HELLOALEPPO.COM
Shared Attributes
Domain
hellomaseru.com hellomaseru.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 148 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 26 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
DM DM-101492 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellodavao.com hellodavao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Jