42 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
oundlewealthmanagement.co.uk oundlewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 275 days
GTM GTM-58PXN8T Jan 2021 May 2021 96 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
redoakwealth.co.uk redoakwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 51 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 76 days
UA UA-5583714 Jan 2021 Jan 2021 18 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
patrickwardconsulting.co.uk patrickwardconsulting.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
paulsamoilys.co.uk paulsamoilys.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
paulsmithwm.co.uk paulsmithwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
pbfwm.co.uk pbfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
pdprivateclient.co.uk pdprivateclient.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 72 days
UA UA-5583714 Jan 2021 Jan 2021 15 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
penrosewealthmanagement.co.uk penrosewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 113 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
penvearnwealthmanagement.co.uk penvearnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 113 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
reliancewealth.co.uk reliancewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 19 days
UA UA-5583714 Jan 2021 Jan 2021 18 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
petersimonsfinancialservices.co.uk petersimonsfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
pfpwealth.co.uk pfpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
phillipsparham.co.uk phillipsparham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 256 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
pickeringandryefinancial.co.uk pickeringandryefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 114 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
pjlwealthmanagement.com pjlwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 99 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
pointtopointfm.co.uk pointtopointfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 123 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
perchardwealthmanagement.co.uk perchardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
prestfieldwm.co.uk prestfieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
pricefp.co.uk pricefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
prjfinancialplanning.co.uk prjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 75 days
UA UA-5583714 Jan 2021 Jan 2021 17 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
provestfs.co.uk provestfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 277 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
pswm.co.uk pswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Jan 2021 17 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 17 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
pwmni.co.uk pwmni.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 17 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
richardsonhewittfp.co.uk richardsonhewittfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Jan 2021 19 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 19 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
rjfinancialplanning.co.uk rjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
buttercrossfp.co.uk buttercrossfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
castlerockwealth.co.uk castlerockwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
buchananfp.co.uk buchananfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
bpwealthmanagement.co.uk bpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
rogerswealthmanagement.co.uk rogerswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 337 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
rossmitchellwm.com rossmitchellwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
russellfairbrass.co.uk russellfairbrass.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
ruthhomberger.co.uk ruthhomberger.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 79 days
UA UA-5583714 Jan 2021 Jan 2021 20 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
britannicfp.co.uk britannicfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
adwfinancialsolutions.co.uk adwfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Feb 2021 46 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
adrianwhitewm.co.uk adrianwhitewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 46 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
samuelsfinancial.co.uk samuelsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 2 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adamsonross.co.uk adamsonross.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 46 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
saragray.co.uk saragray.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 21 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sarahquirkassociates.co.uk sarahquirkassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
sarahsiddons.co.uk sarahsiddons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2021 89 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
scottsymeswm.co.uk scottsymeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 60 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
akfm.co.uk akfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
alanfilsell.co.uk alanfilsell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 311 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
sfwm.co.uk sfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 335 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
altonwealth.co.uk altonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
alexanderdannwealthmanagementltd.co.uk alexanderdannwealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
sharpfs.co.uk sharpfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 81 days
GTM GTM-W2ZFB5N Sep 2021 Oct 2021 33 days
UA UA-5583714 Jan 2021 Feb 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
sheebapadman.co.uk sheebapadman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2023 1 year, 301 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 81 days
UA UA-5583714 Jan 2021 Feb 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
alexcaulder.co.uk alexcaulder.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 317 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
alistairblack.com alistairblack.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 317 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
cambriawealth.co.uk cambriawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
cameronjonesfm.com cameronjonesfm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
silverthornwealth.co.uk silverthornwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 23 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
simonroffey.co.uk simonroffey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 23 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
amandaredmanfp.co.uk amandaredmanfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
sjbettridgefp.co.uk sjbettridgefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
amberleyhulmewm.co.uk amberleyhulmewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
sldwealth.co.uk sldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
sleightwm.co.uk sleightwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
smithhobbswealth.co.uk smithhobbswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 24 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 24 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
anglianwealthmanagement.co.uk anglianwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
anchorwmltd.co.uk anchorwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
solentwealth.co.uk solentwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 171 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
solosywm.co.uk solosywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
andrewdavid.co.uk andrewdavid.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andrewskinnerwealth.co.uk andrewskinnerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andrewvrettos.co.uk andrewvrettos.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
speightwealthmanagement.co.uk speightwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Nov 2020 Nov 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
spwealth.co.uk spwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2022 207 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
sterlingfa.co.uk sterlingfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
stevejoyce.co.uk stevejoyce.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
sussexwealthmanagement.com sussexwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
swannfinancial.co.uk swannfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 56 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
swiftsurewealthmanagement.co.uk swiftsurewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
atlanticwc.co.uk atlanticwc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 51 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
templewoodwealth.co.uk templewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 329 days
UA UA-5583714 Jan 2021 Feb 2021 29 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
themjp.co.uk themjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 53 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
theplattpartnership.com theplattpartnership.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
UA UA-5583714 Jan 2021 Feb 2021 30 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
thompsonfinancialplanning.co.uk thompsonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
UA UA-5583714 Jan 2021 Feb 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
thompstonewm.co.uk thompstonewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 58 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
UA UA-5583714 Jan 2021 Feb 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
threehillswealth.co.uk threehillswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bassantfs.co.uk bassantfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
beckwealth.co.uk beckwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
benchapmanwealth.co.uk benchapmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
berkleysquarepc.co.uk berkleysquarepc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
bffinancialplanning.co.uk bffinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
bfpwealthmanagement.co.uk bfpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
blackdownwealthmanagement.co.uk blackdownwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
victoredmonds.co.uk victoredmonds.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
vinitmehta.co.uk vinitmehta.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Feb 2021 Mar 2021 42 days
bloomerwealth.co.uk bloomerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
vtwealth.co.uk vtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
walbrookfinancial.co.uk walbrookfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
wallwm.co.uk wallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 267 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
wardwealthmanagement.co.uk wardwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
watersdaywm.co.uk watersdaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
bowcliffewm.co.uk bowcliffewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
wentworthwm.co.uk wentworthwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
welshandtaylorwealth.co.uk welshandtaylorwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 143 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
brittonassociates.co.uk brittonassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
bromileyandpartners.co.uk bromileyandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 108 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
brooksfinancialplanning.co.uk brooksfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
willsfinancial.co.uk willsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
williamsonwm.co.uk williamsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
williamswealthmanagement.co.uk williamswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
willingalewealthmanagement.co.uk willingalewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
wronskiwealthmanagement.co.uk wronskiwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
calderwoodwm.co.uk calderwoodwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
carlcrossfield.co.uk carlcrossfield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
chalkfarmfinancial.co.uk chalkfarmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
chapman-associates.co.uk chapman-associates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
chrisbuckland.co.uk chrisbuckland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
chromaticwealth.co.uk chromaticwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
circlewealth.co.uk circlewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
clarenceplace.co.uk clarenceplace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
claywarden.co.uk claywarden.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 149 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
cmpfinancial.co.uk cmpfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
coecapital.co.uk coecapital.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
comfortfinancial.co.uk comfortfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 110 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
constantiawealthandfinance.co.uk constantiawealthandfinance.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
copperrock.co.uk copperrock.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 238 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
cordata.co.uk cordata.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
cormackwealthmanagement.co.uk cormackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 311 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
cornerstonewealthmanagement.co.uk cornerstonewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
cruddenfinancialplanning.co.uk cruddenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
davidmasonfp.com davidmasonfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
denhamwm.co.uk denhamwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
djswealthadviser.co.uk djswealthadviser.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
eamonncassidy.co.uk eamonncassidy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
flackwellfs.com flackwellfs.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 153 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
frazerwealth.co.uk frazerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
gallimorewealthmanagement.co.uk gallimorewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
garyshieldswealthmanagementllp.co.uk garyshieldswealthmanagementllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
gayworrow.co.uk gayworrow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
gbwealthmanagement.co.uk gbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 243 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
goldingandpartners.co.uk goldingandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 359 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
goldwealthmanagement.co.uk goldwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
gravitaswm.co.uk gravitaswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
greenwealthplanning.co.uk greenwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
greenwoodwealthsolutions.co.uk greenwoodwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
guthriefps.co.uk guthriefps.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 114 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hackettwealth.co.uk hackettwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hamptonjamesfa.co.uk hamptonjamesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hargreaveswealth.co.uk hargreaveswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
hawkinsthomas.co.uk hawkinsthomas.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
hawwm.co.uk hawwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 29 days
holleronwm.co.uk holleronwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
hutchinsonfinancialplanningltd.co.uk hutchinsonfinancialplanningltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
ianbellwm.co.uk ianbellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
ianrennardfp.co.uk ianrennardfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 32 days
ifswealth.co.uk ifswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 361 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Nov 2020 32 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
ingramwealthmanagement.co.uk ingramwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 361 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
jamieweller.co.uk jamieweller.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 359 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jbedwards.co.uk jbedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jenningsfp.co.uk jenningsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
joethomas.info joethomas.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 5 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
johnpigott.co.uk johnpigott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jolyonhankinson.co.uk jolyonhankinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2022 222 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
jonathanjgibbons.co.uk jonathanjgibbons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
rcawealth.co.uk rcawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
rcwealthmanagement.co.uk rcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
reasonwilliamspartnership.co.uk reasonwilliamspartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 220 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
reedmanwm.co.uk reedmanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
reeffc.com reeffc.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
robertpilnick.co.uk robertpilnick.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
rollowm.co.uk rollowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
rosspenman.co.uk rosspenman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
rozsimcockwealthmanagement.co.uk rozsimcockwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 78 days
GTM GTM-W2ZFB5N Sep 2021 Oct 2021 31 days
UA UA-5583714 Jan 2021 Jan 2021 20 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
rsr-wm.co.uk rsr-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 78 days
UA UA-5583714 Jan 2021 Jan 2021 20 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
rwafp.com rwafp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 142 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
adhwealthmanagement.co.uk adhwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 46 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
salterwm.co.uk salterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 21 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
samuelcroudacewm.co.uk samuelcroudacewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 21 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
samuellukeswm.co.uk samuellukeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
sarahbuckwealthmanagement.co.uk sarahbuckwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 21 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
scottwallace.co.uk scottwallace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 1 year, 11 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 128 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
scrivenerfinancial.co.uk scrivenerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 80 days
UA UA-5583714 Jan 2021 Feb 2021 22 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
sedgwickwm.co.uk sedgwickwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 22 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 22 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
selectinvestors.sg selectinvestors.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 336 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 2 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
ajwwealth.co.uk ajwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
ajtwealth.co.uk ajtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 103 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
ajgwealthmanagement.co.uk ajgwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
ajbarnesfinancial.co.uk ajbarnesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
campbellcainwm.co.uk campbellcainwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
alwealthmanagement.co.uk alwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
aleksjeromel.co.uk aleksjeromel.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
alisonwright.co.uk alisonwright.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 317 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
shireswm.co.uk shireswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 23 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
macfarlanewealthpartners.com macfarlanewealthpartners.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
shubhokunduwm.co.uk shubhokunduwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 81 days
UA UA-5583714 Jan 2021 Feb 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
annegibsonsjp.co.uk annegibsonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
antlerwealth.co.uk antlerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 50 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
antonyearley.co.uk antonyearley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 145 days
UA UA-5583714 Jan 2021 Mar 2021 50 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
andrewclarey.co.uk andrewclarey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
andrewoliverfinancial.co.uk andrewoliverfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andrewrogerswm.co.uk andrewrogerswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andybarrettsjp.co.uk andybarrettsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
southdownsfp.co.uk southdownsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
arw-wm.com arw-wm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
srjwm.co.uk srjwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Nov 2020 Nov 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
sterlingwealthmanagement.co.uk sterlingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 281 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 5 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
stevenheyes.co.uk stevenheyes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
stevereeswealthmanagement.co.uk stevereeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
abacuswm.co.uk abacuswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
adambentonwm.co.uk adambentonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 46 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
carpenterwealthmanagement.co.uk carpenterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 102 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
tailoredsolutionswm.co.uk tailoredsolutionswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2023 1 year, 303 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
aswealthmanagement.co.uk aswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 51 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
athertonandassociates.co.uk athertonandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 51 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
terencegoddardassociates.co.uk terencegoddardassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 29 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
avonwoodfinancial.co.uk avonwoodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 52 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
thegrahamharmspractice.co.uk thegrahamharmspractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 29 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
ballantinewm.co.uk ballantinewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
thomas-rigg.co.uk thomas-rigg.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
UA UA-5583714 Jan 2021 Feb 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
throgmortonassociates.co.uk throgmortonassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bathwealth.co.uk bathwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
beckfordandlewis.co.uk beckfordandlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
bennisonyates.co.uk bennisonyates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
bhtwealthmanagement.co.uk bhtwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
uwmwealth.co.uk uwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 148 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Mar 2021 43 days
blackwaterwealthmanagement.co.uk blackwaterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
blenheimwealthmanagement.co.uk blenheimwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
vibrantwealthmanagement.co.uk vibrantwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
blossomwealth.co.uk blossomwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
vittyalexander.co.uk vittyalexander.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 274 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 112 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Feb 2021 Mar 2021 41 days
vswealth.co.uk vswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
bootefinancial.co.uk bootefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 158 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
watchhousewm.co.uk watchhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Jun 2021 105 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-W2ZFB5N Sep 2021 Oct 2021 44 days
UA UA-5583714 Feb 2021 Mar 2021 40 days
breretonjacksonfinancial.co.uk breretonjacksonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
westerhamfs.co.uk westerhamfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
UA UA-5583714 Feb 2021 Mar 2021 40 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
whitepeakwm.co.uk whitepeakwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
wilcoxday.co.uk wilcoxday.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Mar 2021 40 days
bryantassociates.co.uk bryantassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
wiltshirewm.co.uk wiltshirewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
wilkinsonwealth.co.uk wilkinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 100 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
burfieldshousewm.co.uk burfieldshousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
callumleachwm.co.uk callumleachwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 237 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
cedarswm.co.uk cedarswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
cedarvalegroup.co.uk cedarvalegroup.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 127 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
christianjohnwm.co.uk christianjohnwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
chronoswm.co.uk chronoswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
cockbainassociates.co.uk cockbainassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
coenandclark.co.uk coenandclark.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
cooksonwm.co.uk cooksonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
corneliuswealth.co.uk corneliuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
countrysidefs.co.uk countrysidefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
cranwellws.co.uk cranwellws.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 63 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
crawforddean.co.uk crawforddean.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
curzonwm.com curzonwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
cyrpaillard.co.uk cyrpaillard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davewalkerwealthmanagement.co.uk davewalkerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 185 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidhillwealth.co.uk davidhillwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidmakin.co.uk davidmakin.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidmelrosewm.co.uk davidmelrosewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
dbsfinancial.co.uk dbsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
ddlwealthmanagement.co.uk ddlwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
deltawealth.co.uk deltawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
denmanfp.co.uk denmanfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
doreewm.co.uk doreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 55 days
doweswealthmanagement.co.uk doweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Nov 2020 55 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
drewharperfinancialconsultants.co.uk drewharperfinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
duncannunnwm.co.uk duncannunnwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
dwjwealth.co.uk dwjwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
dyerandcowm.co.uk dyerandcowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
edenwoodwealth.com edenwoodwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
financialwealthsolutions.co.uk financialwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
flavellwm.co.uk flavellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 27 days
florastamato.co.uk florastamato.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
forbesfinancial.co.uk forbesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
foremostfinancial.net foremostfinancial.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 92 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
haycockandgricefp.co.uk haycockandgricefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
garryjohnsonwealthmanagement.co.uk garryjohnsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
garymorrisonwm.co.uk garymorrisonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
hayesfinancialplanning.com hayesfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
gcadurham.co.uk gcadurham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
gildedwealth.co.uk gildedwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
gillisfinancial.co.uk gillisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2023 1 year, 204 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
ginderswm.co.uk ginderswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 303 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
godfreywealthmanagement.co.uk godfreywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
grahamwealthmanagement.co.uk grahamwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
greavesfinancialservices.co.uk greavesfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
gregjmiddleton.co.uk gregjmiddleton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 1 day
HJ HJ-946865 Oct 2020 Oct 2020 One Off
guthriewealthconsultancy.co.uk guthriewealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hadlowedwards.co.uk hadlowedwards.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
harnhill.com harnhill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
harriesfinancial.co.uk harriesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hartfordwealth.co.uk hartfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
hartleywm.co.uk hartleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
heritagefc.co.uk heritagefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
hesslewoodwm.co.uk hesslewoodwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 74 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 31 days
hillandcofa.co.uk hillandcofa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
horizonwealthconsultancy.co.uk horizonwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
houghtonwm.co.uk houghtonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 153 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 31 days
howardfinancialplanning.co.uk howardfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 300 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 31 days
hutchinsonwealthmanagement.co.uk hutchinsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
hwlwm.co.uk hwlwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
igwm.co.uk igwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 361 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
investasure.co.im investasure.co.im
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 360 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Nov 2020 32 days
jamielewington.co.uk jamielewington.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2022 50 days
UA UA-5583714 Jan 2021 Jan 2021 5 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 5 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
jeanlamb.co.uk jeanlamb.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2023 1 year, 320 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jennerwm.co.uk jennerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
jerimeattah.co.uk jerimeattah.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 257 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jmswealthmanagement.co.uk jmswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
johncummingswm.co.uk johncummingswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jon-paulhardy.co.uk jon-paulhardy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jonathangrantwealth.co.uk jonathangrantwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
jonpittey.co.uk jonpittey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 238 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
jopottsfinancialplanning.co.uk jopottsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jpnfinancial.co.uk jpnfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 288 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
julianspencerwm.co.uk julianspencerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
juliedaweswealthmanagement.co.uk juliedaweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
juliehowiesonwealthmanagement.co.uk juliehowiesonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
kathwilkinson.co.uk kathwilkinson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
kennettwealthmanagement.co.uk kennettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
kevindavieswm.co.uk kevindavieswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 311 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
keystonefinancial.co.uk keystonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
kineticwealthmanagement.co.uk kineticwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
kirbyknott.co.uk kirbyknott.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 148 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
kudoswealth.com kudoswealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 182 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
lehmannfinancialmanagement.co.uk lehmannfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
lenwalters.co.uk lenwalters.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 310 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
lesterbrunt.co.uk lesterbrunt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 313 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
lfhwealthmanagement.co.uk lfhwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
lisaleewealthmanagement.co.uk lisaleewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
littlepebbles.co.uk littlepebbles.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
lockingtonfinancial.co.uk lockingtonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
louisewoollardfinancial.co.uk louisewoollardfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 352 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
lukecarless.co.uk lukecarless.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 352 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
lynnanderson.co.uk lynnanderson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 351 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
marknieldwm.co.uk marknieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
marquewealth.co.uk marquewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
marsonwm.co.uk marsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
martellowealth.co.uk martellowealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 244 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
masperoassociates.co.uk masperoassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
matthewgreenhalgh.co.uk matthewgreenhalgh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
maylamfinancial.co.uk maylamfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 348 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
mbarclay.co.uk mbarclay.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Jan 2021 10 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
meadwm.co.uk meadwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
mercianwm.co.uk mercianwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
mglwealthmanagement.co.uk mglwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 66 days
UA UA-5583714 Jan 2021 Jan 2021 11 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
michaelkiener.co.uk michaelkiener.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 102 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
mjbfp.co.uk mjbfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
mkm-wealth.co.uk mkm-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 103 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
mountstuartwm.co.uk mountstuartwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 294 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 41 days
mwcarefeesadvice.co.uk mwcarefeesadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2022 237 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 41 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
myerswealthmanagement.co.uk myerswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 105 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
neilforeman.co.uk neilforeman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 199 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 15 days
UA UA-5583714 Jan 2021 Jan 2021 13 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
newmanrea.com newmanrea.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
nickspence.co.uk nickspence.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
oakmerewealth.co.uk oakmerewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
oakridge-partners.co.uk oakridge-partners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 95 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Nov 2020 Nov 2020 15 days
paularodriguez.co.uk paularodriguez.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
paulbutlerwm.co.uk paulbutlerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
paulmkavanagh.co.uk paulmkavanagh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 343 days
GTM GTM-58PXN8T Jan 2021 May 2021 97 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
paulmorganwealthmanagement.co.uk paulmorganwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
rickettsfp.co.uk rickettsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
penninewealthmanagement.co.uk penninewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
peterallensjp.co.uk peterallensjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Jan 2021 16 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 16 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
petermooresjp.co.uk petermooresjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 218 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
peterwildwealth.co.uk peterwildwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 1 year, 8 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
primusfinancial.co.uk primusfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
priorywealthmanagement.co.uk priorywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 219 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 152 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
prosperawealth.co.uk prosperawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
prudentfpa.co.uk prudentfpa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
ptrembeth.co.uk ptrembeth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 75 days
UA UA-5583714 Jan 2021 Jan 2021 17 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
puxleypartnership.co.uk puxleypartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
pwandpartners.co.uk pwandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2022 331 days
GTM GTM-58PXN8T Jan 2021 May 2021 123 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
rachaelbellwealthmanagement.co.uk rachaelbellwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
rajivprabhakar.co.uk rajivprabhakar.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
randallwm.co.uk randallwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
richardbrewster.co.uk richardbrewster.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 55 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
abbeywealthmanagement.co.uk abbeywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 121 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
rodneyspillerwm.co.uk rodneyspillerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
roseassociatesfp.co.uk roseassociatesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lorrainecoaton.co.uk lorrainecoaton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 352 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
rtwwealth.co.uk rtwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lucialangella.co.uk lucialangella.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 352 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
ryleywm.co.uk ryleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 1 year, 10 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 20 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
samrawm.co.uk samrawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
UA UA-5583714 Jan 2021 Feb 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
adamsandbowleswm.co.uk adamsandbowleswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 46 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
sarahmhughes.co.uk sarahmhughes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 221 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
savvideswealthmanagement.co.uk savvideswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 336 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
scottjamesandassociates.co.uk scottjamesandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
alanhillfp.co.uk alanhillfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 47 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
alpewealthmanagement.co.uk alpewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 106 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
shaunajhappan.co.uk shaunajhappan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
alisongregorywm.co.uk alisongregorywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
alexziff.com alexziff.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
simonlipp.co.uk simonlipp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
almavalewealthmanagement.co.uk almavalewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 154 days
UA UA-5583714 Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
silvertreewm.co.uk silvertreewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
UA UA-5583714 Jan 2021 Feb 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
smartinfinancialplanning.co.uk smartinfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 222 days
UA UA-5583714 Jan 2021 Feb 2021 24 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 24 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
smithjackson.co.uk smithjackson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Feb 2021 24 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
sneddonfp.co.uk sneddonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 333 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
askwealthmanagement.co.uk askwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 51 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
anderson-wealthmanagement.co.uk anderson-wealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andersonfinancial.co.uk andersonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
andrewconnolly.co.uk andrewconnolly.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
spillaneandcompany.co.uk spillaneandcompany.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
carterlegrand.co.uk carterlegrand.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
casewealth.co.uk casewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
stanleyfinancial.co.uk stanleyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 148 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
stevenswealthmanagement.co.uk stevenswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 26 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
stilgoefm.co.uk stilgoefm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 56 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
atlanticwealth.co.uk atlanticwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 104 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
aagwealthmanagement.co.uk aagwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
swindonfinancialservices.com swindonfinancialservices.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 27 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
taitfinancialservices.co.uk taitfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
tarnwealthmanagement.co.uk tarnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
taylorfinancial.co.uk taylorfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 28 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
thindwealthadvisory.co.uk thindwealthadvisory.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 227 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 117 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Feb 2021 1 day
thomaswealthadvisory.co.uk thomaswealthadvisory.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
UA UA-5583714 Jan 2021 Feb 2021 32 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
thomlinsonwealthmanagement.co.uk thomlinsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
bathandwestwealth.co.uk bathandwestwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
treskelionfp.co.uk treskelionfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
UA UA-5583714 Jan 2021 Feb 2021 33 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
trevorngraham.co.uk trevorngraham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 114 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
twelvewm.co.uk twelvewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
UA UA-5583714 Feb 2021 Mar 2021 44 days
twomeywm.co.uk twomeywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Mar 2021 44 days
bhwml.co.uk bhwml.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Oct 2020 17 days
valantineassociates.co.uk valantineassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 124 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Mar 2021 43 days
villageestatesfc.co.uk villageestatesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 36 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
virtuewealthsolutions.co.uk virtuewealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
watchoakpw.co.uk watchoakpw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 143 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Feb 2021 Mar 2021 41 days
bowaterwealth.co.uk bowaterwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2022 228 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
westbrookfs.co.uk westbrookfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
westgatewealth.co.uk westgatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
wharfebank.co.uk wharfebank.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
brianemslie.co.uk brianemslie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
bricknellwealth.co.uk bricknellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 18 days
bridgesandco.co.uk bridgesandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
whitewm.co.uk whitewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 8 days
broadcharepartners.co.uk broadcharepartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
wilkinsonfinancialmgt.co.uk wilkinsonfinancialmgt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
willgcunningham.co.uk willgcunningham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
wilsonwealthmanagement.co.uk wilsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
wjpickering.co.uk wjpickering.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wolfewealth.co.uk wolfewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
woodstockwealthmanagement.co.uk woodstockwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
burn-joneswealthmanagement.co.uk burn-joneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
burtonhills.co.uk burtonhills.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
UA UA-5583714 Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
wyefieldwm.co.uk wyefieldwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
capitalplanningpartners.co.uk capitalplanningpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
castellwm.co.uk castellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
cathedralgreenfinancialplanning.co.uk cathedralgreenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 359 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
claytondenefp.co.uk claytondenefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 29 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
clearwaterwealthmanagement.co.uk clearwaterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2022 257 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
coldfairwealthmanagement.co.uk coldfairwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
colefinancial.co.uk colefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
colinjessopp.co.uk colinjessopp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
colinrexwm.co.uk colinrexwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 29 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
corinthianwealthmanagement.co.uk corinthianwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
cotswoldwealth.co.uk cotswoldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
ctpwm.co.uk ctpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 64 days
HJ HJ-946865 Oct 2020 Oct 2020 22 days
dalejohnsonwealthmanagement.co.uk dalejohnsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
daleycroft.co.uk daleycroft.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
dalviwealth.co.uk dalviwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 310 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidgallagherwm.com davidgallagherwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
daviswealth.co.uk daviswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
deltachelmsford.co.uk deltachelmsford.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
djbrewsterfcs.co.uk djbrewsterfcs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 55 days
duleypractice.co.uk duleypractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
dwbwealth.co.uk dwbwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
dwmfp.co.uk dwmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
eadenwm.co.uk eadenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
educate-financial.co.uk educate-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
ejwm.co.uk ejwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 99 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
farrowwealth.co.uk farrowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 27 days
fortemfm.co.uk fortemfm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
heraldwealth.co.uk heraldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 31 days
fyldewealthmanagement.co.uk fyldewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
garywalker.co.uk garywalker.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
gdcfinancialadvisers.co.uk gdcfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 91 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
genoawealthmanagement.co.uk genoawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
germainfinancial.co.uk germainfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 118 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
gilsongrayfinancial.co.uk gilsongrayfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 116 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
goldsmithwm.co.uk goldsmithwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
goodallsmith.co.uk goodallsmith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 29 days
gregorywm.co.uk gregorywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
gregthomsonwealth.co.uk gregthomsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
griersonwm.co.uk griersonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
grovewoodwealth.co.uk grovewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
hallandcostellowealthmanagement.co.uk hallandcostellowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 114 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hamesassociates.co.uk hamesassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
hamwicwealth.co.uk hamwicwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
havenwealthmanagement.co.uk havenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 281 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
hetalpatelwealth.co.uk hetalpatelwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 31 days
highhousewealth.co.uk highhousewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 31 days
hilljohnstone.co.uk hilljohnstone.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 167 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
howefinancialadvisers.co.uk howefinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
ianhuntwm.co.uk ianhuntwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
invictuswealth.co.uk invictuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 360 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-946865 Oct 2020 Nov 2020 32 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
iptucker.co.uk iptucker.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 360 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
islinwm.co.uk islinwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 360 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
jameselliottwealthmanagement.co.uk jameselliottwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 359 days
GTM GTM-58PXN8T Jan 2021 May 2021 121 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
jfwealth.co.uk jfwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
johnclementswealthmanagement.co.uk johnclementswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 71 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jpswealthmanagement.co.uk jpswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 197 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
kearsleyfinancialmanagement.co.uk kearsleyfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
kevinmunrofp.co.uk kevinmunrofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
kevinprobertwealthmanagement.co.uk kevinprobertwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 311 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 72 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
kmosbyfinancial.co.uk kmosbyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 183 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
kpwoodandassociates.co.uk kpwoodandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 355 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
las-wealth.co.uk las-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
latorrewealthmanagement.co.uk latorrewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
leedowdall.com leedowdall.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
leeswm.co.uk leeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
littlewickwealthmanagement.co.uk littlewickwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 63 days
UA UA-5583714 Jan 2021 Jan 2021 8 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
liztuccy.co.uk liztuccy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
louisewarland.co.uk louisewarland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 352 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 88 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
magorwealthmanagement.co.uk magorwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 183 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mardons.co.uk mardons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 153 days
UA UA-5583714 Jan 2021 Feb 2021 44 days
HJ HJ-946865 Oct 2020 Oct 2020 11 days
marshallwealthmanagement.co.uk marshallwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
martinkeyte.co.uk martinkeyte.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
matrixwp.co.uk matrixwp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
matthewjohnrowland.co.uk matthewjohnrowland.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 124 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
matthewwykes.co.uk matthewwykes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
mccuewealthmanagement.co.uk mccuewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Oct 2020 3 days
mercerandassociates.co.uk mercerandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 76 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
metcalfewealth.co.uk metcalfewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
michaelmacauley.co.uk michaelmacauley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Jan 2021 11 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 11 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
murraywealthmanagement.co.uk murraywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 93 days
UA UA-5583714 Jan 2021 Mar 2021 66 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
napierlane.com napierlane.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 42 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
navigationwm.co.uk navigationwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 106 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 42 days
networkventuresfs.co.uk networkventuresfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 289 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
newmanlangley.co.uk newmanlangley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 141 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
nicholsonwm.co.uk nicholsonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 107 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
nickclarkwm.co.uk nickclarkwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 1 year, 6 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
nickcumminswealthmanagement.co.uk nickcumminswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
osmanwealth.co.uk osmanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 96 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
palmerwealth.co.uk palmerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 72 days
UA UA-5583714 Jan 2021 Jan 2021 15 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
papewealthmanagement.co.uk papewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 112 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
GTM GTM-W2ZFB5N Sep 2021 Oct 2021 25 days
paulabicknellwealth.co.uk paulabicknellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 72 days
UA UA-5583714 Jan 2021 Jan 2021 15 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
paulasherlock-cross.co.uk paulasherlock-cross.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
paulgeddeswm.co.uk paulgeddeswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
pdavisfinancial.co.uk pdavisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 113 days
HJ HJ-946865 Nov 2020 Nov 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
persellewart.co.uk persellewart.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
pfpswm.com pfpswm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
plummerandassociates.co.uk plummerandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 99 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
poundburywealth.co.uk poundburywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
probertwealthmanagement.co.uk probertwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 75 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
psgwealth.co.uk psgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
quaysidewealthmanagement.co.uk quaysidewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 75 days
UA UA-5583714 Jan 2021 Jan 2021 18 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
queenssquarewealth.co.uk queenssquarewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 219 days
UA UA-5583714 Jan 2021 Jan 2021 18 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 18 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
rebeccapope.co.uk rebeccapope.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Jan 2021 18 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 18 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
reeswealthmanagement.co.uk reeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 51 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 18 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
leeblissettwealthmanagement.co.uk leeblissettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
legacywealth.sg legacywealth.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lifetimeconnections.co.uk lifetimeconnections.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
lisawickenswm.co.uk lisawickenswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 28 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
lpwealth.co.uk lpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 55 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
marclbennett.co.uk marclbennett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
marcsmelt.co.uk marcsmelt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jan 2021 14 days
UA UA-5583714 Jan 2021 Jan 2021 10 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
minsterwealthmanagement.co.uk minsterwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 136 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
moorewealth.co.uk moorewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 93 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
npfc.co.uk npfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2022 1 year, 6 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 38 days
one-wealth.co.uk one-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 274 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 71 days
UA UA-5583714 Jan 2021 Jan 2021 14 days
paulgschofield.co.uk paulgschofield.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 42 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 2 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
petergavin.net petergavin.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 98 days
UA UA-5583714 Jan 2021 Mar 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
ridlandwealth.co.uk ridlandwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
robertshawsidlow-wealth.co.uk robertshawsidlow-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 48 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
rppw.co.uk rppw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
mgwealth.co.uk mgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
silverdomefinancial.co.uk silverdomefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 23 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
smtwealth.co.uk smtwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2023 1 year, 263 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 82 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
snwfinancialplanning.co.uk snwfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-5583714 Jan 2021 Feb 2021 24 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 24 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
andrewwhiting.co.uk andrewwhiting.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 14 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 13 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
stroudwm.co.uk stroudwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2023 1 year, 303 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
sullivanwealthmanagement.co.uk sullivanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 133 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 27 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
taffetsaufferwm.co.uk taffetsaufferwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 22 days
HJ HJ-946865 Oct 2020 Oct 2020 6 days
barnesrobertson.com barnesrobertson.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
bedfordwm.co.uk bedfordwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 99 days
UA UA-5583714 Jan 2021 Mar 2021 53 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
vcpc.co.uk vcpc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 123 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
walfordwealth.co.uk walfordwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 149 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
walkerwm.co.uk walkerwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Feb 2021 37 days
willgrace.co.uk willgrace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2022 339 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
bullwm.co.uk bullwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 159 days
HJ HJ-946865 Oct 2020 Nov 2020 39 days
chasebridgewm.co.uk chasebridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
coulterweir.co.uk coulterweir.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
davidbeanwealth.co.uk davidbeanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
deanstevenswm.co.uk deanstevenswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
douglasrowefs.co.uk douglasrowefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
easternwealth.co.uk easternwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
eatlywm.co.uk eatlywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2023 1 year, 322 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
experiumfinancialservices.co.uk experiumfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
frizzellandpartners.co.uk frizzellandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 58 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
frizzellwm.co.uk frizzellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 91 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
graywealth.co.uk graywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 79 days
UA UA-5583714 Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
hallwealth.co.uk hallwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 52 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
iccwealthmanagement.co.uk iccwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Apr 2023 1 year, 138 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 112 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
irpwealth.co.uk irpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Apr 2021 Jun 2021 82 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
iwmwealth.co.uk iwmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 298 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 110 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jamiecalder.co.uk jamiecalder.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 33 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
johncharper.co.uk johncharper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 60 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
kdmurraywm.co.uk kdmurraywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jan 2021 6 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
UA UA-5583714 Jan 2021 Jan 2021 One Off
kimdevinefp.co.uk kimdevinefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
joybarden.co.uk joybarden.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
keithwilliamsfinancial.co.uk keithwilliamsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 78 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
leemerrettwealthmanagement.co.uk leemerrettwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 181 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 157 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
miwealth.co.uk miwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
moifc.co.uk moifc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 92 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
ninewealth.co.uk ninewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 37 days
HJ HJ-946865 Nov 2020 Nov 2020 One Off
pinnaclewealth.co.uk pinnaclewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
polarisfp.co.uk polarisfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2023 1 year, 171 days
HJ HJ-946865 Oct 2020 Nov 2020 44 days
GTM GTM-58PXN8T Mar 2021 May 2021 41 days
rhodesbrook.co.uk rhodesbrook.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
richardpaddle.com richardpaddle.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
ridley-jones.co.uk ridley-jones.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 278 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
robertcompton.co.uk robertcompton.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 52 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
sjpp.asia sjpp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 107 days
UA UA-5583714 Feb 2021 Mar 2021 54 days
amgwealthmanagement.com amgwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 31 days
GTM GTM-58PXN8T Feb 2021 Mar 2021 14 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
andrewspillane.co.uk andrewspillane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-5583714 Jan 2021 Mar 2021 49 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 49 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andrewtodd-sjp.co.uk andrewtodd-sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
UA UA-5583714 Jan 2021 Mar 2021 49 days
sterlingsolutionsltd.co.uk sterlingsolutionsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
stowwm.co.uk stowwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 21 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
tandhfinancialplanning.co.uk tandhfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 134 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 63 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
templemewswm.co.uk templemewswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 140 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
avantiwm.co.uk avantiwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
ayeshakhanfinancialplanning.co.uk ayeshakhanfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
berkeleystjames-wm.co.uk berkeleystjames-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 99 days
UA UA-5583714 Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
victoria-lawson.co.uk victoria-lawson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
UA UA-5583714 Jan 2021 Feb 2021 36 days
williamsandassociatesfa.co.uk williamsandassociatesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 135 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
woodruffhill.co.uk woodruffhill.co.uk
Attribute Value First Detected Last Detected Overlap Duration
UA UA-5583714 Jan 2021 Feb 2021 39 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
cassidyfinancial.co.uk cassidyfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 59 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
darrenford.co.uk darrenford.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidsonpert.co.uk davidsonpert.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 185 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
dmbwealthmanagement.co.uk dmbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 67 days
dpfinplan.com dpfinplan.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
ellisonedwardswm.co.uk ellisonedwardswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 187 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
frcfinancialplanning.co.uk frcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
hawthornewealthmanagement.com hawthornewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Nov 2020 29 days
hillcrestwm.co.uk hillcrestwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 114 days
HJ HJ-946865 Nov 2020 Nov 2020 One Off
illingworthseddon.co.uk illingworthseddon.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 81 days
UA UA-5583714 Jan 2021 Mar 2021 74 days
HJ HJ-946865 Oct 2020 Nov 2020 32 days
iqandco.com iqandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 299 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 110 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jayramfinancialservices.co.uk jayramfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 32 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 6 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
jlwealthconsultancy.co.uk jlwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 34 days
robertapugh.co.uk robertapugh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
russellpikefinancial.co.uk russellpikefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 79 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
schoolfeessolutions.co.uk schoolfeessolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
simplicityfp.co.uk simplicityfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 23 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 23 days
stefaniepricewealth.co.uk stefaniepricewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
storercfp.co.uk storercfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
thegroveprivatewealthltd.co.uk thegroveprivatewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
batchworthwealth.co.uk batchworthwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 16 days
cmjfinancialplanning.co.uk cmjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 278 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 162 days
HJ HJ-946865 Oct 2020 Oct 2020 21 days
davidjwalsh.co.uk davidjwalsh.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
demellowandco.com demellowandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
dominicmarcus.co.uk dominicmarcus.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
HJ HJ-946865 Oct 2020 Oct 2020 24 days
dsmcdermottfinancialplanning.co.uk dsmcdermottfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 164 days
UA UA-5583714 Jan 2021 Mar 2021 69 days
edmundwilson.co.uk edmundwilson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
elliottwealthmanagement.co.uk elliottwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
UA UA-5583714 Jan 2021 Mar 2021 71 days
enverwm.co.uk enverwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Oct 2020 26 days
firmitasfs.co.uk firmitasfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-946865 Oct 2020 Oct 2020 27 days
frankmcmillan.co.uk frankmcmillan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
gardnerwealthmanagement.co.uk gardnerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
hayeswealthmanagement.co.uk hayeswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 80 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
gqwm.co.uk gqwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
guildfordfinancial.co.uk guildfordfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
GTM GTM-58PXN8T Mar 2021 Jun 2021 115 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
hampshirefinancialplanning.co.uk hampshirefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 79 days
UA UA-5583714 Jan 2021 Mar 2021 76 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
iancrookwm.co.uk iancrookwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jan 2021 6 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
UA UA-5583714 Jan 2021 Jan 2021 One Off
impactwm.co.uk impactwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 361 days
HJ HJ-946865 Oct 2020 Nov 2020 58 days
GTM GTM-58PXN8T May 2021 Jun 2021 45 days
jacquinorman.co.uk jacquinorman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 359 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 110 days
HJ HJ-946865 Oct 2020 Nov 2020 32 days
jeremybarrett.co.uk jeremybarrett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 54 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
lionbridgewealth.co.uk lionbridgewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-946865 Nov 2020 Nov 2020 One Off
lisaeveritt.co.uk lisaeveritt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 161 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
lizmaudsleyfinancialplanning.co.uk lizmaudsleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 106 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
malcolmfrost.co.uk malcolmfrost.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 38 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 4 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
mbwwealthmanagement.co.uk mbwwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
mellingfp.co.uk mellingfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
UA UA-5583714 Jan 2021 Mar 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
meridianadvice.co.uk meridianadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
nigelcookewm.co.uk nigelcookewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 94 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
njwealthplanning.co.uk njwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 70 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
oreillywealthmanagement.co.uk oreillywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 45 days
GTM GTM-58PXN8T May 2021 May 2021 One Off
richardjdavies.co.uk richardjdavies.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 77 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
richardmarshall.co.uk richardmarshall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
pdfinancialmanagement.co.uk pdfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 113 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
HJ HJ-946865 Oct 2020 Nov 2020 47 days
perowealthmanagement.co.uk perowealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
peter-walmsley.co.uk peter-walmsley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 73 days
UA UA-5583714 Jan 2021 Jan 2021 16 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
pjwwealth.co.uk pjwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 151 days
HJ HJ-946865 Oct 2020 Nov 2020 48 days
placidgonzales.co.uk placidgonzales.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jan 2021 17 days
UA UA-5583714 Jan 2021 Jan 2021 16 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
portburywealth.co.uk portburywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 99 days
UA UA-5583714 Jan 2021 Mar 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
richardcbooth.co.uk richardcbooth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 19 days
richardjkbrown.co.uk richardjkbrown.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 19 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
rmbfc.co.uk rmbfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
rppw.sg rppw.sg
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 55 days
rsrobertsonfp.co.uk rsrobertsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 221 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
accessionrwm.co.uk accessionrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 12 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sarahspraguewealthmanagement.co.uk sarahspraguewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 54 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
allenfinancial.co.uk allenfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 119 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
simonbraywm.co.uk simonbraywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 56 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
apexfinancialservices.co.uk apexfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 155 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
carterlane.co.uk carterlane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 127 days
UA UA-5583714 Mar 2021 Mar 2021 20 days
stevensonwealthplanning.co.uk stevensonwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 5 days
stwwealth.co.uk stwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 223 days
GTM GTM-58PXN8T Feb 2021 Apr 2021 62 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
sunflowerfinancialplanning.co.uk sunflowerfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Feb 2021 27 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 27 days
tcolleyassociates.co.uk tcolleyassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
UA UA-5583714 Jan 2021 Feb 2021 28 days
williamsbirley.co.uk williamsbirley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 323 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
UA UA-5583714 Jan 2021 Feb 2021 38 days
willowbrooklfp.co.uk willowbrooklfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 150 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
woodheadwm.co.uk woodheadwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
UA UA-5583714 Jan 2021 Feb 2021 39 days
HJ HJ-946865 Oct 2020 Oct 2020 9 days
wrightshadwell.co.uk wrightshadwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 60 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
capitolfinancial.co.uk capitolfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 102 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
capstone-financial.co.uk capstone-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
UA UA-5583714 Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Oct 2020 19 days
consiliumwmltd.co.uk consiliumwmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 99 days
HJ HJ-946865 Oct 2020 Nov 2020 53 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
craigjameswm.co.uk craigjameswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 63 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
danielburnswm.co.uk danielburnswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 111 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
darronchildspractice.co.uk darronchildspractice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 361 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
davidkeddie.co.uk davidkeddie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 163 days
UA UA-5583714 Jan 2021 Mar 2021 65 days
edwardjowilson.co.uk edwardjowilson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
fisherwealthconsultancy.co.uk fisherwealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 48 days
HJ HJ-946865 Oct 2020 Oct 2020 27 days
flynnwealthmanagement.co.uk flynnwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 168 days
HJ HJ-946865 Oct 2020 Oct 2020 28 days
hemmensfinancial.co.uk hemmensfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 114 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
hydewealthmanagement.co.uk hydewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
HJ HJ-946865 Oct 2020 Nov 2020 30 days
jamesbarnett.co.uk jamesbarnett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 359 days
GTM GTM-58PXN8T Mar 2021 Apr 2021 29 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
jamescurriefinancialsolutions.co.uk jamescurriefinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 May 2021 121 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
jamestrickett.co.uk jamestrickett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 83 days
UA UA-5583714 Jan 2021 Mar 2021 73 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
lambert-wealth.co.uk lambert-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
GTM GTM-58PXN8T Mar 2021 Jun 2021 107 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
ljwealthmanagement.co.uk ljwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 353 days
GTM GTM-58PXN8T May 2021 Jun 2021 38 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
lombardprivateclients.co.uk lombardprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
maclennanwealth.co.uk maclennanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 351 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
mandyrodgers.co.uk mandyrodgers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 104 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
UA UA-5583714 Jan 2021 Jan 2021 9 days
markkidd.co.uk markkidd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
GTM GTM-58PXN8T Mar 2021 May 2021 68 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
mayflowerfinancialplanning.co.uk mayflowerfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 212 days
GTM GTM-58PXN8T Jan 2021 Apr 2021 90 days
HJ HJ-946865 Oct 2020 Nov 2020 38 days
mcleanandpartnerswm.co.uk mcleanandpartnerswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Oct 2020 2 days
mikestarkeywealthmanagement.co.uk mikestarkeywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
GTM GTM-58PXN8T Mar 2021 Mar 2021 One Off
milesnovotny.co.uk milesnovotny.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 56 days
GTM GTM-58PXN8T Jan 2021 Jan 2021 3 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
modus-wealth.co.uk modus-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Mar 2021 56 days
HJ HJ-946865 Oct 2020 Nov 2020 37 days
oloughlinandco.co.uk oloughlinandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 147 days
UA UA-5583714 Jan 2021 Jan 2021 14 days
pathwaywealthmanagement.co.uk pathwaywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
GTM GTM-58PXN8T Mar 2021 May 2021 40 days
pellegriniandbarlowassociates.co.uk pellegriniandbarlowassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 May 2021 113 days
UA UA-5583714 Jan 2021 Mar 2021 63 days
pineapplefp.co.uk pineapplefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Feb 2021 Feb 2021 One Off
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
pritchardwm.co.uk pritchardwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Jan 2021 18 days
UA UA-5583714 Jan 2021 Jan 2021 17 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
quantumprivateclients.co.uk quantumprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2023 1 year, 298 days
GTM GTM-58PXN8T Mar 2021 May 2021 65 days
HJ HJ-946865 Oct 2020 Nov 2020 46 days
regencywm.co.uk regencywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
UA UA-5583714 Jan 2021 Jan 2021 One Off
GTM GTM-58PXN8T Jan 2021 Jan 2021 One Off
pricewhitinghodgson.co.uk pricewhitinghodgson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2023 1 year, 174 days
HJ HJ-946865 Oct 2020 Nov 2020 55 days
rhiannongoghfp.co.uk rhiannongoghfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 58 days
HJ HJ-946865 Oct 2020 Nov 2020 52 days
bruceandassociates.co.uk bruceandassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
selectinvestors.hk selectinvestors.hk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Apr 2022 173 days
HJ HJ-946865 Oct 2020 Nov 2020 50 days
amwm.co.uk amwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
sjp.co.uk sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
spillaneassociates.co.uk spillaneassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
templecloudwm.co.uk templecloudwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 May 2022 246 days
UA UA-5583714 Jan 2021 Mar 2021 78 days
thompsonnorburyfinancialplanning.co.uk thompsonnorburyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 32 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
tim-watts.co.uk tim-watts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
timramptonwealthmanagement.com timramptonwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 283 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
tmpwealthmanagement.co.uk tmpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
beyondwm.co.uk beyondwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
blakebrooke.co.uk blakebrooke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
vickykleboe.co.uk vickykleboe.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2021 94 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
brecklandfinancialmanagement.co.uk brecklandfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
brewsterfinancialplanning.co.uk brewsterfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
westwealthmanagement.co.uk westwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 268 days
HJ HJ-946865 Oct 2020 Oct 2020 One Off
whitfieldwealth.co.uk whitfieldwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 112 days
bsjfinancialplanning.co.uk bsjfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2022 350 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 2 days
calderwealthmanagement.co.uk calderwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 313 days
GTM GTM-58PXN8T Apr 2021 Jun 2021 81 days
charlottepoolegraham.co.uk charlottepoolegraham.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
clearwaterwm.co.uk clearwaterwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
drpwm.com drpwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
ennveefinancial.co.uk ennveefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
forte-financial.co.uk forte-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
fortresswealthpartnership.com fortresswealthpartnership.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
gkbfinancialplanning.co.uk gkbfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
grazianolongo.co.uk grazianolongo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 63 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
regencywealthltd.co.uk regencywealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 203 days
HJ HJ-946865 Oct 2020 Oct 2020 14 days
rherbert.co.uk rherbert.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 15 days
bowbrookfp.co.uk bowbrookfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
adamjameswm.co.uk adamjameswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
allardwhiteley.co.uk allardwhiteley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jul 2023 1 year, 261 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
deptagency.com sjp-partner-nginx-prd-asia.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 152 days
anthonyanderson.co.uk anthonyanderson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
andrewhugheswm.co.uk andrewhugheswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
stringermann.com stringermann.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
swhfp.co.uk swhfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 272 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
avocetwealth.co.uk avocetwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 13 days
avonwoodfinancialplanning.co.uk avonwoodfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 312 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
tywm.co.uk tywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
btmwealth.co.uk btmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
willgrasscornishwealthmanagement.co.uk willgrasscornishwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 50 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
willgrasswealthmanagement.co.uk willgrasswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
carringtonbond.co.uk carringtonbond.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2022 350 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
zenithfinancial.co.uk zenithfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
crusewealth.com crusewealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 53 days
GTM GTM-58PXN8T Jan 2021 Feb 2021 43 days
danielgreenwm.co.uk danielgreenwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
denmanwealthmanagement.co.uk denmanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
ellisonwealth.co.uk ellisonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
ewenharris.co.uk ewenharris.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
fernbankwealth.co.uk fernbankwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
formanwealthmanagement.co.uk formanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
formfinancialclarity.co.uk formfinancialclarity.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 1 day
gardnerwealthmanagement.com gardnerwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
ghfinancialsolutions.co.uk ghfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
gillespiefinancialconsultancy.com gillespiefinancialconsultancy.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
rjvaughanwealth.co.uk rjvaughanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 78 days
HJ HJ-946865 Oct 2020 Oct 2020 4 days
sandgatewealth.co.uk sandgatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 49 days
advisorycube.co.uk advisorycube.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Feb 2021 Jun 2021 120 days
deptagency.com sjp-partner-nginx-prd.uk.deptagency.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 152 days
sjpfoundation.co.uk sjpfoundation.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
apwealth.co.uk apwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
stephenhopewealthmanagement.com stephenhopewealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 5 days
strategicwealthsolutions.co.uk strategicwealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 6 days
GTM GTM-58PXN8T Feb 2021 Feb 2021 One Off
avonwoodfinancialplanning.com avonwoodfinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2022 312 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
awwealth.co.uk awwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 1 day
thinkfinancialwealthmanagement.co.uk thinkfinancialwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 244 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
tomricketts.co.uk tomricketts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2022 208 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
bridgegatewm.co.uk bridgegatewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
whitepeakwm.uk whitepeakwm.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2021 45 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
calderwoodswm.co.uk calderwoodswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
catherinerichardson.co.uk catherinerichardson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 11 days
chartsmorewealthltd.co.uk chartsmorewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cheshirelifestyle.com cheshirelifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 20 days
GTM GTM-W2ZFB5N Sep 2023 Sep 2023 8 days
clachanviewwm.co.uk clachanviewwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
claremont-financial.co.uk claremont-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cogentfinancial.co.uk cogentfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
cpfc.org.uk cpfc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
crossleythompson.co.uk crossleythompson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
eawealth.co.uk eawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 165 days
gillespiefinancial.co.uk gillespiefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
gillespiefinancialconsultancy.co.uk gillespiefinancialconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
gillespiefinancialconsultants.com gillespiefinancialconsultants.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
gittinsandco.com gittinsandco.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
glencastlefs.co.uk glencastlefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
jacksonfinancial.co.uk jacksonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 359 days
HJ HJ-946865 Oct 2020 Nov 2020 33 days
johnpeoples.co.uk johnpeoples.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Feb 2022 37 days
HJ HJ-946865 Oct 2020 Oct 2020 1 day
ltcsolutionsltd.co.uk ltcsolutionsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Jun 2022 74 days
HJ HJ-946865 Oct 2020 Nov 2020 57 days
markbeverley.co.uk markbeverley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Mar 2021 Jun 2021 103 days
UA UA-5583714 Mar 2021 Mar 2021 One Off
mooreforwealth.co.uk mooreforwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 347 days
HJ HJ-946865 Oct 2020 Nov 2020 41 days
nbwealthmanagement.co.uk nbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 7 days
acjordanwealthmanagement.co.uk acjordanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2022 214 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
alfristonwealth.co.uk alfristonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 244 days
HJ HJ-946865 Oct 2020 Oct 2020 13 days
steggleswm.co.uk steggleswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Feb 2021 Apr 2021 61 days
HJ HJ-946865 Oct 2020 Nov 2020 54 days
stricklandwealthmanagement.co.uk stricklandwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Oct 2020 20 days
stuartdavieswealthconsultancy.co.uk stuartdavieswealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 59 days
sutherlandmayfairwm.co.uk sutherlandmayfairwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 53 days
GTM GTM-W2ZFB5N Dec 2021 Dec 2021 One Off
avonwoodfinancial.com avonwoodfinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
baggermanwm.co.uk baggermanwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 156 days
towerhousewm.co.uk towerhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T May 2021 Jun 2021 9 days
wadewealthmanagement.co.uk wadewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
waltierwealthmanagement.co.uk waltierwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
boundstonewm.co.uk boundstonewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 18 days
GTM GTM-58PXN8T Apr 2021 Apr 2021 One Off
whcfp.co.uk whcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
whittowwilliamswalkerllp.co.uk whittowwilliamswalkerllp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Feb 2021 26 days
HJ HJ-946865 Oct 2020 Oct 2020 25 days
brightsidewealthmanagement.co.uk brightsidewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
chrishillsfc.co.uk chrishillsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
coleridgewm.co.uk coleridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
crownwealth.co.uk crownwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
debenprivatewealth.co.uk debenprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
denmanfp.com denmanfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
equinoxfinancialplanning.co.uk equinoxfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 166 days
etteca.asia etteca.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
frostwealthmanagement.co.uk frostwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 1 day
gillespiefinancialconsultants.co.uk gillespiefinancialconsultants.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
godivafinancialplanning.co.uk godivafinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 2 days
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
hearndenandwestonwm.co.uk hearndenandwestonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 169 days
kgrwealth.co.uk kgrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Apr 2021 91 days
HJ HJ-946865 Oct 2020 Nov 2020 35 days
markproberts.co.uk markproberts.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 36 days
millfieldwm.com millfieldwm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
HJ HJ-946865 Oct 2020 Nov 2020 40 days
nigelhelen.co.uk nigelhelen.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jan 2021 Mar 2021 57 days
HJ HJ-946865 Oct 2020 Nov 2020 43 days
sjp.asia partnership.sjp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 123 days
sjp.co.uk partnership.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
GTM GTM-58PXN8T Jan 2021 Jun 2021 160 days
ksfinancialadvisers.co.uk ksfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 173 days
kwmfp.co.uk kwmfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 135 days
lansdownplace.co.uk lansdownplace.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
lauriefp.co.uk lauriefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 130 days
legatumwealthmanagement.co.uk legatumwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 134 days
lewingtonwealth.co.uk lewingtonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 210 days
malcolmgibsonwealthmanagement.co.uk malcolmgibsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 204 days
loswealth.co.uk loswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 352 days
lwcwealthmanagement.co.uk lwcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 2 days
mackiewealthmanagement.co.uk mackiewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 34 days
macphail-kennedy.co.uk macphail-kennedy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 98 days
malikzadafp.co.uk malikzadafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 28 days
markgolesworthy.co.uk markgolesworthy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 349 days
mbfinancial-planning.co.uk mbfinancial-planning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Jun 2023 One Off
mdslackwealthmanagement.co.uk mdslackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 364 days
middletonfp.co.uk middletonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 39 days
mjwsjp.co.uk mjwsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 40 days
monteaglewm.co.uk monteaglewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 322 days
mrfinancial.info mrfinancial.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
neavewealth.co.uk neavewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 7 days
neilmorrisfinancial.co.uk neilmorrisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 241 days
maplewoodwealth.co.uk maplewoodwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 157 days
northwealthmanagement.co.uk northwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 286 days
npswealth.co.uk npswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
marcnorris.co.uk marcnorris.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
oaktreefinancial.asia oaktreefinancial.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
oliverwm.co.uk oliverwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Feb 2023 1 year, 145 days
opawealthmanagement.co.uk opawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 45 days
markeldor.co.uk markeldor.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 204 days
orchardfinancialassociates.co.uk orchardfinancialassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2023 6 days
paulmwilliams.co.uk paulmwilliams.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 42 days
peakfifteenfp.co.uk peakfifteenfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 198 days
pennygatefinancialassociates.co.uk pennygatefinancialassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 319 days
philippotterwealth.co.uk philippotterwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 342 days
markpattersonfp.co.uk markpattersonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 283 days
quaylifewm.co.uk quaylifewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 213 days
rhodianwm.co.uk rhodianwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
richardtidy.co.uk richardtidy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 90 days
abacuswealthservices.co.uk abacuswealthservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 14 days
robinsonfp.co.uk robinsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
rodgersfamilywealth.co.uk rodgersfamilywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 204 days
bwfinancialplanning.co.uk bwfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 340 days
rubywealth.co.uk rubywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
adnfp.co.uk adnfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 266 days
agilepensions.uk agilepensions.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2023 57 days
schofieldassociatesfp.co.uk schofieldassociatesfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
sdhandawealthmanagement.co.uk sdhandawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 282 days
searlesfinancial.co.uk searlesfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 49 days
selectinvestors.asia selectinvestors.asia
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 50 days
sjp.co.uk alumni.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2022 1 year, 54 days
skeltons.co.uk skeltons.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
solastawm.co.uk solastawm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2023 67 days
andrewdaldrywm.co.uk andrewdaldrywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 188 days
andrewpaynewm.co.uk andrewpaynewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 14 days
andrewvarleyfinancialplanning.co.uk andrewvarleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 14 days
spirewealth.co.uk spirewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
springwealth.co.uk springwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 256 days
srmfinancial.co.uk srmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 62 days
steeleaspire.co.uk steeleaspire.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2023 236 days
steelewealthmanagement.co.uk steelewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
stephenkingwealthmanagement.co.uk stephenkingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 20 days
stevenjerath.co.uk stevenjerath.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 5 days
swanwealthmanagement.co.uk swanwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 190 days
swindonfinancialadvisers.uk swindonfinancialadvisers.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
swindonfinancialservices.co.uk swindonfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
swindonfinancialservices.uk swindonfinancialservices.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
aswwm.co.uk aswwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 15 days
tarporleywealth.co.uk tarporleywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 161 days
tempuswealth.co.uk tempuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 6 days
terryhartley.co.uk terryhartley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
averywealthmanagement.co.uk averywealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 15 days
awfwm.co.uk awfwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
bainfa.co.uk bainfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 265 days
tmcfc.co.uk tmcfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 351 days
beaconfp.co.uk beaconfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 11 days
benhiles.co.uk benhiles.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 174 days
truitywealth.co.uk truitywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 159 days
tsfinancialplanning.co.uk tsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 21 days
ubuntuwealthmanagement.co.uk ubuntuwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 May 2023 296 days
beverleyfinancialmanagement.co.uk beverleyfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 49 days
bhwml.com bhwml.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Feb 2022 147 days
unaking.co.uk unaking.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 228 days
vfcwealthmanagement.co.uk vfcwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 158 days
vinewealth.co.uk vinewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 192 days
blythswood.com blythswood.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 63 days
whistonwealth.com whistonwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 192 days
willcoxwealthmanagement.co.uk willcoxwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Jul 2023 1 year, 96 days
rafflesplaceprivatewealth.com rafflesplaceprivatewealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 55 days
calderwoodfinancial.co.uk calderwoodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 171 days
cheshirewealthconsultancy.co.uk cheshirewealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 20 days
clareclarkson.co.uk clareclarkson.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 261 days
colewealthmanagement.co.uk colewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 296 days
darcyfp.co.uk darcyfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 310 days
dfwealthmanagement.co.uk dfwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 13 days
dlwm.co.uk dlwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2022 1 year, 112 days
dowdallwealthmanagement.co.uk dowdallwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 24 days
drsaqibkarim.co.uk drsaqibkarim.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 56 days
duncanmaw.co.uk duncanmaw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Aug 2022 133 days
eastgatewealthmanagementltd.co.uk eastgatewealthmanagementltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 25 days
edgintonstanley.co.uk edgintonstanley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 73 days
farisnori.co.uk farisnori.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 27 days
fifteenfinancialplanning.co.uk fifteenfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2023 44 days
firmstonewealth.co.uk firmstonewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 213 days
foresightfs.co.uk foresightfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 165 days
freddieansah.co.uk freddieansah.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 28 days
futureperfectwealthmanagement.co.uk futureperfectwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jun 2022 203 days
georgeshippam.co.uk georgeshippam.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 One Off
goldenacornfp.co.uk goldenacornfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 211 days
gpfp.co.uk gpfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 29 days
grahamlavinwealthmanagement.co.uk grahamlavinwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
graysonlewis.co.uk graysonlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Jun 2023 79 days
greenfortpw.com greenfortpw.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
gritstone-fp.co.uk gritstone-fp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 279 days
haydnlewis.co.uk haydnlewis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
hendredfinancialpartners.co.uk hendredfinancialpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
hipstagram.com hipstagram.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
hoadley-financial.co.uk hoadley-financial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 251 days
holmesfinancialplanning.co.uk holmesfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
hudsonandrogersfinancial.co.uk hudsonandrogersfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 39 days
ipswichfs.co.uk ipswichfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 360 days
jameshunwickewealthmanagement.co.uk jameshunwickewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jcrwealth.co.uk jcrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 80 days
jensenwealth.co.uk jensenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
joebointon.co.uk joebointon.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jonesregan.co.uk jonesregan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 297 days
jopowis.co.uk jopowis.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 68 days
julianhoweswealthmanagement.co.uk julianhoweswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
justicewealth.co.uk justicewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 247 days
kfhwm.co.uk kfhwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 135 days
kieranfowley.co.uk kieranfowley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 209 days
mentmorefp.co.uk mentmorefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 171 days
monriewm.co.uk monriewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 155 days
kaplan-planwell.co.uk kaplan-planwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
keyhavenwealth.co.uk keyhavenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2022 1 year, 28 days
keyplanwealth.co.uk keyplanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 328 days
knightturnerprivateclients.co.uk knightturnerprivateclients.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2023 1 year, 276 days
krc-wealth-management.co.uk krc-wealth-management.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 57 days
lafirmasantana.com lafirmasantana.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
lawcapitalwealth.co.uk lawcapitalwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
lpfinancial.co.uk lpfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 352 days
lucernawealth.com lucernawealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 218 days
malcolmodonovan.co.uk malcolmodonovan.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 57 days
mansionhousefinancialplanning.co.uk mansionhousefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 One Off
marginsfinancialsolutions.co.uk marginsfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 36 days
marklowewm.co.uk marklowewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 38 days
markwheatleywealth.co.uk markwheatleywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Nov 2021 76 days
michaelkylewm.co.uk michaelkylewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
midlandswealthmanagement.co.uk midlandswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
minsterfinancialplanning.co.uk minsterfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 282 days
mjonesandco.co.uk mjonesandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 40 days
moorefinancialwellbeing.co.uk moorefinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 213 days
msestatesandfinancialservices.co.uk msestatesandfinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 3 days
murfittwealth.co.uk murfittwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 41 days
myleschurchill.com myleschurchill.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
nandsfp.co.uk nandsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2022 One Off
neptunefinancialmanagement.co.uk neptunefinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
nightingalewealth.co.uk nightingalewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
oakridgewealth.co.uk oakridgewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 3 days
onewealthltd.co.uk onewealthltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 64 days
markcosgrave.co.uk markcosgrave.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 156 days
orangetreefs.co.uk orangetreefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 199 days
paulmageewealthmanagement.co.uk paulmageewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 42 days
powerfinancialmanagement.co.uk powerfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 197 days
priteshpankhania.com priteshpankhania.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2023 1 year, 341 days
marlowwealth.co.uk marlowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 206 days
richardburchnall.co.uk richardburchnall.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 48 days
rnpwealth.co.uk rnpwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 283 days
roxburghonline.co.uk roxburghonline.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 147 days
russellgreer.co.uk russellgreer.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
bradbyswm.co.uk bradbyswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 173 days
ryanmcguinnesswm.co.uk ryanmcguinnesswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 235 days
sjp-cloud.info accelerator.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
saltandlightfs.co.uk saltandlightfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 147 days
adeptiowm.co.uk adeptiowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 12 days
sarahmcgurkwealthmanagement.co.uk sarahmcgurkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 336 days
seekerfinancial.co.uk seekerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 23 days
shandandburnsfinancial.co.uk shandandburnsfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 274 days
sherpawealth.uk sherpawealth.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 238 days
allensykeswm.com allensykeswm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 13 days
albionhousewm.co.uk albionhousewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 78 days
mimigom.co.uk mimigom.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 213 days
siddonsand.co siddonsand.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 235 days
sigmafp.co.uk sigmafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 88 days
skylarkwealth.co.uk skylarkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
andrewgrayafp.co.uk andrewgrayafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 81 days
sophiederouet.co.uk sophiederouet.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Oct 2021 36 days
spco.co.uk spco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
srgwealthmanagement.co.uk srgwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2023 66 days
steadfastwm.co.uk steadfastwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 230 days
stoneswealth.co.uk stoneswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
stpetersfinancialplanning.co.uk stpetersfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
suffolkfp.co.uk suffolkfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2022 One Off
summitfinancial.asia summitfinancial.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 230 days
agilelife.uk agilelife.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2023 Sep 2023 57 days
asmwealth.com asmwealth.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
tedreesltd.co.uk tedreesltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
availfinancialplanning.co.uk availfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 77 days
thelockyerpartnership.co.uk thelockyerpartnership.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2023 233 days
tomworley.co.uk tomworley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
torweybridge.co.uk torweybridge.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 22 days
truenorthfp.co.uk truenorthfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 270 days
vantagewm.co.uk vantagewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 274 days
vaughanwealth.co.uk vaughanwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 317 days
virtusfp.co.uk virtusfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
wandco-fp.co.uk wandco-fp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 8 days
walmsleyfinancialplanning.co.uk walmsleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 324 days
whfinancialwellbeing.co.uk whfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
whrwealthmanagement.co.uk whrwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 323 days
brwm.org.uk brwm.org.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 92 days
woodmitchellfp.com woodmitchellfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 139 days
calderdaviswealthmanagement.co.uk calderdaviswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 18 days
cambridgefinancialadvisers.co.uk cambridgefinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 110 days
carefeeadvice.co.uk carefeeadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 51 days
carrfinancialplanning.co.uk carrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 312 days
charlesjoneswealthmanagement.co.uk charlesjoneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 312 days
clarkwm.co.uk clarkwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 321 days
cooperassociateswm.com cooperassociateswm.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 53 days
darrenknibbwealthmanagement.co.uk darrenknibbwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 147 days
davesouthbyfp.co.uk davesouthbyfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 146 days
davidjohnsonfp.co.uk davidjohnsonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davidsonfinancialplanning.co.uk davidsonfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 183 days
earleywm.co.uk earleywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 188 days
edwardtrehearne.co.uk edwardtrehearne.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 11 days
emeraldassociates.co.uk emeraldassociates.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 306 days
excaliburwm.co.uk excaliburwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 127 days
familytreewealthmanagement.co.uk familytreewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 215 days
farrierrose.co.uk farrierrose.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 254 days
financialmerrett.co.uk financialmerrett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 134 days
macaulaywm.co.uk macaulaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 351 days
francefinancial.co.uk francefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 254 days
frontierwealth.co.uk frontierwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 126 days
futurumfa.co.uk futurumfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 147 days
gapstowwealth.co.uk gapstowwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
greatoakfp.co.uk greatoakfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 1 year, 8 days
gregorhowitt.co.uk gregorhowitt.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 303 days
hillsidefinancialplanning.co.uk hillsidefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 363 days
hjpcfp.com hjpcfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 177 days
hodgewealthmanagement.co.uk hodgewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 177 days
horshamfinancial.co.uk horshamfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Sep 2023 1 year, 103 days
huntminasfinancial.co.uk huntminasfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 39 days
integralwm.co.uk integralwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 360 days
ivanhoefp.co.uk ivanhoefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 121 days
jamesbournewm.com jamesbournewm.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 359 days
jckfinancialeducation.co.uk jckfinancialeducation.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 One Off
jgriver.co jgriver.co
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 37 days
cordnerwealthmanagement.co.uk cordnerwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 130 days
eatonwealthmanagement.co.uk eatonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Sep 2023 1 year, 108 days
gnkwealthmanagement.co.uk gnkwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 333 days
rebeccabailey.co.uk rebeccabailey.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
reflectfp.co.uk reflectfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
repositorywealth.co.uk repositorywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 148 days
rmcfp.co.uk rmcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
acwwealthmanagement.co.uk acwwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 12 days
hauxwellwealthmanagement.co.uk hauxwellwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 1 year, 7 days
saxtonfp.co.uk saxtonfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 218 days
scottjameswealthmanagement.co.uk scottjameswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 282 days
scrimgerandoakes.co.uk scrimgerandoakes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
seven-wealth.co.uk seven-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 335 days
allardwealth.co.uk allardwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 13 days
shawfieldwealthmanagement.co.uk shawfieldwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 315 days
shearwoodfinancialmanagement.co.uk shearwoodfinancialmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
silveroakfs.co.uk silveroakfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
sjmfinancial.co.uk sjmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 334 days
sjp.asia sjp.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
autuswealth.co.uk autuswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 151 days
antlerwealth.com antlerwealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 45 days
antlerwealth.asia antlerwealth.asia
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 80 days
srmfs.co.uk srmfs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 337 days
appartnerswealth.co.uk appartnerswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 135 days
stephenboylewealthmanagement.co.uk stephenboylewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 21 days
stephenhydewealthmanagement.co.uk stephenhydewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
sterlingadvice.co.uk sterlingadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
strakerfp.co.uk strakerfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 33 days
aspirelane.co.uk aspirelane.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 152 days
stuartthom.co.uk stuartthom.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 53 days
sullivanandcofp.co.uk sullivanandcofp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 190 days
swannfinancial.com swannfinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
swindonfinancialadvisers.co.uk swindonfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
angieaddisonfinancial.co.uk angieaddisonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 153 days
athelisfinancial.co.uk athelisfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 15 days
aurorafinancialservices.co.uk aurorafinancialservices.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 15 days
avonwoodfinancialplanning.uk avonwoodfinancialplanning.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
thameswealth.co.uk thameswealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 272 days
bardenwealthmanagement.co.uk bardenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jul 2023 1 year, 303 days
trueselfwealth.co.uk trueselfwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 194 days
berryfinancial.co.uk berryfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
birchwealthmanagement.co.uk birchwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
watchhousefp.co.uk watchhousefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 279 days
waymarkerfinancial.co.uk waymarkerfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
wellbankwm.co.uk wellbankwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 324 days
westwellwm.co.uk westwellwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 8 days
whittinghamprivateclients.com whittinghamprivateclients.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 157 days
wokingfinancialadviser.co.uk wokingfinancialadviser.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 16 days
bullivantwealth.co.uk bullivantwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 74 days
cgafinancial.co.uk cgafinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 20 days
christopherpughwealthmanagement.co.uk christopherpughwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 311 days
claywealth.co.uk claywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 170 days
cleevefinancialplanning.co.uk cleevefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 297 days
colebridgefs.co.uk colebridgefs.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2023 Sep 2023 8 days
compoundwealth.uk compoundwealth.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 1 year, 2 days
coralfp.co.uk coralfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 296 days
cowgillwealthmanagement.co.uk cowgillwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 218 days
craigcrawfordfinancial.co.uk craigcrawfordfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 May 2023 39 days
craigsaxtonwm.co.uk craigsaxtonwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2021 108 days
sjp-cloud.info custom.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
dalemurtenwealthmanagement.co.uk dalemurtenwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 23 days
declankiely.co.uk declankiely.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 295 days
dmcfp.co.uk dmcfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 128 days
dunnewealthmanagement.co.uk dunnewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Sep 2023 1 year, 108 days
dwwealthplanning.co.uk dwwealthplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 147 days
eastlakewm.co.uk eastlakewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Sep 2023 1 year, 108 days
emilyman.com emilyman.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 87 days
farrfinancialplanning.co.uk farrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 165 days
filsellwealth.co.uk filsellwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 1 year, 10 days
financialplanningformedics.co.uk financialplanningformedics.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 27 days
finlaywealth.co.uk finlaywealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 165 days
forethoughtfinancial.co.uk forethoughtfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 304 days
fortitudewealthmanagement.co.uk fortitudewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 142 days
fskfinancialplanning.co.uk fskfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 213 days
goldenacornfp.com goldenacornfp.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 211 days
hartfp.co.uk hartfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 364 days
hfkwealth.co.uk hfkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Jan 2022 One Off
majoroakwm.co.uk majoroakwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 283 days
hsprivatewealth.co.uk hsprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 31 days
isaacwealth.co.uk isaacwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jamesdrowley.co.uk jamesdrowley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 32 days
jamesonwealthmanagement.co.uk jamesonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jasonbellissimo.co.uk jasonbellissimo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Mar 2022 184 days
jdcfinancialplanning.co.uk jdcfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 174 days
jenkinsonwealth.co.uk jenkinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 46 days
jkb-wealth.co.uk jkb-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 136 days
joannefogowm.co.uk joannefogowm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
joejoblingwealthmanagement.co.uk joejoblingwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
johngoldiewm.co.uk johngoldiewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 34 days
johnhomewealthmanagement.co.uk johnhomewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 33 days
jpwealthmanagement.co.uk jpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
kenwoodwealthmanagement.co.uk kenwoodwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
kilsaranfp.co.uk kilsaranfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
lamymanandco.co.uk lamymanandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 206 days
langwealthmanagement.co.uk langwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 109 days
laurajoycewealthmanagement.co.uk laurajoycewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
lemontfp.co.uk lemontfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 34 days
libertywm.co.uk libertywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
longsandsfp.co.uk longsandsfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 118 days
mantafp.co.uk mantafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 76 days
martaderpenska.co.uk martaderpenska.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 36 days
mattimorewealth.co.uk mattimorewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 32 days
mcgillwm.co.uk mcgillwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 97 days
michaelheard.co.uk michaelheard.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 36 days
mjrfinancialplanning.co.uk mjrfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Sep 2023 1 year, 133 days
mkm-wm.co.uk mkm-wm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2023 1 year, 337 days
mollamwm.co.uk mollamwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 155 days
morrinsonwealth.co.uk morrinsonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 56 days
mwandpartners.co.uk mwandpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 153 days
naomihaynes.co.uk naomihaynes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
nauticalwealth.co.uk nauticalwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 345 days
nicholasbonefinancial.co.uk nicholasbonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 73 days
norfolkwealth.co.uk norfolkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
norifinancial.co.uk norifinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
oaksmithfinancialplanning.co.uk oaksmithfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 288 days
oakwaywm.co.uk oakwaywm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 44 days
originwm.co.uk originwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 172 days
revolutionwealth.co.uk revolutionwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
pantheonwealthpartners.co.uk pantheonwealthpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 16 days
pardeepnarwal.co.uk pardeepnarwal.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
parnellfinancialmanagement.com parnellfinancialmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
richardmarshall.uk richardmarshall.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
pearsonfinancialwellbeing.co.uk pearsonfinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 150 days
website-testing-link.net penrose.website-testing-link.net
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 17 days
ripplewealth.co.uk ripplewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2023 239 days
petrichorfinancialsolutions.com petrichorfinancialsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2023 241 days
philipblackwealthmanagement.co.uk philipblackwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 360 days
planitfuture.co.uk planitfuture.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Oct 2021 4 days
planned-wealth.co.uk planned-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
portsdownwealthmanagement.co.uk portsdownwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 45 days
priteshkabawala.co.uk priteshkabawala.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 45 days
progressivewealth.co.uk progressivewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
psrwm.co.uk psrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 91 days
rabeyaislam.co.uk rabeyaislam.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 237 days
mcqueenwealth.co.uk mcqueenwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Sep 2023 1 year, 132 days
mcgwealth.co.uk mcgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 75 days
mendipwm.co.uk mendipwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 243 days
midlandfp.co.uk midlandfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 364 days
rexwealth.co.uk rexwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 296 days
richardjhewlett.co.uk richardjhewlett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
richardreith.co.uk richardreith.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 48 days
rkpwealthmanagement.co.uk rkpwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 251 days
sapphirefinancialplanning.com sapphirefinancialplanning.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
advice-on-line.co.uk advice-on-line.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 13 days
akrwealth.co.uk akrwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 303 days
altairfp.co.uk altairfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 317 days
sgwealth.co.uk sgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2022 Sep 2023 1 year, 125 days
sharpwm.co.uk sharpwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
sherwoodsolutions.com sherwoodsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
simplewealthsolutions.co.uk simplewealthsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 334 days
southoverwealth.co.uk southoverwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Jul 2023 1 year, 214 days
sparkwealth.co.uk sparkwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Sep 2023 355 days
andyheyes.co.uk andyheyes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 96 days
spinnaker-wealth.co.uk spinnaker-wealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
spinnakerwealth.co.uk spinnakerwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Aug 2023 1 year, 346 days
sjp-cloud.info ssl-test.sjp-cloud.info
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
stephendawsonwealthmanagement.co.uk stephendawsonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Dec 2021 89 days
stephensonwealthmanagement.co.uk stephensonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 54 days
stjulienfp.co.uk stjulienfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 105 days
abreyprivateclients.com abreyprivateclients.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 302 days
surreyoakswm.co.uk surreyoakswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
alderleyfinancialplanning.co.uk alderleyfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 317 days
swfsltd.co.uk swfsltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 61 days
swilcanfinancialpartners.co.uk swilcanfinancialpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 330 days
amicafinancialwellbeing.co.uk amicafinancialwellbeing.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 153 days
tait.financial tait.financial
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
taylorwealthmanagement.co.uk taylorwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
templepiper.co.uk templepiper.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 143 days
avfp.co.uk avfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
avongreenfinancial.co.uk avongreenfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 98 days
avonwoodfinancial.uk avonwoodfinancial.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-58PXN8T Jun 2021 Jun 2021 One Off
theethicalwealthproject.co.uk theethicalwealthproject.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 329 days
tiffanybeardfinancialadvisers.co.uk tiffanybeardfinancialadvisers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 228 days
tilikumwealth.co.uk tilikumwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
trbeardwealth.co.uk trbeardwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 7 days
belgravefinancial.com belgravefinancial.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Jun 2023 1 year, 225 days
bentleybrownandco.co.uk bentleybrownandco.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 221 days
twachartered.co.uk twachartered.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 103 days
twcfinancial.co.uk twcfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 60 days
tweedieandwyllie.co.uk tweedieandwyllie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 103 days
venturawealth.co.uk venturawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2022 Sep 2023 1 year, 158 days
blackfinwm.co.uk blackfinwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 264 days
vivawealth.co.uk vivawealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 324 days
warwickshirewealthmanagement.co.uk warwickshirewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 8 days
wellsandcofinancialplanning.co.uk wellsandcofinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Nov 2022 124 days
brcwm.co.uk brcwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 50 days
whitfeldfinancialplanning.co.uk whitfeldfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 51 days
whitstablefp.co.uk whitstablefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 184 days
wildandwildwm.co.uk wildandwildwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Sep 2023 319 days
bromleyrahlke.co.uk bromleyrahlke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 51 days
bromptonprivatewealth.co.uk bromptonprivatewealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 101 days
williamstreetwealth.co.uk williamstreetwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2021 Sep 2023 1 year, 273 days
williamswealthconsultancy.co.uk williamswealthconsultancy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 139 days
woodmitchellfp.co.uk woodmitchellfp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 139 days
yasutoarai.co.uk yasutoarai.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2022 Sep 2023 1 year, 226 days
yltwealthmanagement.co.uk yltwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 83 days
challonerwealth.com challonerwealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 20 days
chequersfinancialplanning.co.uk chequersfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 312 days
sjp.co.uk choices.sjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Apr 2023 1 year, 222 days
chrisbromiley.co.uk chrisbromiley.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 52 days
chriswordsworthfinancialplanning.co.uk chriswordsworthfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 298 days
ciaranpreshurwm.co.uk ciaranpreshurwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 55 days
compass-fs.org compass-fs.org
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 258 days
comptonfinancialadvice.co.uk comptonfinancialadvice.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
connectedfinancial.co.uk connectedfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 169 days
cotterell-wilkie.co.uk cotterell-wilkie.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 22 days
crescentwm.co.uk crescentwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 218 days
cthfinancialplanning.co.uk cthfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Aug 2022 54 days
cuthbertsonwealthmanagement.com cuthbertsonwealthmanagement.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 22 days
davidjoneswealthmanagement.co.uk davidjoneswealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Dec 2022 Sep 2023 257 days
davidwilkinsonsjp.co.uk davidwilkinsonsjp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 23 days
davieswealthmanagement.uk davieswealthmanagement.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2022 Sep 2023 1 year, 14 days
ellisonwealthmanagement.co.uk ellisonwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 127 days
ellisonwwm.co.uk ellisonwwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2022 Sep 2023 1 year, 73 days
elmhurstfinancialplanning.co.uk elmhurstfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 127 days
ffwm.co.uk ffwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Feb 2023 121 days
finative.co.uk finative.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2023 Sep 2023 165 days
fordhamfinancialplanning.co.uk fordhamfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 214 days
forest-oak.co.uk forest-oak.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2023 253 days
fortispw.co.uk fortispw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Sep 2023 1 year, 304 days
gallacherwealth.uk gallacherwealth.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 One Off
grindalwealthmanagement.co.uk grindalwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 1 day
gwwealth.co.uk gwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 290 days
hamiltonbennett.co.uk hamiltonbennett.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years
hansawealthmanagement.co.uk hansawealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Apr 2023 169 days
helenmrogers.co.uk helenmrogers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 30 days
hexafinancialplanning.co.uk hexafinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 31 days
hutchesonfinancial.co.uk hutchesonfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2022 Sep 2023 289 days
hwmfinancial.co.uk hwmfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 362 days
iriswm.co.uk iriswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 81 days
jafp.co.uk jafp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 175 days
jdwealthmanagement.co.uk jdwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
jeremydavieswm.co.uk jeremydavieswm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 358 days
joblingwm.co.uk joblingwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 80 days
jonathanstorrwm.co.uk jonathanstorrwm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 34 days
jrmwealth.co.uk jrmwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 357 days
juxonwealth.com juxonwealth.com
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Oct 2020 1 day
kbruce.co.uk kbruce.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Jan 2022 50 days
kevindenman.co.uk kevindenman.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 356 days
kilbrinfinancial.co.uk kilbrinfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Aug 2023 Sep 2023 36 days
kingsfordwealthmanagement.co.uk kingsfordwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 120 days
lawrenceneilwealthmanagement.co.uk lawrenceneilwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
leeperkes.co.uk leeperkes.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
lethbridgewm.co.uk lethbridgewm.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 1 year, 354 days
limestonefp.co.uk limestonefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jul 2022 Sep 2023 1 year, 67 days
lisamccreadiewealthmanagement.co.uk lisamccreadiewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2022 108 days
ljgwealth.co.uk ljgwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2022 Oct 2022 One Off
lochriefp.co.uk lochriefp.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2023 246 days
lordstonefinancial.co.uk lordstonefinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2023 Sep 2023 205 days
macleodfinancial.co.uk macleodfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jun 2023 Sep 2023 80 days
majorcontext.com majorcontext.com
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2021 One Off
marktigwell.co.uk marktigwell.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 206 days
mphwealthmanagement.co.uk mphwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 41 days
mwwealth.co.uk mwwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jun 2022 272 days
nickhowells.co.uk nickhowells.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
nineoak.co.uk nineoak.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Mar 2022 Sep 2023 1 year, 183 days
obwealth.co.uk obwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
ocsfinancialplanning.co.uk ocsfinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Apr 2023 Sep 2023 151 days
oneillwealth.co.uk oneillwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 203 days
orangetreewealthmanagement.co.uk orangetreewealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Jan 2023 1 year, 126 days
ovalwealthpartners.co.uk ovalwealthpartners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2021 Sep 2023 2 years, 3 days
ovieo.co.uk ovieo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 46 days
paragonwealth.co.uk paragonwealth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Sep 2022 Apr 2023 211 days
parallelwealthmanagement.co.uk parallelwealthmanagement.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Nov 2021 Aug 2022 247 days
parksidefinancialplanning.co.uk parksidefinancialplanning.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 112 days
parrettfinancial.co.uk parrettfinancial.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Jan 2023 Sep 2023 241 days
pathfinderpw.co.uk pathfinderpw.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Oct 2021 Sep 2023 1 year, 343 days
petrichorfinancialsolutions.co.uk petrichorfinancialsolutions.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N May 2023 Sep 2023 112 days
reddingswmltd.co.uk reddingswmltd.co.uk
Attribute Value First Detected Last Detected Overlap Duration
HJ HJ-946865 Oct 2020 Nov 2020 59 days
regentdow.co.uk regentdow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
GTM GTM-W2ZFB5N Feb 2022 Sep 2023 1 year, 200 days
GILLESPIEFINANCIAL.COM
Non IP Attributes
Attribute First Last
GTM GTM-W2ZFB5N Sep 2021 Sep 2023
UA UA-64686186 Mar 2016 Oct 2017
GTM GTM-58PXN8T Jan 2021 Jun 2021
UA UA-5583714 Jan 2021 Mar 2021
HJ HJ-946865 Oct 2020 Nov 2020
GILLESPIEFINANCIAL.COM
Overlap Attribute Domains
gillespiefinancial.com gillespiefinancial.com
laurencewilkinson.co.uk laurencewilkinson.co.uk
lcwealth.co.uk lcwealth.co.uk
ldbwealth.co.uk ldbwealth.co.uk
lewiswealthmanagement.co.uk lewiswealthmanagement.co.uk
lhfp.co.uk lhfp.co.uk
lifeandlegacywm.co.uk lifeandlegacywm.co.uk
linleyblack.com linleyblack.com
llewellynfs.co.uk llewellynfs.co.uk
lmcfinancialplanning.co.uk lmcfinancialplanning.co.uk
lochviewfinancialplanning.co.uk lochviewfinancialplanning.co.uk
lombardwealthassociates.co.uk lombardwealthassociates.co.uk
lowesawyerfp.co.uk lowesawyerfp.co.uk
lsmwealth.co.uk lsmwealth.co.uk
macintyrewealth.co.uk macintyrewealth.co.uk
macleodandmaccallumwm.co.uk macleodandmaccallumwm.co.uk
mainewealth.co.uk mainewealth.co.uk
mandersfinancialservices.co.uk mandersfinancialservices.co.uk
mansionhousefp.co.uk mansionhousefp.co.uk
marionsiddall.co.uk marionsiddall.co.uk
martenwm.co.uk martenwm.co.uk
maskerywealthmanagement.com maskerywealthmanagement.com
masonswealthassociates.co.uk masonswealthassociates.co.uk
mastersfinancial.co.uk mastersfinancial.co.uk
mathieson-financial-services.co.uk mathieson-financial-services.co.uk
melluter.co.uk melluter.co.uk
merlinwealthmanagement.co.uk merlinwealthmanagement.co.uk
michaeljcookwm.co.uk michaeljcookwm.co.uk
michellesheppard.co.uk michellesheppard.co.uk
mitchellwm.co.uk mitchellwm.co.uk
mktwealthmanagement.co.uk mktwealthmanagement.co.uk
moorgatefp.co.uk moorgatefp.co.uk
mwm-sjp.co.uk mwm-sjp.co.uk
napiersharpe.com napiersharpe.com
narwalwm.co.uk narwalwm.co.uk
nathanind.co.uk nathanind.co.uk
naziahaquewm.co.uk naziahaquewm.co.uk
neathercoat.com neathercoat.com
niceassociates.co.uk niceassociates.co.uk
norfolkwealthmanagement.co.uk norfolkwealthmanagement.co.uk
northumbriafm.co.uk northumbriafm.co.uk
norwoodfp.com norwoodfp.com
nowfinancial.co.uk nowfinancial.co.uk
oakdalefinancialservices.co.uk oakdalefinancialservices.co.uk
oakroomwealth.co.uk oakroomwealth.co.uk
ocswealthmanagement.co.uk ocswealthmanagement.co.uk
olcotelappin.co.uk olcotelappin.co.uk
oliverwronski.co.uk oliverwronski.co.uk
orangetreewm.co.uk orangetreewm.co.uk
rbawealthmanagement.com rbawealthmanagement.com
parkswm.co.uk parkswm.co.uk
patmclaughlin.co.uk patmclaughlin.co.uk
paton-feaver.com paton-feaver.com
paulthorntonsjp.co.uk paulthorntonsjp.co.uk
paulwardwealth.co.uk paulwardwealth.co.uk
pcfaltd.co.uk pcfaltd.co.uk
pcfinancialplanning.com pcfinancialplanning.com
pentelow-wealth-management.co.uk pentelow-wealth-management.co.uk
peterhardingwm.co.uk peterhardingwm.co.uk
petermulronefp.co.uk petermulronefp.co.uk
pettengellwealth.co.uk pettengellwealth.co.uk
pfswm.co.uk pfswm.co.uk
philiphamilton.co.uk philiphamilton.co.uk
pollardwealthmanagement.co.uk pollardwealthmanagement.co.uk
poolegrahamwc.co.uk poolegrahamwc.co.uk
portbrae.co.uk portbrae.co.uk
priteshpankhania.co.uk priteshpankhania.co.uk
reddingswm.co.uk reddingswm.co.uk
renoufwmltd.co.uk renoufwmltd.co.uk
chapel-wealth.co.uk chapel-wealth.co.uk
bwfconsultants.com bwfconsultants.com
rmwmllp.co.uk rmwmllp.co.uk
roburwm.co.uk roburwm.co.uk
robinson-porteous.co.uk robinson-porteous.co.uk
brownlow.co.uk brownlow.co.uk
robinsonwealth.co.uk robinsonwealth.co.uk
acsfinancialplanning.co.uk acsfinancialplanning.co.uk
brightwm.co.uk brightwm.co.uk
broadhurstfm.co.uk broadhurstfm.co.uk
sandafinancialservice.com sandafinancialservice.com
admitchellfinancialplanning.co.uk admitchellfinancialplanning.co.uk
aflfinancial.co.uk aflfinancial.co.uk
scharpwm.co.uk scharpwm.co.uk
afswm.co.uk afswm.co.uk
agfp.co.uk agfp.co.uk
seandownswealthmanagement.co.uk seandownswealthmanagement.co.uk
seifertdunk.co.uk seifertdunk.co.uk
sevenhillswealth.co.uk sevenhillswealth.co.uk
argentwm.co.uk argentwm.co.uk
alanrutherfordwealth.co.uk alanrutherfordwealth.co.uk
alexanderswm.co.uk alexanderswm.co.uk
shenleyprivatewealth.co.uk shenleyprivatewealth.co.uk
shiptonwealth.co.uk shiptonwealth.co.uk
albrightonwm.co.uk albrightonwm.co.uk
ambersmithwc.co.uk ambersmithwc.co.uk
armstrongswealth.co.uk armstrongswealth.co.uk
andersonwealthplanning.co.uk andersonwealthplanning.co.uk
andrewcummingwm.co.uk andrewcummingwm.co.uk
andrewswealth.co.uk andrewswealth.co.uk
srbwm.co.uk srbwm.co.uk
stephendawsonfp.co.uk stephendawsonfp.co.uk
stephenpitcher.co.uk stephenpitcher.co.uk
stephensonfp.co.uk stephensonfp.co.uk
suepickeringwealth.co.uk suepickeringwealth.co.uk
sycamorealliance.com sycamorealliance.com
ashleyjai.co.uk ashleyjai.co.uk
atkinsfinancialmanagement.co.uk atkinsfinancialmanagement.co.uk
thederouetpartnership.co.uk thederouetpartnership.co.uk
thestrainpractice.co.uk thestrainpractice.co.uk
thetdp.co.uk thetdp.co.uk
thomashallwm.co.uk thomashallwm.co.uk
barbaracopeland.co.uk barbaracopeland.co.uk
timmswealthmanagement.co.uk timmswealthmanagement.co.uk
tinaowenfp.co.uk tinaowenfp.co.uk
barneswealthmanagement.co.uk barneswealthmanagement.co.uk
bderose.co.uk bderose.co.uk
beauchampwealth.co.uk beauchampwealth.co.uk
tpcwealth.co.uk tpcwealth.co.uk
beechcroftwm.co.uk beechcroftwm.co.uk
trbarbour.co.uk trbarbour.co.uk
bellamywealthmanagement.co.uk bellamywealthmanagement.co.uk
trowlockwm.co.uk trowlockwm.co.uk
benningfm.com benningfm.com
bglwealth.co.uk bglwealth.co.uk
boardmanwealth.co.uk boardmanwealth.co.uk
blancowealthmanagement.co.uk blancowealthmanagement.co.uk
boagenglandfp.co.uk boagenglandfp.co.uk
wbwealth.co.uk wbwealth.co.uk
wdwealth.co.uk wdwealth.co.uk
wealthandfinancematterslimited.co.uk wealthandfinancematterslimited.co.uk
bpcwealth.co.uk bpcwealth.co.uk
bracewealth.co.uk bracewealth.co.uk
wellsandcompanywm.co.uk wellsandcompanywm.co.uk
whitehousefm.co.uk whitehousefm.co.uk
whitelockfinancialplanning.co.uk whitelockfinancialplanning.co.uk
wickenswealthmanagement.co.uk wickenswealthmanagement.co.uk
buchanwm.co.uk buchanwm.co.uk
wmcinvestment.com wmcinvestment.com
woodfallwealth.co.uk woodfallwealth.co.uk
cadmanandco.co.uk cadmanandco.co.uk
yiotawilkinsonwm.co.uk yiotawilkinsonwm.co.uk
cedarfp.co.uk cedarfp.co.uk
cfswp.co.uk cfswp.co.uk
chatsworthwm.co.uk chatsworthwm.co.uk
chrisjwilkinson.co.uk chrisjwilkinson.co.uk
cliftonwealthmanagement.co.uk cliftonwealthmanagement.co.uk
collinswm.co.uk collinswm.co.uk
colyerassociates.co.uk colyerassociates.co.uk
coronationwealth.co.uk coronationwealth.co.uk
dfsfinancialconsultancy.co.uk dfsfinancialconsultancy.co.uk
davidhannonwealthmanagement.co.uk davidhannonwealthmanagement.co.uk
davidmccollwealthmanagement.co.uk davidmccollwealthmanagement.co.uk
derekmillswealth.co.uk derekmillswealth.co.uk
derekscott.co.uk derekscott.co.uk
dilasserprivateclients.co.uk dilasserprivateclients.co.uk
dmcwm.co.uk dmcwm.co.uk
duncanwealth.co.uk duncanwealth.co.uk
ecclesgreenwood.co.uk ecclesgreenwood.co.uk
eswaranstone.com eswaranstone.com
executivewealth.co.uk executivewealth.co.uk
fawcettwm.co.uk fawcettwm.co.uk
firstchoicefinancial.co.uk firstchoicefinancial.co.uk
fowlerfp.co.uk fowlerfp.co.uk
franciswealth.co.uk franciswealth.co.uk
gainsboroughwealthmanagement.co.uk gainsboroughwealthmanagement.co.uk
garyhewett.co.uk garyhewett.co.uk
gdtwealthmanagement.co.uk gdtwealthmanagement.co.uk
gibsonlaingwealth.co.uk gibsonlaingwealth.co.uk
godridgewealth.co.uk godridgewealth.co.uk
gofp.co.uk gofp.co.uk
goldbywealth.com goldbywealth.com
gpswealthmanagement.co.uk gpswealthmanagement.co.uk
grahamtiney.co.uk grahamtiney.co.uk
grovewealthmanagement.info grovewealthmanagement.info
gsqwealth.co.uk gsqwealth.co.uk
harmansmith.co.uk harmansmith.co.uk
harrisonjamesfp.co.uk harrisonjamesfp.co.uk
hartyltd.co.uk hartyltd.co.uk
henshallwm.co.uk henshallwm.co.uk
hfinancialplanning.co.uk hfinancialplanning.co.uk
hfwealthplanning.co.uk hfwealthplanning.co.uk
hindleandjepsonfs.co.uk hindleandjepsonfs.co.uk
hjwealthplanning.co.uk hjwealthplanning.co.uk
honeycroftwm.co.uk honeycroftwm.co.uk
hugocraggs.co.uk hugocraggs.co.uk
huntminaswm.co.uk huntminaswm.co.uk
hwmwealth.co.uk hwmwealth.co.uk
hylandfp.co.uk hylandfp.co.uk
janineedwards.co.uk janineedwards.co.uk
jenkinsandcofm.co.uk jenkinsandcofm.co.uk
jennymoloney.co.uk jennymoloney.co.uk
jenybeardsley.co.uk jenybeardsley.co.uk
johnsherlock.co.uk johnsherlock.co.uk
johntavender.co.uk johntavender.co.uk
jolyonroderickfp.co.uk jolyonroderickfp.co.uk
jsawealthmanagement.co.uk jsawealthmanagement.co.uk
kanishkswarup.co.uk kanishkswarup.co.uk
kimgeorge.co.uk kimgeorge.co.uk
klcfinancial.co.uk klcfinancial.co.uk
kmcwealthmanagement.co.uk kmcwealthmanagement.co.uk
krfinancialplanning.co.uk krfinancialplanning.co.uk
jpprivateclients.co.uk jpprivateclients.co.uk
jsfinancialplanning.co.uk jsfinancialplanning.co.uk
juliantrumper.co.uk juliantrumper.co.uk
justinredwards.co.uk justinredwards.co.uk
jwhwealth.co.uk jwhwealth.co.uk
kcwealth.co.uk kcwealth.co.uk
keithmarwick.co.uk keithmarwick.co.uk
kenbinniefinancialltd.co.uk kenbinniefinancialltd.co.uk
kevinwhite.co.uk kevinwhite.co.uk
kingsforestwealth.co.uk kingsforestwealth.co.uk
klafp.co.uk klafp.co.uk
kpfinancialwellbeing.co.uk kpfinancialwellbeing.co.uk
ktwm.co.uk ktwm.co.uk
langleyparkwealth.co.uk langleyparkwealth.co.uk
leonardwealthsolutions.co.uk leonardwealthsolutions.co.uk
leowealth.co.uk leowealth.co.uk
lettswealthmanagement.co.uk lettswealthmanagement.co.uk
leversedgewm.co.uk leversedgewm.co.uk
lfp.co.uk lfp.co.uk
lockwoodwealth.co.uk lockwoodwealth.co.uk
lyonsfinancialmanagement.co.uk lyonsfinancialmanagement.co.uk
mandyknox.co.uk mandyknox.co.uk
markingarfield.co.uk markingarfield.co.uk
marktimmins.com marktimmins.com
martinjonesfinancialservices.co.uk martinjonesfinancialservices.co.uk
matthewwilkeswealthmanagement.co.uk matthewwilkeswealthmanagement.co.uk
mbjj.co.uk mbjj.co.uk
mckenzieandco.co.uk mckenzieandco.co.uk
mcknightassociates.co.uk mcknightassociates.co.uk
mercuryfinancial.co.uk mercuryfinancial.co.uk
mlfinancialconsultants.co.uk mlfinancialconsultants.co.uk
moranprivateclientpractice.co.uk moranprivateclientpractice.co.uk
moranwealthmanagement.co.uk moranwealthmanagement.co.uk
murrowwealthmanagement.co.uk murrowwealthmanagement.co.uk
neilloveitt.co.uk neilloveitt.co.uk
newforestwealthmanagement.co.uk newforestwealthmanagement.co.uk
newsomewealthmanagement.co.uk newsomewealthmanagement.co.uk
nigelwd.co.uk nigelwd.co.uk
odellwealth.com odellwealth.com
rectorygreenfs.co.uk rectorygreenfs.co.uk
oliverreeve.co.uk oliverreeve.co.uk
oundlewealthmanagement.co.uk oundlewealthmanagement.co.uk
redoakwealth.co.uk redoakwealth.co.uk
patrickwardconsulting.co.uk patrickwardconsulting.co.uk
paulsamoilys.co.uk paulsamoilys.co.uk
paulsmithwm.co.uk paulsmithwm.co.uk
pbfwm.co.uk pbfwm.co.uk
pdprivateclient.co.uk pdprivateclient.co.uk
penrosewealthmanagement.co.uk penrosewealthmanagement.co.uk
penvearnwealthmanagement.co.uk penvearnwealthmanagement.co.uk
reliancewealth.co.uk reliancewealth.co.uk
petersimonsfinancialservices.co.uk petersimonsfinancialservices.co.uk
pfpwealth.co.uk pfpwealth.co.uk
phillipsparham.co.uk phillipsparham.co.uk
pickeringandryefinancial.co.uk pickeringandryefinancial.co.uk
pjlwealthmanagement.com pjlwealthmanagement.com
pointtopointfm.co.uk pointtopointfm.co.uk
perchardwealthmanagement.co.uk perchardwealthmanagement.co.uk
prestfieldwm.co.uk prestfieldwm.co.uk
pricefp.co.uk pricefp.co.uk
prjfinancialplanning.co.uk prjfinancialplanning.co.uk
provestfs.co.uk provestfs.co.uk
pswm.co.uk pswm.co.uk
pwmni.co.uk pwmni.co.uk
richardsonhewittfp.co.uk richardsonhewittfp.co.uk
rjfinancialplanning.co.uk rjfinancialplanning.co.uk
buttercrossfp.co.uk buttercrossfp.co.uk
castlerockwealth.co.uk castlerockwealth.co.uk
buchananfp.co.uk buchananfp.co.uk
bpwealthmanagement.co.uk bpwealthmanagement.co.uk
rogerswealthmanagement.co.uk rogerswealthmanagement.co.uk
rossmitchellwm.com rossmitchellwm.com
russellfairbrass.co.uk russellfairbrass.co.uk
ruthhomberger.co.uk ruthhomberger.co.uk
britannicfp.co.uk britannicfp.co.uk
adwfinancialsolutions.co.uk adwfinancialsolutions.co.uk
adrianwhitewm.co.uk adrianwhitewm.co.uk
samuelsfinancial.co.uk samuelsfinancial.co.uk
adamsonross.co.uk adamsonross.co.uk
saragray.co.uk saragray.co.uk
sarahquirkassociates.co.uk sarahquirkassociates.co.uk
sarahsiddons.co.uk sarahsiddons.co.uk
scottsymeswm.co.uk scottsymeswm.co.uk
akfm.co.uk akfm.co.uk
alanfilsell.co.uk alanfilsell.co.uk
sfwm.co.uk sfwm.co.uk
altonwealth.co.uk altonwealth.co.uk
alexanderdannwealthmanagementltd.co.uk alexanderdannwealthmanagementltd.co.uk
sharpfs.co.uk sharpfs.co.uk
sheebapadman.co.uk sheebapadman.co.uk
alexcaulder.co.uk alexcaulder.co.uk
alistairblack.com alistairblack.com
cambriawealth.co.uk cambriawealth.co.uk
cameronjonesfm.com cameronjonesfm.com
silverthornwealth.co.uk silverthornwealth.co.uk
simonroffey.co.uk simonroffey.co.uk
amandaredmanfp.co.uk amandaredmanfp.co.uk
sjbettridgefp.co.uk sjbettridgefp.co.uk
amberleyhulmewm.co.uk amberleyhulmewm.co.uk
sldwealth.co.uk sldwealth.co.uk
sleightwm.co.uk sleightwm.co.uk
smithhobbswealth.co.uk smithhobbswealth.co.uk
anglianwealthmanagement.co.uk anglianwealthmanagement.co.uk
anchorwmltd.co.uk anchorwmltd.co.uk
solentwealth.co.uk solentwealth.co.uk
solosywm.co.uk solosywm.co.uk
andrewdavid.co.uk andrewdavid.co.uk
andrewskinnerwealth.co.uk andrewskinnerwealth.co.uk
andrewvrettos.co.uk andrewvrettos.co.uk
speightwealthmanagement.co.uk speightwealthmanagement.co.uk
spwealth.co.uk spwealth.co.uk
sterlingfa.co.uk sterlingfa.co.uk
stevejoyce.co.uk stevejoyce.co.uk
sussexwealthmanagement.com sussexwealthmanagement.com
swannfinancial.co.uk swannfinancial.co.uk
swiftsurewealthmanagement.co.uk swiftsurewealthmanagement.co.uk
atlanticwc.co.uk atlanticwc.co.uk
templewoodwealth.co.uk templewoodwealth.co.uk
themjp.co.uk themjp.co.uk
theplattpartnership.com theplattpartnership.com
thompsonfinancialplanning.co.uk thompsonfinancialplanning.co.uk
thompstonewm.co.uk thompstonewm.co.uk
threehillswealth.co.uk threehillswealth.co.uk
bassantfs.co.uk bassantfs.co.uk
beckwealth.co.uk beckwealth.co.uk
benchapmanwealth.co.uk benchapmanwealth.co.uk
berkleysquarepc.co.uk berkleysquarepc.co.uk
bffinancialplanning.co.uk bffinancialplanning.co.uk
bfpwealthmanagement.co.uk bfpwealthmanagement.co.uk
blackdownwealthmanagement.co.uk blackdownwealthmanagement.co.uk
victoredmonds.co.uk victoredmonds.co.uk
vinitmehta.co.uk vinitmehta.co.uk
bloomerwealth.co.uk bloomerwealth.co.uk
vtwealth.co.uk vtwealth.co.uk
walbrookfinancial.co.uk walbrookfinancial.co.uk
wallwm.co.uk wallwm.co.uk
wardwealthmanagement.co.uk wardwealthmanagement.co.uk
watersdaywm.co.uk watersdaywm.co.uk
bowcliffewm.co.uk bowcliffewm.co.uk
wentworthwm.co.uk wentworthwm.co.uk
welshandtaylorwealth.co.uk welshandtaylorwealth.co.uk
brittonassociates.co.uk brittonassociates.co.uk
bromileyandpartners.co.uk bromileyandpartners.co.uk
brooksfinancialplanning.co.uk brooksfinancialplanning.co.uk
willsfinancial.co.uk willsfinancial.co.uk
williamsonwm.co.uk williamsonwm.co.uk
williamswealthmanagement.co.uk williamswealthmanagement.co.uk
willingalewealthmanagement.co.uk willingalewealthmanagement.co.uk
wronskiwealthmanagement.co.uk wronskiwealthmanagement.co.uk
calderwoodwm.co.uk calderwoodwm.co.uk
carlcrossfield.co.uk carlcrossfield.co.uk
chalkfarmfinancial.co.uk chalkfarmfinancial.co.uk
chapman-associates.co.uk chapman-associates.co.uk
chrisbuckland.co.uk chrisbuckland.co.uk
chromaticwealth.co.uk chromaticwealth.co.uk
circlewealth.co.uk circlewealth.co.uk
clarenceplace.co.uk clarenceplace.co.uk
claywarden.co.uk claywarden.co.uk
cmpfinancial.co.uk cmpfinancial.co.uk
coecapital.co.uk coecapital.co.uk
comfortfinancial.co.uk comfortfinancial.co.uk
constantiawealthandfinance.co.uk constantiawealthandfinance.co.uk
copperrock.co.uk copperrock.co.uk
cordata.co.uk cordata.co.uk
cormackwealthmanagement.co.uk cormackwealthmanagement.co.uk
cornerstonewealthmanagement.co.uk cornerstonewealthmanagement.co.uk
cruddenfinancialplanning.co.uk cruddenfinancialplanning.co.uk
davidmasonfp.com davidmasonfp.com
denhamwm.co.uk denhamwm.co.uk
djswealthadviser.co.uk djswealthadviser.co.uk
eamonncassidy.co.uk eamonncassidy.co.uk
flackwellfs.com flackwellfs.com
frazerwealth.co.uk frazerwealth.co.uk
gallimorewealthmanagement.co.uk gallimorewealthmanagement.co.uk
garyshieldswealthmanagementllp.co.uk garyshieldswealthmanagementllp.co.uk
gayworrow.co.uk gayworrow.co.uk
gbwealthmanagement.co.uk gbwealthmanagement.co.uk
goldingandpartners.co.uk goldingandpartners.co.uk
goldwealthmanagement.co.uk goldwealthmanagement.co.uk
gravitaswm.co.uk gravitaswm.co.uk
greenwealthplanning.co.uk greenwealthplanning.co.uk
greenwoodwealthsolutions.co.uk greenwoodwealthsolutions.co.uk
guthriefps.co.uk guthriefps.co.uk
hackettwealth.co.uk hackettwealth.co.uk
hamptonjamesfa.co.uk hamptonjamesfa.co.uk
hargreaveswealth.co.uk hargreaveswealth.co.uk
hawkinsthomas.co.uk hawkinsthomas.co.uk
hawwm.co.uk hawwm.co.uk
holleronwm.co.uk holleronwm.co.uk
hutchinsonfinancialplanningltd.co.uk hutchinsonfinancialplanningltd.co.uk
ianbellwm.co.uk ianbellwm.co.uk
ianrennardfp.co.uk ianrennardfp.co.uk
ifswealth.co.uk ifswealth.co.uk
ingramwealthmanagement.co.uk ingramwealthmanagement.co.uk
jamieweller.co.uk jamieweller.co.uk
jbedwards.co.uk jbedwards.co.uk
jenningsfp.co.uk jenningsfp.co.uk
joethomas.info joethomas.info
johnpigott.co.uk johnpigott.co.uk
jolyonhankinson.co.uk jolyonhankinson.co.uk
jonathanjgibbons.co.uk jonathanjgibbons.co.uk
rcawealth.co.uk rcawealth.co.uk
rcwealthmanagement.co.uk rcwealthmanagement.co.uk
reasonwilliamspartnership.co.uk reasonwilliamspartnership.co.uk
reedmanwm.co.uk reedmanwm.co.uk
reeffc.com reeffc.com
robertpilnick.co.uk robertpilnick.co.uk
rollowm.co.uk rollowm.co.uk
rosspenman.co.uk rosspenman.co.uk
rozsimcockwealthmanagement.co.uk rozsimcockwealthmanagement.co.uk
rsr-wm.co.uk rsr-wm.co.uk
rwafp.com rwafp.com
adhwealthmanagement.co.uk adhwealthmanagement.co.uk
salterwm.co.uk salterwm.co.uk
samuelcroudacewm.co.uk samuelcroudacewm.co.uk
samuellukeswm.co.uk samuellukeswm.co.uk
sarahbuckwealthmanagement.co.uk sarahbuckwealthmanagement.co.uk
scottwallace.co.uk scottwallace.co.uk
scrivenerfinancial.co.uk scrivenerfinancial.co.uk
sedgwickwm.co.uk sedgwickwm.co.uk
selectinvestors.sg selectinvestors.sg
ajwwealth.co.uk ajwwealth.co.uk
ajtwealth.co.uk ajtwealth.co.uk
ajgwealthmanagement.co.uk ajgwealthmanagement.co.uk
ajbarnesfinancial.co.uk ajbarnesfinancial.co.uk
campbellcainwm.co.uk campbellcainwm.co.uk
alwealthmanagement.co.uk alwealthmanagement.co.uk
aleksjeromel.co.uk aleksjeromel.co.uk
alisonwright.co.uk alisonwright.co.uk
shireswm.co.uk shireswm.co.uk
macfarlanewealthpartners.com macfarlanewealthpartners.com
shubhokunduwm.co.uk shubhokunduwm.co.uk
annegibsonsjp.co.uk annegibsonsjp.co.uk
antlerwealth.co.uk antlerwealth.co.uk
antonyearley.co.uk antonyearley.co.uk
andrewclarey.co.uk andrewclarey.co.uk
andrewoliverfinancial.co.uk andrewoliverfinancial.co.uk
andrewrogerswm.co.uk andrewrogerswm.co.uk
andybarrettsjp.co.uk andybarrettsjp.co.uk
southdownsfp.co.uk southdownsfp.co.uk
arw-wm.com arw-wm.com
srjwm.co.uk srjwm.co.uk
sterlingwealthmanagement.co.uk sterlingwealthmanagement.co.uk
stevenheyes.co.uk stevenheyes.co.uk
stevereeswealthmanagement.co.uk stevereeswealthmanagement.co.uk
abacuswm.co.uk abacuswm.co.uk
adambentonwm.co.uk adambentonwm.co.uk
carpenterwealthmanagement.co.uk carpenterwealthmanagement.co.uk
tailoredsolutionswm.co.uk tailoredsolutionswm.co.uk
aswealthmanagement.co.uk aswealthmanagement.co.uk
athertonandassociates.co.uk athertonandassociates.co.uk
terencegoddardassociates.co.uk terencegoddardassociates.co.uk
avonwoodfinancial.co.uk avonwoodfinancial.co.uk
thegrahamharmspractice.co.uk thegrahamharmspractice.co.uk
ballantinewm.co.uk ballantinewm.co.uk
thomas-rigg.co.uk thomas-rigg.co.uk
throgmortonassociates.co.uk throgmortonassociates.co.uk
bathwealth.co.uk bathwealth.co.uk
beckfordandlewis.co.uk beckfordandlewis.co.uk
bennisonyates.co.uk bennisonyates.co.uk
bhtwealthmanagement.co.uk bhtwealthmanagement.co.uk
uwmwealth.co.uk uwmwealth.co.uk
blackwaterwealthmanagement.co.uk blackwaterwealthmanagement.co.uk
blenheimwealthmanagement.co.uk blenheimwealthmanagement.co.uk
vibrantwealthmanagement.co.uk vibrantwealthmanagement.co.uk
blossomwealth.co.uk blossomwealth.co.uk
vittyalexander.co.uk vittyalexander.co.uk
vswealth.co.uk vswealth.co.uk
bootefinancial.co.uk bootefinancial.co.uk
watchhousewm.co.uk watchhousewm.co.uk
breretonjacksonfinancial.co.uk breretonjacksonfinancial.co.uk
westerhamfs.co.uk westerhamfs.co.uk
whitepeakwm.co.uk whitepeakwm.co.uk
wilcoxday.co.uk wilcoxday.co.uk
bryantassociates.co.uk bryantassociates.co.uk
wiltshirewm.co.uk wiltshirewm.co.uk
wilkinsonwealth.co.uk wilkinsonwealth.co.uk
burfieldshousewm.co.uk burfieldshousewm.co.uk
callumleachwm.co.uk callumleachwm.co.uk
cedarswm.co.uk cedarswm.co.uk
cedarvalegroup.co.uk cedarvalegroup.co.uk
christianjohnwm.co.uk christianjohnwm.co.uk
chronoswm.co.uk chronoswm.co.uk
cockbainassociates.co.uk cockbainassociates.co.uk
coenandclark.co.uk coenandclark.co.uk
cooksonwm.co.uk cooksonwm.co.uk
corneliuswealth.co.uk corneliuswealth.co.uk
countrysidefs.co.uk countrysidefs.co.uk
cranwellws.co.uk cranwellws.co.uk
crawforddean.co.uk crawforddean.co.uk
curzonwm.com curzonwm.com
cyrpaillard.co.uk cyrpaillard.co.uk
davewalkerwealthmanagement.co.uk davewalkerwealthmanagement.co.uk
davidhillwealth.co.uk davidhillwealth.co.uk
davidmakin.co.uk davidmakin.co.uk
davidmelrosewm.co.uk davidmelrosewm.co.uk
dbsfinancial.co.uk dbsfinancial.co.uk
ddlwealthmanagement.co.uk ddlwealthmanagement.co.uk
deltawealth.co.uk deltawealth.co.uk
denmanfp.co.uk denmanfp.co.uk
doreewm.co.uk doreewm.co.uk
doweswealthmanagement.co.uk doweswealthmanagement.co.uk
drewharperfinancialconsultants.co.uk drewharperfinancialconsultants.co.uk
duncannunnwm.co.uk duncannunnwm.co.uk
dwjwealth.co.uk dwjwealth.co.uk
dyerandcowm.co.uk dyerandcowm.co.uk
edenwoodwealth.com edenwoodwealth.com
financialwealthsolutions.co.uk financialwealthsolutions.co.uk
flavellwm.co.uk flavellwm.co.uk
florastamato.co.uk florastamato.co.uk
forbesfinancial.co.uk forbesfinancial.co.uk
foremostfinancial.net foremostfinancial.net
haycockandgricefp.co.uk haycockandgricefp.co.uk
garryjohnsonwealthmanagement.co.uk garryjohnsonwealthmanagement.co.uk
garymorrisonwm.co.uk garymorrisonwm.co.uk
hayesfinancialplanning.com hayesfinancialplanning.com
gcadurham.co.uk gcadurham.co.uk
gildedwealth.co.uk gildedwealth.co.uk
gillisfinancial.co.uk gillisfinancial.co.uk
ginderswm.co.uk ginderswm.co.uk
godfreywealthmanagement.co.uk godfreywealthmanagement.co.uk
grahamwealthmanagement.co.uk grahamwealthmanagement.co.uk
greavesfinancialservices.co.uk greavesfinancialservices.co.uk
gregjmiddleton.co.uk gregjmiddleton.co.uk
guthriewealthconsultancy.co.uk guthriewealthconsultancy.co.uk
hadlowedwards.co.uk hadlowedwards.co.uk
harnhill.com harnhill.com
harriesfinancial.co.uk harriesfinancial.co.uk
hartfordwealth.co.uk hartfordwealth.co.uk
hartleywm.co.uk hartleywm.co.uk
heritagefc.co.uk heritagefc.co.uk
hesslewoodwm.co.uk hesslewoodwm.co.uk
hillandcofa.co.uk hillandcofa.co.uk
horizonwealthconsultancy.co.uk horizonwealthconsultancy.co.uk
houghtonwm.co.uk houghtonwm.co.uk
howardfinancialplanning.co.uk howardfinancialplanning.co.uk
hutchinsonwealthmanagement.co.uk hutchinsonwealthmanagement.co.uk
hwlwm.co.uk hwlwm.co.uk
igwm.co.uk igwm.co.uk
investasure.co.im investasure.co.im
jamielewington.co.uk jamielewington.co.uk
jeanlamb.co.uk jeanlamb.co.uk
jennerwm.co.uk jennerwm.co.uk
jerimeattah.co.uk jerimeattah.co.uk
jmswealthmanagement.co.uk jmswealthmanagement.co.uk
johncummingswm.co.uk johncummingswm.co.uk
jon-paulhardy.co.uk jon-paulhardy.co.uk
jonathangrantwealth.co.uk jonathangrantwealth.co.uk
jonpittey.co.uk jonpittey.co.uk
jopottsfinancialplanning.co.uk jopottsfinancialplanning.co.uk
jpnfinancial.co.uk jpnfinancial.co.uk
julianspencerwm.co.uk julianspencerwm.co.uk
juliedaweswealthmanagement.co.uk juliedaweswealthmanagement.co.uk
juliehowiesonwealthmanagement.co.uk juliehowiesonwealthmanagement.co.uk
kathwilkinson.co.uk kathwilkinson.co.uk
kennettwealthmanagement.co.uk kennettwealthmanagement.co.uk
kevindavieswm.co.uk kevindavieswm.co.uk
keystonefinancial.co.uk keystonefinancial.co.uk
kineticwealthmanagement.co.uk kineticwealthmanagement.co.uk
kirbyknott.co.uk kirbyknott.co.uk
kudoswealth.com kudoswealth.com
lehmannfinancialmanagement.co.uk lehmannfinancialmanagement.co.uk
lenwalters.co.uk lenwalters.co.uk
lesterbrunt.co.uk lesterbrunt.co.uk
lfhwealthmanagement.co.uk lfhwealthmanagement.co.uk
lisaleewealthmanagement.co.uk lisaleewealthmanagement.co.uk
littlepebbles.co.uk littlepebbles.co.uk
lockingtonfinancial.co.uk lockingtonfinancial.co.uk
louisewoollardfinancial.co.uk louisewoollardfinancial.co.uk
lukecarless.co.uk lukecarless.co.uk
lynnanderson.co.uk lynnanderson.co.uk
marknieldwm.co.uk marknieldwm.co.uk
marquewealth.co.uk marquewealth.co.uk
marsonwm.co.uk marsonwm.co.uk
martellowealth.co.uk martellowealth.co.uk
masperoassociates.co.uk masperoassociates.co.uk
matthewgreenhalgh.co.uk matthewgreenhalgh.co.uk
maylamfinancial.co.uk maylamfinancial.co.uk
mbarclay.co.uk mbarclay.co.uk
meadwm.co.uk meadwm.co.uk
mercianwm.co.uk mercianwm.co.uk
mglwealthmanagement.co.uk mglwealthmanagement.co.uk
michaelkiener.co.uk michaelkiener.co.uk
mjbfp.co.uk mjbfp.co.uk
mkm-wealth.co.uk mkm-wealth.co.uk
mountstuartwm.co.uk mountstuartwm.co.uk
mwcarefeesadvice.co.uk mwcarefeesadvice.co.uk
myerswealthmanagement.co.uk myerswealthmanagement.co.uk
neilforeman.co.uk neilforeman.co.uk
newmanrea.com newmanrea.com
nickspence.co.uk nickspence.co.uk
oakmerewealth.co.uk oakmerewealth.co.uk
oakridge-partners.co.uk oakridge-partners.co.uk
paularodriguez.co.uk paularodriguez.co.uk
paulbutlerwm.co.uk paulbutlerwm.co.uk
paulmkavanagh.co.uk paulmkavanagh.co.uk
paulmorganwealthmanagement.co.uk paulmorganwealthmanagement.co.uk
rickettsfp.co.uk rickettsfp.co.uk
penninewealthmanagement.co.uk penninewealthmanagement.co.uk
peterallensjp.co.uk peterallensjp.co.uk
petermooresjp.co.uk petermooresjp.co.uk
peterwildwealth.co.uk peterwildwealth.co.uk
primusfinancial.co.uk primusfinancial.co.uk
priorywealthmanagement.co.uk priorywealthmanagement.co.uk
prosperawealth.co.uk prosperawealth.co.uk
prudentfpa.co.uk prudentfpa.co.uk
ptrembeth.co.uk ptrembeth.co.uk
puxleypartnership.co.uk puxleypartnership.co.uk
pwandpartners.co.uk pwandpartners.co.uk
rachaelbellwealthmanagement.co.uk rachaelbellwealthmanagement.co.uk
rajivprabhakar.co.uk rajivprabhakar.co.uk
randallwm.co.uk randallwm.co.uk
richardbrewster.co.uk richardbrewster.co.uk
abbeywealthmanagement.co.uk abbeywealthmanagement.co.uk
rodneyspillerwm.co.uk rodneyspillerwm.co.uk
roseassociatesfp.co.uk roseassociatesfp.co.uk
lorrainecoaton.co.uk lorrainecoaton.co.uk
rtwwealth.co.uk rtwwealth.co.uk
lucialangella.co.uk lucialangella.co.uk
ryleywm.co.uk ryleywm.co.uk
samrawm.co.uk samrawm.co.uk
adamsandbowleswm.co.uk adamsandbowleswm.co.uk
sarahmhughes.co.uk sarahmhughes.co.uk
savvideswealthmanagement.co.uk savvideswealthmanagement.co.uk
scottjamesandassociates.co.uk scottjamesandassociates.co.uk
alanhillfp.co.uk alanhillfp.co.uk
alpewealthmanagement.co.uk alpewealthmanagement.co.uk
shaunajhappan.co.uk shaunajhappan.co.uk
alisongregorywm.co.uk alisongregorywm.co.uk
alexziff.com alexziff.com
simonlipp.co.uk simonlipp.co.uk
almavalewealthmanagement.co.uk almavalewealthmanagement.co.uk
silvertreewm.co.uk silvertreewm.co.uk
smartinfinancialplanning.co.uk smartinfinancialplanning.co.uk
smithjackson.co.uk smithjackson.co.uk
sneddonfp.co.uk sneddonfp.co.uk
askwealthmanagement.co.uk askwealthmanagement.co.uk
anderson-wealthmanagement.co.uk anderson-wealthmanagement.co.uk
andersonfinancial.co.uk andersonfinancial.co.uk
andrewconnolly.co.uk andrewconnolly.co.uk
spillaneandcompany.co.uk spillaneandcompany.co.uk
carterlegrand.co.uk carterlegrand.co.uk
casewealth.co.uk casewealth.co.uk
stanleyfinancial.co.uk stanleyfinancial.co.uk
stevenswealthmanagement.co.uk stevenswealthmanagement.co.uk
stilgoefm.co.uk stilgoefm.co.uk
atlanticwealth.co.uk atlanticwealth.co.uk
aagwealthmanagement.co.uk aagwealthmanagement.co.uk
swindonfinancialservices.com swindonfinancialservices.com
taitfinancialservices.co.uk taitfinancialservices.co.uk
tarnwealthmanagement.co.uk tarnwealthmanagement.co.uk
taylorfinancial.co.uk taylorfinancial.co.uk
thindwealthadvisory.co.uk thindwealthadvisory.co.uk
thomaswealthadvisory.co.uk thomaswealthadvisory.co.uk
thomlinsonwealthmanagement.co.uk thomlinsonwealthmanagement.co.uk
bathandwestwealth.co.uk bathandwestwealth.co.uk
treskelionfp.co.uk treskelionfp.co.uk
trevorngraham.co.uk trevorngraham.co.uk
twelvewm.co.uk twelvewm.co.uk
twomeywm.co.uk twomeywm.co.uk
bhwml.co.uk bhwml.co.uk
valantineassociates.co.uk valantineassociates.co.uk
villageestatesfc.co.uk villageestatesfc.co.uk
virtuewealthsolutions.co.uk virtuewealthsolutions.co.uk
watchoakpw.co.uk watchoakpw.co.uk
bowaterwealth.co.uk bowaterwealth.co.uk
westbrookfs.co.uk westbrookfs.co.uk
westgatewealth.co.uk westgatewealth.co.uk
wharfebank.co.uk wharfebank.co.uk
brianemslie.co.uk brianemslie.co.uk
bricknellwealth.co.uk bricknellwealth.co.uk
bridgesandco.co.uk bridgesandco.co.uk
whitewm.co.uk whitewm.co.uk
broadcharepartners.co.uk broadcharepartners.co.uk
wilkinsonfinancialmgt.co.uk wilkinsonfinancialmgt.co.uk
willgcunningham.co.uk willgcunningham.co.uk
wilsonwealthmanagement.co.uk wilsonwealthmanagement.co.uk
wjpickering.co.uk wjpickering.co.uk
wolfewealth.co.uk wolfewealth.co.uk
woodstockwealthmanagement.co.uk woodstockwealthmanagement.co.uk
burn-joneswealthmanagement.co.uk burn-joneswealthmanagement.co.uk
burtonhills.co.uk burtonhills.co.uk
wyefieldwm.co.uk wyefieldwm.co.uk
capitalplanningpartners.co.uk capitalplanningpartners.co.uk
castellwm.co.uk castellwm.co.uk
cathedralgreenfinancialplanning.co.uk cathedralgreenfinancialplanning.co.uk
claytondenefp.co.uk claytondenefp.co.uk
clearwaterwealthmanagement.co.uk clearwaterwealthmanagement.co.uk
coldfairwealthmanagement.co.uk coldfairwealthmanagement.co.uk
colefinancial.co.uk colefinancial.co.uk
colinjessopp.co.uk colinjessopp.co.uk
colinrexwm.co.uk colinrexwm.co.uk
corinthianwealthmanagement.co.uk corinthianwealthmanagement.co.uk
cotswoldwealth.co.uk cotswoldwealth.co.uk
ctpwm.co.uk ctpwm.co.uk
dalejohnsonwealthmanagement.co.uk dalejohnsonwealthmanagement.co.uk
daleycroft.co.uk daleycroft.co.uk
dalviwealth.co.uk dalviwealth.co.uk
davidgallagherwm.com davidgallagherwm.com
daviswealth.co.uk daviswealth.co.uk
deltachelmsford.co.uk deltachelmsford.co.uk
djbrewsterfcs.co.uk djbrewsterfcs.co.uk
duleypractice.co.uk duleypractice.co.uk
dwbwealth.co.uk dwbwealth.co.uk
dwmfp.co.uk dwmfp.co.uk
eadenwm.co.uk eadenwm.co.uk
educate-financial.co.uk educate-financial.co.uk
ejwm.co.uk ejwm.co.uk
farrowwealth.co.uk farrowwealth.co.uk
fortemfm.co.uk fortemfm.co.uk
heraldwealth.co.uk heraldwealth.co.uk
fyldewealthmanagement.co.uk fyldewealthmanagement.co.uk
garywalker.co.uk garywalker.co.uk
gdcfinancialadvisers.co.uk gdcfinancialadvisers.co.uk
genoawealthmanagement.co.uk genoawealthmanagement.co.uk
germainfinancial.co.uk germainfinancial.co.uk
gilsongrayfinancial.co.uk gilsongrayfinancial.co.uk
goldsmithwm.co.uk goldsmithwm.co.uk
goodallsmith.co.uk goodallsmith.co.uk
gregorywm.co.uk gregorywm.co.uk
gregthomsonwealth.co.uk gregthomsonwealth.co.uk
griersonwm.co.uk griersonwm.co.uk
grovewoodwealth.co.uk grovewoodwealth.co.uk
hallandcostellowealthmanagement.co.uk hallandcostellowealthmanagement.co.uk
hamesassociates.co.uk hamesassociates.co.uk
hamwicwealth.co.uk hamwicwealth.co.uk
havenwealthmanagement.co.uk havenwealthmanagement.co.uk
hetalpatelwealth.co.uk hetalpatelwealth.co.uk
highhousewealth.co.uk highhousewealth.co.uk
hilljohnstone.co.uk hilljohnstone.co.uk
howefinancialadvisers.co.uk howefinancialadvisers.co.uk
ianhuntwm.co.uk ianhuntwm.co.uk
invictuswealth.co.uk invictuswealth.co.uk
iptucker.co.uk iptucker.co.uk
islinwm.co.uk islinwm.co.uk
jameselliottwealthmanagement.co.uk jameselliottwealthmanagement.co.uk
jfwealth.co.uk jfwealth.co.uk
johnclementswealthmanagement.co.uk johnclementswealthmanagement.co.uk
jpswealthmanagement.co.uk jpswealthmanagement.co.uk
kearsleyfinancialmanagement.co.uk kearsleyfinancialmanagement.co.uk
kevinmunrofp.co.uk kevinmunrofp.co.uk
kevinprobertwealthmanagement.co.uk kevinprobertwealthmanagement.co.uk
kmosbyfinancial.co.uk kmosbyfinancial.co.uk
kpwoodandassociates.co.uk kpwoodandassociates.co.uk
las-wealth.co.uk las-wealth.co.uk
latorrewealthmanagement.co.uk latorrewealthmanagement.co.uk
leedowdall.com leedowdall.com
leeswm.co.uk leeswm.co.uk
littlewickwealthmanagement.co.uk littlewickwealthmanagement.co.uk
liztuccy.co.uk liztuccy.co.uk
louisewarland.co.uk louisewarland.co.uk
magorwealthmanagement.co.uk magorwealthmanagement.co.uk
mardons.co.uk mardons.co.uk
marshallwealthmanagement.co.uk marshallwealthmanagement.co.uk
martinkeyte.co.uk martinkeyte.co.uk
matrixwp.co.uk matrixwp.co.uk
matthewjohnrowland.co.uk matthewjohnrowland.co.uk
matthewwykes.co.uk matthewwykes.co.uk
mccuewealthmanagement.co.uk mccuewealthmanagement.co.uk
mercerandassociates.co.uk mercerandassociates.co.uk
metcalfewealth.co.uk metcalfewealth.co.uk
michaelmacauley.co.uk michaelmacauley.co.uk
murraywealthmanagement.co.uk murraywealthmanagement.co.uk
napierlane.com napierlane.com
navigationwm.co.uk navigationwm.co.uk
networkventuresfs.co.uk networkventuresfs.co.uk
newmanlangley.co.uk newmanlangley.co.uk
nicholsonwm.co.uk nicholsonwm.co.uk
nickclarkwm.co.uk nickclarkwm.co.uk
nickcumminswealthmanagement.co.uk nickcumminswealthmanagement.co.uk
osmanwealth.co.uk osmanwealth.co.uk
palmerwealth.co.uk palmerwealth.co.uk
papewealthmanagement.co.uk papewealthmanagement.co.uk
paulabicknellwealth.co.uk paulabicknellwealth.co.uk
paulasherlock-cross.co.uk paulasherlock-cross.co.uk
paulgeddeswm.co.uk paulgeddeswm.co.uk
pdavisfinancial.co.uk pdavisfinancial.co.uk
persellewart.co.uk persellewart.co.uk
pfpswm.com pfpswm.com
plummerandassociates.co.uk plummerandassociates.co.uk
poundburywealth.co.uk poundburywealth.co.uk
probertwealthmanagement.co.uk probertwealthmanagement.co.uk
psgwealth.co.uk psgwealth.co.uk
quaysidewealthmanagement.co.uk quaysidewealthmanagement.co.uk
queenssquarewealth.co.uk queenssquarewealth.co.uk
rebeccapope.co.uk rebeccapope.co.uk
reeswealthmanagement.co.uk reeswealthmanagement.co.uk
leeblissettwealthmanagement.co.uk leeblissettwealthmanagement.co.uk
legacywealth.sg legacywealth.sg
lifetimeconnections.co.uk lifetimeconnections.co.uk
lisawickenswm.co.uk lisawickenswm.co.uk
lpwealth.co.uk lpwealth.co.uk
marclbennett.co.uk marclbennett.co.uk
marcsmelt.co.uk marcsmelt.co.uk
minsterwealthmanagement.co.uk minsterwealthmanagement.co.uk
moorewealth.co.uk moorewealth.co.uk
npfc.co.uk npfc.co.uk
one-wealth.co.uk one-wealth.co.uk
paulgschofield.co.uk paulgschofield.co.uk
petergavin.net petergavin.net
ridlandwealth.co.uk ridlandwealth.co.uk
robertshawsidlow-wealth.co.uk robertshawsidlow-wealth.co.uk
rppw.co.uk rppw.co.uk
mgwealth.co.uk mgwealth.co.uk
silverdomefinancial.co.uk silverdomefinancial.co.uk
smtwealth.co.uk smtwealth.co.uk
snwfinancialplanning.co.uk snwfinancialplanning.co.uk
andrewwhiting.co.uk andrewwhiting.co.uk
stroudwm.co.uk stroudwm.co.uk
sullivanwealthmanagement.co.uk sullivanwealthmanagement.co.uk
taffetsaufferwm.co.uk taffetsaufferwm.co.uk
barnesrobertson.com barnesrobertson.com
bedfordwm.co.uk bedfordwm.co.uk
vcpc.co.uk vcpc.co.uk
walfordwealth.co.uk walfordwealth.co.uk
walkerwm.co.uk walkerwm.co.uk
willgrace.co.uk willgrace.co.uk
bullwm.co.uk bullwm.co.uk
chasebridgewm.co.uk chasebridgewm.co.uk
coulterweir.co.uk coulterweir.co.uk
davidbeanwealth.co.uk davidbeanwealth.co.uk
deanstevenswm.co.uk deanstevenswm.co.uk
douglasrowefs.co.uk douglasrowefs.co.uk
easternwealth.co.uk easternwealth.co.uk
eatlywm.co.uk eatlywm.co.uk
experiumfinancialservices.co.uk experiumfinancialservices.co.uk
frizzellandpartners.co.uk frizzellandpartners.co.uk
frizzellwm.co.uk frizzellwm.co.uk
graywealth.co.uk graywealth.co.uk
hallwealth.co.uk hallwealth.co.uk
iccwealthmanagement.co.uk iccwealthmanagement.co.uk
irpwealth.co.uk irpwealth.co.uk
iwmwealth.co.uk iwmwealth.co.uk
jamiecalder.co.uk jamiecalder.co.uk
johncharper.co.uk johncharper.co.uk
kdmurraywm.co.uk kdmurraywm.co.uk
kimdevinefp.co.uk kimdevinefp.co.uk
joybarden.co.uk joybarden.co.uk
keithwilliamsfinancial.co.uk keithwilliamsfinancial.co.uk
leemerrettwealthmanagement.co.uk leemerrettwealthmanagement.co.uk
miwealth.co.uk miwealth.co.uk
moifc.co.uk moifc.co.uk
ninewealth.co.uk ninewealth.co.uk
pinnaclewealth.co.uk pinnaclewealth.co.uk
polarisfp.co.uk polarisfp.co.uk
rhodesbrook.co.uk rhodesbrook.co.uk
richardpaddle.com richardpaddle.com
ridley-jones.co.uk ridley-jones.co.uk
robertcompton.co.uk robertcompton.co.uk
sjpp.asia sjpp.asia
amgwealthmanagement.com amgwealthmanagement.com
andrewspillane.co.uk andrewspillane.co.uk
andrewtodd-sjp.co.uk andrewtodd-sjp.co.uk
sterlingsolutionsltd.co.uk sterlingsolutionsltd.co.uk
stowwm.co.uk stowwm.co.uk
tandhfinancialplanning.co.uk tandhfinancialplanning.co.uk
templemewswm.co.uk templemewswm.co.uk
avantiwm.co.uk avantiwm.co.uk
ayeshakhanfinancialplanning.co.uk ayeshakhanfinancialplanning.co.uk
berkeleystjames-wm.co.uk berkeleystjames-wm.co.uk
victoria-lawson.co.uk victoria-lawson.co.uk
williamsandassociatesfa.co.uk williamsandassociatesfa.co.uk
woodruffhill.co.uk woodruffhill.co.uk
cassidyfinancial.co.uk cassidyfinancial.co.uk
darrenford.co.uk darrenford.co.uk
davidsonpert.co.uk davidsonpert.co.uk
dmbwealthmanagement.co.uk dmbwealthmanagement.co.uk
dpfinplan.com dpfinplan.com
ellisonedwardswm.co.uk ellisonedwardswm.co.uk
frcfinancialplanning.co.uk frcfinancialplanning.co.uk
hawthornewealthmanagement.com hawthornewealthmanagement.com
hillcrestwm.co.uk hillcrestwm.co.uk
illingworthseddon.co.uk illingworthseddon.co.uk
iqandco.com iqandco.com
jayramfinancialservices.co.uk jayramfinancialservices.co.uk
jlwealthconsultancy.co.uk jlwealthconsultancy.co.uk
robertapugh.co.uk robertapugh.co.uk
russellpikefinancial.co.uk russellpikefinancial.co.uk
schoolfeessolutions.co.uk schoolfeessolutions.co.uk
simplicityfp.co.uk simplicityfp.co.uk
stefaniepricewealth.co.uk stefaniepricewealth.co.uk
storercfp.co.uk storercfp.co.uk
thegroveprivatewealthltd.co.uk thegroveprivatewealthltd.co.uk
batchworthwealth.co.uk batchworthwealth.co.uk
cmjfinancialplanning.co.uk cmjfinancialplanning.co.uk
davidjwalsh.co.uk davidjwalsh.co.uk
demellowandco.com demellowandco.com
dominicmarcus.co.uk dominicmarcus.co.uk
dsmcdermottfinancialplanning.co.uk dsmcdermottfinancialplanning.co.uk
edmundwilson.co.uk edmundwilson.co.uk
elliottwealthmanagement.co.uk elliottwealthmanagement.co.uk
enverwm.co.uk enverwm.co.uk
firmitasfs.co.uk firmitasfs.co.uk
frankmcmillan.co.uk frankmcmillan.co.uk
gardnerwealthmanagement.co.uk gardnerwealthmanagement.co.uk
hayeswealthmanagement.co.uk hayeswealthmanagement.co.uk
gqwm.co.uk gqwm.co.uk
guildfordfinancial.co.uk guildfordfinancial.co.uk
hampshirefinancialplanning.co.uk hampshirefinancialplanning.co.uk
iancrookwm.co.uk iancrookwm.co.uk
impactwm.co.uk impactwm.co.uk
jacquinorman.co.uk jacquinorman.co.uk
jeremybarrett.co.uk jeremybarrett.co.uk
lionbridgewealth.co.uk lionbridgewealth.co.uk
lisaeveritt.co.uk lisaeveritt.co.uk
lizmaudsleyfinancialplanning.co.uk lizmaudsleyfinancialplanning.co.uk
malcolmfrost.co.uk malcolmfrost.co.uk
mbwwealthmanagement.co.uk mbwwealthmanagement.co.uk
mellingfp.co.uk mellingfp.co.uk
meridianadvice.co.uk meridianadvice.co.uk
nigelcookewm.co.uk nigelcookewm.co.uk
njwealthplanning.co.uk njwealthplanning.co.uk
oreillywealthmanagement.co.uk oreillywealthmanagement.co.uk
richardjdavies.co.uk richardjdavies.co.uk
richardmarshall.co.uk richardmarshall.co.uk
pdfinancialmanagement.co.uk pdfinancialmanagement.co.uk
perowealthmanagement.co.uk perowealthmanagement.co.uk
peter-walmsley.co.uk peter-walmsley.co.uk
pjwwealth.co.uk pjwwealth.co.uk
placidgonzales.co.uk placidgonzales.co.uk
portburywealth.co.uk portburywealth.co.uk
richardcbooth.co.uk richardcbooth.co.uk
richardjkbrown.co.uk richardjkbrown.co.uk
rmbfc.co.uk rmbfc.co.uk
rppw.sg rppw.sg
rsrobertsonfp.co.uk rsrobertsonfp.co.uk
accessionrwm.co.uk accessionrwm.co.uk
sarahspraguewealthmanagement.co.uk sarahspraguewealthmanagement.co.uk
allenfinancial.co.uk allenfinancial.co.uk
simonbraywm.co.uk simonbraywm.co.uk
apexfinancialservices.co.uk apexfinancialservices.co.uk
carterlane.co.uk carterlane.co.uk
stevensonwealthplanning.co.uk stevensonwealthplanning.co.uk
stwwealth.co.uk stwwealth.co.uk
sunflowerfinancialplanning.co.uk sunflowerfinancialplanning.co.uk
tcolleyassociates.co.uk tcolleyassociates.co.uk
williamsbirley.co.uk williamsbirley.co.uk
willowbrooklfp.co.uk willowbrooklfp.co.uk
woodheadwm.co.uk woodheadwm.co.uk
wrightshadwell.co.uk wrightshadwell.co.uk
capitolfinancial.co.uk capitolfinancial.co.uk
capstone-financial.co.uk capstone-financial.co.uk
consiliumwmltd.co.uk consiliumwmltd.co.uk
craigjameswm.co.uk craigjameswm.co.uk
danielburnswm.co.uk danielburnswm.co.uk
darronchildspractice.co.uk darronchildspractice.co.uk
davidkeddie.co.uk davidkeddie.co.uk
edwardjowilson.co.uk edwardjowilson.co.uk
fisherwealthconsultancy.co.uk fisherwealthconsultancy.co.uk
flynnwealthmanagement.co.uk flynnwealthmanagement.co.uk
hemmensfinancial.co.uk hemmensfinancial.co.uk
hydewealthmanagement.co.uk hydewealthmanagement.co.uk
jamesbarnett.co.uk jamesbarnett.co.uk
jamescurriefinancialsolutions.co.uk jamescurriefinancialsolutions.co.uk
jamestrickett.co.uk jamestrickett.co.uk
lambert-wealth.co.uk lambert-wealth.co.uk
ljwealthmanagement.co.uk ljwealthmanagement.co.uk
lombardprivateclients.co.uk lombardprivateclients.co.uk
maclennanwealth.co.uk maclennanwealth.co.uk
mandyrodgers.co.uk mandyrodgers.co.uk
markkidd.co.uk markkidd.co.uk
mayflowerfinancialplanning.co.uk mayflowerfinancialplanning.co.uk
mcleanandpartnerswm.co.uk mcleanandpartnerswm.co.uk
mikestarkeywealthmanagement.co.uk mikestarkeywealthmanagement.co.uk
milesnovotny.co.uk milesnovotny.co.uk
modus-wealth.co.uk modus-wealth.co.uk
oloughlinandco.co.uk oloughlinandco.co.uk
pathwaywealthmanagement.co.uk pathwaywealthmanagement.co.uk
pellegriniandbarlowassociates.co.uk pellegriniandbarlowassociates.co.uk
pineapplefp.co.uk pineapplefp.co.uk
pritchardwm.co.uk pritchardwm.co.uk
quantumprivateclients.co.uk quantumprivateclients.co.uk
regencywm.co.uk regencywm.co.uk
pricewhitinghodgson.co.uk pricewhitinghodgson.co.uk
rhiannongoghfp.co.uk rhiannongoghfp.co.uk
bruceandassociates.co.uk bruceandassociates.co.uk
selectinvestors.hk selectinvestors.hk
amwm.co.uk amwm.co.uk
sjp.co.uk sjp.co.uk
spillaneassociates.co.uk spillaneassociates.co.uk
templecloudwm.co.uk templecloudwm.co.uk
thompsonnorburyfinancialplanning.co.uk thompsonnorburyfinancialplanning.co.uk
tim-watts.co.uk tim-watts.co.uk
timramptonwealthmanagement.com timramptonwealthmanagement.com
tmpwealthmanagement.co.uk tmpwealthmanagement.co.uk
beyondwm.co.uk beyondwm.co.uk
blakebrooke.co.uk blakebrooke.co.uk
vickykleboe.co.uk vickykleboe.co.uk
brecklandfinancialmanagement.co.uk brecklandfinancialmanagement.co.uk
brewsterfinancialplanning.co.uk brewsterfinancialplanning.co.uk
westwealthmanagement.co.uk westwealthmanagement.co.uk
whitfieldwealth.co.uk whitfieldwealth.co.uk
bsjfinancialplanning.co.uk bsjfinancialplanning.co.uk
calderwealthmanagement.co.uk calderwealthmanagement.co.uk
charlottepoolegraham.co.uk charlottepoolegraham.co.uk
clearwaterwm.co.uk clearwaterwm.co.uk
drpwm.com drpwm.com
ennveefinancial.co.uk ennveefinancial.co.uk
forte-financial.co.uk forte-financial.co.uk
fortresswealthpartnership.com fortresswealthpartnership.com
gkbfinancialplanning.co.uk gkbfinancialplanning.co.uk
grazianolongo.co.uk grazianolongo.co.uk
regencywealthltd.co.uk regencywealthltd.co.uk
rherbert.co.uk rherbert.co.uk
bowbrookfp.co.uk bowbrookfp.co.uk
adamjameswm.co.uk adamjameswm.co.uk
allardwhiteley.co.uk allardwhiteley.co.uk
sjp-partner-nginx-prd-asia.uk.deptagency.com sjp-partner-nginx-prd-asia.uk.deptagency.com
anthonyanderson.co.uk anthonyanderson.co.uk
andrewhugheswm.co.uk andrewhugheswm.co.uk
stringermann.com stringermann.com
swhfp.co.uk swhfp.co.uk
avocetwealth.co.uk avocetwealth.co.uk
avonwoodfinancialplanning.co.uk avonwoodfinancialplanning.co.uk
tywm.co.uk tywm.co.uk
btmwealth.co.uk btmwealth.co.uk
willgrasscornishwealthmanagement.co.uk willgrasscornishwealthmanagement.co.uk
willgrasswealthmanagement.co.uk willgrasswealthmanagement.co.uk
carringtonbond.co.uk carringtonbond.co.uk
zenithfinancial.co.uk zenithfinancial.co.uk
crusewealth.com crusewealth.com
danielgreenwm.co.uk danielgreenwm.co.uk
denmanwealthmanagement.co.uk denmanwealthmanagement.co.uk
ellisonwealth.co.uk ellisonwealth.co.uk
ewenharris.co.uk ewenharris.co.uk
fernbankwealth.co.uk fernbankwealth.co.uk
formanwealthmanagement.co.uk formanwealthmanagement.co.uk
formfinancialclarity.co.uk formfinancialclarity.co.uk
gardnerwealthmanagement.com gardnerwealthmanagement.com
ghfinancialsolutions.co.uk ghfinancialsolutions.co.uk
gillespiefinancialconsultancy.com gillespiefinancialconsultancy.com
rjvaughanwealth.co.uk rjvaughanwealth.co.uk
sandgatewealth.co.uk sandgatewealth.co.uk
advisorycube.co.uk advisorycube.co.uk
sjp-partner-nginx-prd.uk.deptagency.com sjp-partner-nginx-prd.uk.deptagency.com
sjpfoundation.co.uk sjpfoundation.co.uk
apwealth.co.uk apwealth.co.uk
stephenhopewealthmanagement.com stephenhopewealthmanagement.com
strategicwealthsolutions.co.uk strategicwealthsolutions.co.uk
avonwoodfinancialplanning.com avonwoodfinancialplanning.com
awwealth.co.uk awwealth.co.uk
thinkfinancialwealthmanagement.co.uk thinkfinancialwealthmanagement.co.uk
tomricketts.co.uk tomricketts.co.uk
bridgegatewm.co.uk bridgegatewm.co.uk
whitepeakwm.uk whitepeakwm.uk
calderwoodswm.co.uk calderwoodswm.co.uk
catherinerichardson.co.uk catherinerichardson.co.uk
chartsmorewealthltd.co.uk chartsmorewealthltd.co.uk
cheshirelifestyle.com cheshirelifestyle.com
clachanviewwm.co.uk clachanviewwm.co.uk
claremont-financial.co.uk claremont-financial.co.uk
cogentfinancial.co.uk cogentfinancial.co.uk
cpfc.org.uk cpfc.org.uk
crossleythompson.co.uk crossleythompson.co.uk
eawealth.co.uk eawealth.co.uk
gillespiefinancial.co.uk gillespiefinancial.co.uk
gillespiefinancialconsultancy.co.uk gillespiefinancialconsultancy.co.uk
gillespiefinancialconsultants.com gillespiefinancialconsultants.com
gittinsandco.com gittinsandco.com
glencastlefs.co.uk glencastlefs.co.uk
jacksonfinancial.co.uk jacksonfinancial.co.uk
johnpeoples.co.uk johnpeoples.co.uk
ltcsolutionsltd.co.uk ltcsolutionsltd.co.uk
markbeverley.co.uk markbeverley.co.uk
mooreforwealth.co.uk mooreforwealth.co.uk
nbwealthmanagement.co.uk nbwealthmanagement.co.uk
acjordanwealthmanagement.co.uk acjordanwealthmanagement.co.uk
alfristonwealth.co.uk alfristonwealth.co.uk
steggleswm.co.uk steggleswm.co.uk
stricklandwealthmanagement.co.uk stricklandwealthmanagement.co.uk
stuartdavieswealthconsultancy.co.uk stuartdavieswealthconsultancy.co.uk
sutherlandmayfairwm.co.uk sutherlandmayfairwm.co.uk
avonwoodfinancial.com avonwoodfinancial.com
baggermanwm.co.uk baggermanwm.co.uk
towerhousewm.co.uk towerhousewm.co.uk
wadewealthmanagement.co.uk wadewealthmanagement.co.uk
waltierwealthmanagement.co.uk waltierwealthmanagement.co.uk
boundstonewm.co.uk boundstonewm.co.uk
whcfp.co.uk whcfp.co.uk
whittowwilliamswalkerllp.co.uk whittowwilliamswalkerllp.co.uk
brightsidewealthmanagement.co.uk brightsidewealthmanagement.co.uk
chrishillsfc.co.uk chrishillsfc.co.uk
coleridgewm.co.uk coleridgewm.co.uk
crownwealth.co.uk crownwealth.co.uk
debenprivatewealth.co.uk debenprivatewealth.co.uk
denmanfp.com denmanfp.com
equinoxfinancialplanning.co.uk equinoxfinancialplanning.co.uk
etteca.asia etteca.asia
frostwealthmanagement.co.uk frostwealthmanagement.co.uk
gillespiefinancialconsultants.co.uk gillespiefinancialconsultants.co.uk
godivafinancialplanning.co.uk godivafinancialplanning.co.uk
hearndenandwestonwm.co.uk hearndenandwestonwm.co.uk
kgrwealth.co.uk kgrwealth.co.uk
markproberts.co.uk markproberts.co.uk
millfieldwm.com millfieldwm.com
nigelhelen.co.uk nigelhelen.co.uk
partnership.sjp.asia partnership.sjp.asia
partnership.sjp.co.uk partnership.sjp.co.uk
ksfinancialadvisers.co.uk ksfinancialadvisers.co.uk
kwmfp.co.uk kwmfp.co.uk
lansdownplace.co.uk lansdownplace.co.uk
lauriefp.co.uk lauriefp.co.uk
legatumwealthmanagement.co.uk legatumwealthmanagement.co.uk
lewingtonwealth.co.uk lewingtonwealth.co.uk
malcolmgibsonwealthmanagement.co.uk malcolmgibsonwealthmanagement.co.uk
loswealth.co.uk loswealth.co.uk
lwcwealthmanagement.co.uk lwcwealthmanagement.co.uk
mackiewealthmanagement.co.uk mackiewealthmanagement.co.uk
macphail-kennedy.co.uk macphail-kennedy.co.uk
malikzadafp.co.uk malikzadafp.co.uk
markgolesworthy.co.uk markgolesworthy.co.uk
mbfinancial-planning.co.uk mbfinancial-planning.co.uk
mdslackwealthmanagement.co.uk mdslackwealthmanagement.co.uk
middletonfp.co.uk middletonfp.co.uk
mjwsjp.co.uk mjwsjp.co.uk
monteaglewm.co.uk monteaglewm.co.uk
mrfinancial.info mrfinancial.info
neavewealth.co.uk neavewealth.co.uk
neilmorrisfinancial.co.uk neilmorrisfinancial.co.uk
maplewoodwealth.co.uk maplewoodwealth.co.uk
northwealthmanagement.co.uk northwealthmanagement.co.uk
npswealth.co.uk npswealth.co.uk
marcnorris.co.uk marcnorris.co.uk
oaktreefinancial.asia oaktreefinancial.asia
oliverwm.co.uk oliverwm.co.uk
opawealthmanagement.co.uk opawealthmanagement.co.uk
markeldor.co.uk markeldor.co.uk
orchardfinancialassociates.co.uk orchardfinancialassociates.co.uk
paulmwilliams.co.uk paulmwilliams.co.uk
peakfifteenfp.co.uk peakfifteenfp.co.uk
pennygatefinancialassociates.co.uk pennygatefinancialassociates.co.uk
philippotterwealth.co.uk philippotterwealth.co.uk
markpattersonfp.co.uk markpattersonfp.co.uk
quaylifewm.co.uk quaylifewm.co.uk
rhodianwm.co.uk rhodianwm.co.uk
richardtidy.co.uk richardtidy.co.uk
abacuswealthservices.co.uk abacuswealthservices.co.uk
robinsonfp.co.uk robinsonfp.co.uk
rodgersfamilywealth.co.uk rodgersfamilywealth.co.uk
bwfinancialplanning.co.uk bwfinancialplanning.co.uk
rubywealth.co.uk rubywealth.co.uk
adnfp.co.uk adnfp.co.uk
agilepensions.uk agilepensions.uk
schofieldassociatesfp.co.uk schofieldassociatesfp.co.uk
sdhandawealthmanagement.co.uk sdhandawealthmanagement.co.uk
searlesfinancial.co.uk searlesfinancial.co.uk
selectinvestors.asia selectinvestors.asia
alumni.sjp.co.uk alumni.sjp.co.uk
skeltons.co.uk skeltons.co.uk
solastawm.co.uk solastawm.co.uk
andrewdaldrywm.co.uk andrewdaldrywm.co.uk
andrewpaynewm.co.uk andrewpaynewm.co.uk
andrewvarleyfinancialplanning.co.uk andrewvarleyfinancialplanning.co.uk
spirewealth.co.uk spirewealth.co.uk
springwealth.co.uk springwealth.co.uk
srmfinancial.co.uk srmfinancial.co.uk
steeleaspire.co.uk steeleaspire.co.uk
steelewealthmanagement.co.uk steelewealthmanagement.co.uk
stephenkingwealthmanagement.co.uk stephenkingwealthmanagement.co.uk
stevenjerath.co.uk stevenjerath.co.uk
swanwealthmanagement.co.uk swanwealthmanagement.co.uk
swindonfinancialadvisers.uk swindonfinancialadvisers.uk
swindonfinancialservices.co.uk swindonfinancialservices.co.uk
swindonfinancialservices.uk swindonfinancialservices.uk
aswwm.co.uk aswwm.co.uk
tarporleywealth.co.uk tarporleywealth.co.uk
tempuswealth.co.uk tempuswealth.co.uk
terryhartley.co.uk terryhartley.co.uk
averywealthmanagement.co.uk averywealthmanagement.co.uk
awfwm.co.uk awfwm.co.uk
bainfa.co.uk bainfa.co.uk
tmcfc.co.uk tmcfc.co.uk
beaconfp.co.uk beaconfp.co.uk
benhiles.co.uk benhiles.co.uk
truitywealth.co.uk truitywealth.co.uk
tsfinancialplanning.co.uk tsfinancialplanning.co.uk
ubuntuwealthmanagement.co.uk ubuntuwealthmanagement.co.uk
beverleyfinancialmanagement.co.uk beverleyfinancialmanagement.co.uk
bhwml.com bhwml.com
unaking.co.uk unaking.co.uk
vfcwealthmanagement.co.uk vfcwealthmanagement.co.uk
vinewealth.co.uk vinewealth.co.uk
blythswood.com blythswood.com
whistonwealth.com whistonwealth.com
willcoxwealthmanagement.co.uk willcoxwealthmanagement.co.uk
rafflesplaceprivatewealth.com rafflesplaceprivatewealth.com
calderwoodfinancial.co.uk calderwoodfinancial.co.uk
cheshirewealthconsultancy.co.uk cheshirewealthconsultancy.co.uk
clareclarkson.co.uk clareclarkson.co.uk
colewealthmanagement.co.uk colewealthmanagement.co.uk
darcyfp.co.uk darcyfp.co.uk
dfwealthmanagement.co.uk dfwealthmanagement.co.uk
dlwm.co.uk dlwm.co.uk
dowdallwealthmanagement.co.uk dowdallwealthmanagement.co.uk
drsaqibkarim.co.uk drsaqibkarim.co.uk
duncanmaw.co.uk duncanmaw.co.uk
eastgatewealthmanagementltd.co.uk eastgatewealthmanagementltd.co.uk
edgintonstanley.co.uk edgintonstanley.co.uk
farisnori.co.uk farisnori.co.uk
fifteenfinancialplanning.co.uk fifteenfinancialplanning.co.uk
firmstonewealth.co.uk firmstonewealth.co.uk
foresightfs.co.uk foresightfs.co.uk
freddieansah.co.uk freddieansah.co.uk
futureperfectwealthmanagement.co.uk futureperfectwealthmanagement.co.uk
georgeshippam.co.uk georgeshippam.co.uk
goldenacornfp.co.uk goldenacornfp.co.uk
gpfp.co.uk gpfp.co.uk
grahamlavinwealthmanagement.co.uk grahamlavinwealthmanagement.co.uk
graysonlewis.co.uk graysonlewis.co.uk
greenfortpw.com greenfortpw.com
gritstone-fp.co.uk gritstone-fp.co.uk
haydnlewis.co.uk haydnlewis.co.uk
hendredfinancialpartners.co.uk hendredfinancialpartners.co.uk
hipstagram.com hipstagram.com
hoadley-financial.co.uk hoadley-financial.co.uk
holmesfinancialplanning.co.uk holmesfinancialplanning.co.uk
hudsonandrogersfinancial.co.uk hudsonandrogersfinancial.co.uk
ipswichfs.co.uk ipswichfs.co.uk
jameshunwickewealthmanagement.co.uk jameshunwickewealthmanagement.co.uk
jcrwealth.co.uk jcrwealth.co.uk
jensenwealth.co.uk jensenwealth.co.uk
joebointon.co.uk joebointon.co.uk
jonesregan.co.uk jonesregan.co.uk
jopowis.co.uk jopowis.co.uk
julianhoweswealthmanagement.co.uk julianhoweswealthmanagement.co.uk
justicewealth.co.uk justicewealth.co.uk
kfhwm.co.uk kfhwm.co.uk
kieranfowley.co.uk kieranfowley.co.uk
mentmorefp.co.uk mentmorefp.co.uk
monriewm.co.uk monriewm.co.uk
kaplan-planwell.co.uk kaplan-planwell.co.uk
keyhavenwealth.co.uk keyhavenwealth.co.uk
keyplanwealth.co.uk keyplanwealth.co.uk
knightturnerprivateclients.co.uk knightturnerprivateclients.co.uk
krc-wealth-management.co.uk krc-wealth-management.co.uk
lafirmasantana.com lafirmasantana.com
lawcapitalwealth.co.uk lawcapitalwealth.co.uk
lpfinancial.co.uk lpfinancial.co.uk
lucernawealth.com lucernawealth.com
malcolmodonovan.co.uk malcolmodonovan.co.uk
mansionhousefinancialplanning.co.uk mansionhousefinancialplanning.co.uk
marginsfinancialsolutions.co.uk marginsfinancialsolutions.co.uk
marklowewm.co.uk marklowewm.co.uk
markwheatleywealth.co.uk markwheatleywealth.co.uk
michaelkylewm.co.uk michaelkylewm.co.uk
midlandswealthmanagement.co.uk midlandswealthmanagement.co.uk
minsterfinancialplanning.co.uk minsterfinancialplanning.co.uk
mjonesandco.co.uk mjonesandco.co.uk
moorefinancialwellbeing.co.uk moorefinancialwellbeing.co.uk
msestatesandfinancialservices.co.uk msestatesandfinancialservices.co.uk
murfittwealth.co.uk murfittwealth.co.uk
myleschurchill.com myleschurchill.com
nandsfp.co.uk nandsfp.co.uk
neptunefinancialmanagement.co.uk neptunefinancialmanagement.co.uk
nightingalewealth.co.uk nightingalewealth.co.uk
oakridgewealth.co.uk oakridgewealth.co.uk
onewealthltd.co.uk onewealthltd.co.uk
markcosgrave.co.uk markcosgrave.co.uk
orangetreefs.co.uk orangetreefs.co.uk
paulmageewealthmanagement.co.uk paulmageewealthmanagement.co.uk
powerfinancialmanagement.co.uk powerfinancialmanagement.co.uk
priteshpankhania.com priteshpankhania.com
marlowwealth.co.uk marlowwealth.co.uk
richardburchnall.co.uk richardburchnall.co.uk
rnpwealth.co.uk rnpwealth.co.uk
roxburghonline.co.uk roxburghonline.co.uk
russellgreer.co.uk russellgreer.co.uk
bradbyswm.co.uk bradbyswm.co.uk
ryanmcguinnesswm.co.uk ryanmcguinnesswm.co.uk
accelerator.sjp-cloud.info accelerator.sjp-cloud.info
saltandlightfs.co.uk saltandlightfs.co.uk
adeptiowm.co.uk adeptiowm.co.uk
sarahmcgurkwealthmanagement.co.uk sarahmcgurkwealthmanagement.co.uk
seekerfinancial.co.uk seekerfinancial.co.uk
shandandburnsfinancial.co.uk shandandburnsfinancial.co.uk
sherpawealth.uk sherpawealth.uk
allensykeswm.com allensykeswm.com
albionhousewm.co.uk albionhousewm.co.uk
mimigom.co.uk mimigom.co.uk
siddonsand.co siddonsand.co
sigmafp.co.uk sigmafp.co.uk
skylarkwealth.co.uk skylarkwealth.co.uk
andrewgrayafp.co.uk andrewgrayafp.co.uk
sophiederouet.co.uk sophiederouet.co.uk
spco.co.uk spco.co.uk
srgwealthmanagement.co.uk srgwealthmanagement.co.uk
steadfastwm.co.uk steadfastwm.co.uk
stoneswealth.co.uk stoneswealth.co.uk
stpetersfinancialplanning.co.uk stpetersfinancialplanning.co.uk
suffolkfp.co.uk suffolkfp.co.uk
summitfinancial.asia summitfinancial.asia
agilelife.uk agilelife.uk
asmwealth.com asmwealth.com
tedreesltd.co.uk tedreesltd.co.uk
availfinancialplanning.co.uk availfinancialplanning.co.uk
thelockyerpartnership.co.uk thelockyerpartnership.co.uk
tomworley.co.uk tomworley.co.uk
torweybridge.co.uk torweybridge.co.uk
truenorthfp.co.uk truenorthfp.co.uk
vantagewm.co.uk vantagewm.co.uk
vaughanwealth.co.uk vaughanwealth.co.uk
virtusfp.co.uk virtusfp.co.uk
wandco-fp.co.uk wandco-fp.co.uk
walmsleyfinancialplanning.co.uk walmsleyfinancialplanning.co.uk
whfinancialwellbeing.co.uk whfinancialwellbeing.co.uk
whrwealthmanagement.co.uk whrwealthmanagement.co.uk
brwm.org.uk brwm.org.uk
woodmitchellfp.com woodmitchellfp.com
calderdaviswealthmanagement.co.uk calderdaviswealthmanagement.co.uk
cambridgefinancialadvisers.co.uk cambridgefinancialadvisers.co.uk
carefeeadvice.co.uk carefeeadvice.co.uk
carrfinancialplanning.co.uk carrfinancialplanning.co.uk
charlesjoneswealthmanagement.co.uk charlesjoneswealthmanagement.co.uk
clarkwm.co.uk clarkwm.co.uk
cooperassociateswm.com cooperassociateswm.com
darrenknibbwealthmanagement.co.uk darrenknibbwealthmanagement.co.uk
davesouthbyfp.co.uk davesouthbyfp.co.uk
davidjohnsonfp.co.uk davidjohnsonfp.co.uk
davidsonfinancialplanning.co.uk davidsonfinancialplanning.co.uk
earleywm.co.uk earleywm.co.uk
edwardtrehearne.co.uk edwardtrehearne.co.uk
emeraldassociates.co.uk emeraldassociates.co.uk
excaliburwm.co.uk excaliburwm.co.uk
familytreewealthmanagement.co.uk familytreewealthmanagement.co.uk
farrierrose.co.uk farrierrose.co.uk
financialmerrett.co.uk financialmerrett.co.uk
macaulaywm.co.uk macaulaywm.co.uk
francefinancial.co.uk francefinancial.co.uk
frontierwealth.co.uk frontierwealth.co.uk
futurumfa.co.uk futurumfa.co.uk
gapstowwealth.co.uk gapstowwealth.co.uk
greatoakfp.co.uk greatoakfp.co.uk
gregorhowitt.co.uk gregorhowitt.co.uk
hillsidefinancialplanning.co.uk hillsidefinancialplanning.co.uk
hjpcfp.com hjpcfp.com
hodgewealthmanagement.co.uk hodgewealthmanagement.co.uk
horshamfinancial.co.uk horshamfinancial.co.uk
huntminasfinancial.co.uk huntminasfinancial.co.uk
integralwm.co.uk integralwm.co.uk
ivanhoefp.co.uk ivanhoefp.co.uk
jamesbournewm.com jamesbournewm.com
jckfinancialeducation.co.uk jckfinancialeducation.co.uk
jgriver.co jgriver.co
cordnerwealthmanagement.co.uk cordnerwealthmanagement.co.uk
eatonwealthmanagement.co.uk eatonwealthmanagement.co.uk
gnkwealthmanagement.co.uk gnkwealthmanagement.co.uk
rebeccabailey.co.uk rebeccabailey.co.uk
reflectfp.co.uk reflectfp.co.uk
repositorywealth.co.uk repositorywealth.co.uk
rmcfp.co.uk rmcfp.co.uk
acwwealthmanagement.co.uk acwwealthmanagement.co.uk
hauxwellwealthmanagement.co.uk hauxwellwealthmanagement.co.uk
saxtonfp.co.uk saxtonfp.co.uk
scottjameswealthmanagement.co.uk scottjameswealthmanagement.co.uk
scrimgerandoakes.co.uk scrimgerandoakes.co.uk
seven-wealth.co.uk seven-wealth.co.uk
allardwealth.co.uk allardwealth.co.uk
shawfieldwealthmanagement.co.uk shawfieldwealthmanagement.co.uk
shearwoodfinancialmanagement.co.uk shearwoodfinancialmanagement.co.uk
silveroakfs.co.uk silveroakfs.co.uk
sjmfinancial.co.uk sjmfinancial.co.uk
sjp.asia sjp.asia
autuswealth.co.uk autuswealth.co.uk
antlerwealth.com antlerwealth.com
antlerwealth.asia antlerwealth.asia
srmfs.co.uk srmfs.co.uk
appartnerswealth.co.uk appartnerswealth.co.uk
stephenboylewealthmanagement.co.uk stephenboylewealthmanagement.co.uk
stephenhydewealthmanagement.co.uk stephenhydewealthmanagement.co.uk
sterlingadvice.co.uk sterlingadvice.co.uk
strakerfp.co.uk strakerfp.co.uk
aspirelane.co.uk aspirelane.co.uk
stuartthom.co.uk stuartthom.co.uk
sullivanandcofp.co.uk sullivanandcofp.co.uk
swannfinancial.com swannfinancial.com
swindonfinancialadvisers.co.uk swindonfinancialadvisers.co.uk
angieaddisonfinancial.co.uk angieaddisonfinancial.co.uk
athelisfinancial.co.uk athelisfinancial.co.uk
aurorafinancialservices.co.uk aurorafinancialservices.co.uk
avonwoodfinancialplanning.uk avonwoodfinancialplanning.uk
thameswealth.co.uk thameswealth.co.uk
bardenwealthmanagement.co.uk bardenwealthmanagement.co.uk
trueselfwealth.co.uk trueselfwealth.co.uk
berryfinancial.co.uk berryfinancial.co.uk
birchwealthmanagement.co.uk birchwealthmanagement.co.uk
watchhousefp.co.uk watchhousefp.co.uk
waymarkerfinancial.co.uk waymarkerfinancial.co.uk
wellbankwm.co.uk wellbankwm.co.uk
westwellwm.co.uk westwellwm.co.uk
whittinghamprivateclients.com whittinghamprivateclients.com
wokingfinancialadviser.co.uk wokingfinancialadviser.co.uk
bullivantwealth.co.uk bullivantwealth.co.uk
cgafinancial.co.uk cgafinancial.co.uk
christopherpughwealthmanagement.co.uk christopherpughwealthmanagement.co.uk
claywealth.co.uk claywealth.co.uk
cleevefinancialplanning.co.uk cleevefinancialplanning.co.uk
colebridgefs.co.uk colebridgefs.co.uk
compoundwealth.uk compoundwealth.uk
coralfp.co.uk coralfp.co.uk
cowgillwealthmanagement.co.uk cowgillwealthmanagement.co.uk
craigcrawfordfinancial.co.uk craigcrawfordfinancial.co.uk
craigsaxtonwm.co.uk craigsaxtonwm.co.uk
custom.sjp-cloud.info custom.sjp-cloud.info
dalemurtenwealthmanagement.co.uk dalemurtenwealthmanagement.co.uk
declankiely.co.uk declankiely.co.uk
dmcfp.co.uk dmcfp.co.uk
dunnewealthmanagement.co.uk dunnewealthmanagement.co.uk
dwwealthplanning.co.uk dwwealthplanning.co.uk
eastlakewm.co.uk eastlakewm.co.uk
emilyman.com emilyman.com
farrfinancialplanning.co.uk farrfinancialplanning.co.uk
filsellwealth.co.uk filsellwealth.co.uk
financialplanningformedics.co.uk financialplanningformedics.co.uk
finlaywealth.co.uk finlaywealth.co.uk
forethoughtfinancial.co.uk forethoughtfinancial.co.uk
fortitudewealthmanagement.co.uk fortitudewealthmanagement.co.uk
fskfinancialplanning.co.uk fskfinancialplanning.co.uk
goldenacornfp.com goldenacornfp.com
hartfp.co.uk hartfp.co.uk
hfkwealth.co.uk hfkwealth.co.uk
majoroakwm.co.uk majoroakwm.co.uk
hsprivatewealth.co.uk hsprivatewealth.co.uk
isaacwealth.co.uk isaacwealth.co.uk
jamesdrowley.co.uk jamesdrowley.co.uk
jamesonwealthmanagement.co.uk jamesonwealthmanagement.co.uk
jasonbellissimo.co.uk jasonbellissimo.co.uk
jdcfinancialplanning.co.uk jdcfinancialplanning.co.uk
jenkinsonwealth.co.uk jenkinsonwealth.co.uk
jkb-wealth.co.uk jkb-wealth.co.uk
joannefogowm.co.uk joannefogowm.co.uk
joejoblingwealthmanagement.co.uk joejoblingwealthmanagement.co.uk
johngoldiewm.co.uk johngoldiewm.co.uk
johnhomewealthmanagement.co.uk johnhomewealthmanagement.co.uk
jpwealthmanagement.co.uk jpwealthmanagement.co.uk
kenwoodwealthmanagement.co.uk kenwoodwealthmanagement.co.uk
kilsaranfp.co.uk kilsaranfp.co.uk
lamymanandco.co.uk lamymanandco.co.uk
langwealthmanagement.co.uk langwealthmanagement.co.uk
laurajoycewealthmanagement.co.uk laurajoycewealthmanagement.co.uk
lemontfp.co.uk lemontfp.co.uk
libertywm.co.uk libertywm.co.uk
longsandsfp.co.uk longsandsfp.co.uk
mantafp.co.uk mantafp.co.uk
martaderpenska.co.uk martaderpenska.co.uk
mattimorewealth.co.uk mattimorewealth.co.uk
mcgillwm.co.uk mcgillwm.co.uk
michaelheard.co.uk michaelheard.co.uk
mjrfinancialplanning.co.uk mjrfinancialplanning.co.uk
mkm-wm.co.uk mkm-wm.co.uk
mollamwm.co.uk mollamwm.co.uk
morrinsonwealth.co.uk morrinsonwealth.co.uk
mwandpartners.co.uk mwandpartners.co.uk
naomihaynes.co.uk naomihaynes.co.uk
nauticalwealth.co.uk nauticalwealth.co.uk
nicholasbonefinancial.co.uk nicholasbonefinancial.co.uk
norfolkwealth.co.uk norfolkwealth.co.uk
norifinancial.co.uk norifinancial.co.uk
oaksmithfinancialplanning.co.uk oaksmithfinancialplanning.co.uk
oakwaywm.co.uk oakwaywm.co.uk
originwm.co.uk originwm.co.uk
revolutionwealth.co.uk revolutionwealth.co.uk
pantheonwealthpartners.co.uk pantheonwealthpartners.co.uk
pardeepnarwal.co.uk pardeepnarwal.co.uk
parnellfinancialmanagement.com parnellfinancialmanagement.com
richardmarshall.uk richardmarshall.uk
pearsonfinancialwellbeing.co.uk pearsonfinancialwellbeing.co.uk
penrose.website-testing-link.net penrose.website-testing-link.net
ripplewealth.co.uk ripplewealth.co.uk
petrichorfinancialsolutions.com petrichorfinancialsolutions.com
philipblackwealthmanagement.co.uk philipblackwealthmanagement.co.uk
planitfuture.co.uk planitfuture.co.uk
planned-wealth.co.uk planned-wealth.co.uk
portsdownwealthmanagement.co.uk portsdownwealthmanagement.co.uk
priteshkabawala.co.uk priteshkabawala.co.uk
progressivewealth.co.uk progressivewealth.co.uk
psrwm.co.uk psrwm.co.uk
rabeyaislam.co.uk rabeyaislam.co.uk
mcqueenwealth.co.uk mcqueenwealth.co.uk
mcgwealth.co.uk mcgwealth.co.uk
mendipwm.co.uk mendipwm.co.uk
midlandfp.co.uk midlandfp.co.uk
rexwealth.co.uk rexwealth.co.uk
richardjhewlett.co.uk richardjhewlett.co.uk
richardreith.co.uk richardreith.co.uk
rkpwealthmanagement.co.uk rkpwealthmanagement.co.uk
sapphirefinancialplanning.com sapphirefinancialplanning.com
advice-on-line.co.uk advice-on-line.co.uk
akrwealth.co.uk akrwealth.co.uk
altairfp.co.uk altairfp.co.uk
sgwealth.co.uk sgwealth.co.uk
sharpwm.co.uk sharpwm.co.uk
sherwoodsolutions.com sherwoodsolutions.com
simplewealthsolutions.co.uk simplewealthsolutions.co.uk
southoverwealth.co.uk southoverwealth.co.uk
sparkwealth.co.uk sparkwealth.co.uk
andyheyes.co.uk andyheyes.co.uk
spinnaker-wealth.co.uk spinnaker-wealth.co.uk
spinnakerwealth.co.uk spinnakerwealth.co.uk
ssl-test.sjp-cloud.info ssl-test.sjp-cloud.info
stephendawsonwealthmanagement.co.uk stephendawsonwealthmanagement.co.uk
stephensonwealthmanagement.co.uk stephensonwealthmanagement.co.uk
stjulienfp.co.uk stjulienfp.co.uk
abreyprivateclients.com abreyprivateclients.com
surreyoakswm.co.uk surreyoakswm.co.uk
alderleyfinancialplanning.co.uk alderleyfinancialplanning.co.uk
swfsltd.co.uk swfsltd.co.uk
swilcanfinancialpartners.co.uk swilcanfinancialpartners.co.uk
amicafinancialwellbeing.co.uk amicafinancialwellbeing.co.uk
tait.financial tait.financial
taylorwealthmanagement.co.uk taylorwealthmanagement.co.uk
templepiper.co.uk templepiper.co.uk
avfp.co.uk avfp.co.uk
avongreenfinancial.co.uk avongreenfinancial.co.uk
avonwoodfinancial.uk avonwoodfinancial.uk
theethicalwealthproject.co.uk theethicalwealthproject.co.uk
tiffanybeardfinancialadvisers.co.uk tiffanybeardfinancialadvisers.co.uk
tilikumwealth.co.uk tilikumwealth.co.uk
trbeardwealth.co.uk trbeardwealth.co.uk
belgravefinancial.com belgravefinancial.com
bentleybrownandco.co.uk bentleybrownandco.co.uk
twachartered.co.uk twachartered.co.uk
twcfinancial.co.uk twcfinancial.co.uk
tweedieandwyllie.co.uk tweedieandwyllie.co.uk
venturawealth.co.uk venturawealth.co.uk
blackfinwm.co.uk blackfinwm.co.uk
vivawealth.co.uk vivawealth.co.uk
warwickshirewealthmanagement.co.uk warwickshirewealthmanagement.co.uk
wellsandcofinancialplanning.co.uk wellsandcofinancialplanning.co.uk
brcwm.co.uk brcwm.co.uk
whitfeldfinancialplanning.co.uk whitfeldfinancialplanning.co.uk
whitstablefp.co.uk whitstablefp.co.uk
wildandwildwm.co.uk wildandwildwm.co.uk
bromleyrahlke.co.uk bromleyrahlke.co.uk
bromptonprivatewealth.co.uk bromptonprivatewealth.co.uk
williamstreetwealth.co.uk williamstreetwealth.co.uk
williamswealthconsultancy.co.uk williamswealthconsultancy.co.uk
woodmitchellfp.co.uk woodmitchellfp.co.uk
yasutoarai.co.uk yasutoarai.co.uk
yltwealthmanagement.co.uk yltwealthmanagement.co.uk
challonerwealth.com challonerwealth.com
chequersfinancialplanning.co.uk chequersfinancialplanning.co.uk
choices.sjp.co.uk choices.sjp.co.uk
chrisbromiley.co.uk chrisbromiley.co.uk
chriswordsworthfinancialplanning.co.uk chriswordsworthfinancialplanning.co.uk
ciaranpreshurwm.co.uk ciaranpreshurwm.co.uk
compass-fs.org compass-fs.org
comptonfinancialadvice.co.uk comptonfinancialadvice.co.uk
connectedfinancial.co.uk connectedfinancial.co.uk
cotterell-wilkie.co.uk cotterell-wilkie.co.uk
crescentwm.co.uk crescentwm.co.uk
cthfinancialplanning.co.uk cthfinancialplanning.co.uk
cuthbertsonwealthmanagement.com cuthbertsonwealthmanagement.com
davidjoneswealthmanagement.co.uk davidjoneswealthmanagement.co.uk
davidwilkinsonsjp.co.uk davidwilkinsonsjp.co.uk
davieswealthmanagement.uk davieswealthmanagement.uk
ellisonwealthmanagement.co.uk ellisonwealthmanagement.co.uk
ellisonwwm.co.uk ellisonwwm.co.uk
elmhurstfinancialplanning.co.uk elmhurstfinancialplanning.co.uk
ffwm.co.uk ffwm.co.uk
finative.co.uk finative.co.uk
fordhamfinancialplanning.co.uk fordhamfinancialplanning.co.uk
forest-oak.co.uk forest-oak.co.uk
fortispw.co.uk fortispw.co.uk
gallacherwealth.uk gallacherwealth.uk
grindalwealthmanagement.co.uk grindalwealthmanagement.co.uk
gwwealth.co.uk gwwealth.co.uk
hamiltonbennett.co.uk hamiltonbennett.co.uk
hansawealthmanagement.co.uk hansawealthmanagement.co.uk
helenmrogers.co.uk helenmrogers.co.uk
hexafinancialplanning.co.uk hexafinancialplanning.co.uk
hutchesonfinancial.co.uk hutchesonfinancial.co.uk
hwmfinancial.co.uk hwmfinancial.co.uk
iriswm.co.uk iriswm.co.uk
jafp.co.uk jafp.co.uk
jdwealthmanagement.co.uk jdwealthmanagement.co.uk
jeremydavieswm.co.uk jeremydavieswm.co.uk
joblingwm.co.uk joblingwm.co.uk
jonathanstorrwm.co.uk jonathanstorrwm.co.uk
jrmwealth.co.uk jrmwealth.co.uk
juxonwealth.com juxonwealth.com
kbruce.co.uk kbruce.co.uk
kevindenman.co.uk kevindenman.co.uk
kilbrinfinancial.co.uk kilbrinfinancial.co.uk
kingsfordwealthmanagement.co.uk kingsfordwealthmanagement.co.uk
lawrenceneilwealthmanagement.co.uk lawrenceneilwealthmanagement.co.uk
leeperkes.co.uk leeperkes.co.uk
lethbridgewm.co.uk lethbridgewm.co.uk
limestonefp.co.uk limestonefp.co.uk
lisamccreadiewealthmanagement.co.uk lisamccreadiewealthmanagement.co.uk
ljgwealth.co.uk ljgwealth.co.uk
lochriefp.co.uk lochriefp.co.uk
lordstonefinancial.co.uk lordstonefinancial.co.uk
macleodfinancial.co.uk macleodfinancial.co.uk
majorcontext.com majorcontext.com
marktigwell.co.uk marktigwell.co.uk
mphwealthmanagement.co.uk mphwealthmanagement.co.uk
mwwealth.co.uk mwwealth.co.uk
nickhowells.co.uk nickhowells.co.uk
nineoak.co.uk nineoak.co.uk
obwealth.co.uk obwealth.co.uk
ocsfinancialplanning.co.uk ocsfinancialplanning.co.uk
oneillwealth.co.uk oneillwealth.co.uk
orangetreewealthmanagement.co.uk orangetreewealthmanagement.co.uk
ovalwealthpartners.co.uk ovalwealthpartners.co.uk
ovieo.co.uk ovieo.co.uk
paragonwealth.co.uk paragonwealth.co.uk
parallelwealthmanagement.co.uk parallelwealthmanagement.co.uk
parksidefinancialplanning.co.uk parksidefinancialplanning.co.uk
parrettfinancial.co.uk parrettfinancial.co.uk
pathfinderpw.co.uk pathfinderpw.co.uk
petrichorfinancialsolutions.co.uk petrichorfinancialsolutions.co.uk
reddingswmltd.co.uk reddingswmltd.co.uk
regentdow.co.uk regentdow.co.uk
GILLESPIEFINANCIAL.COM
IP History

Click the IP addresses to see over domains using them.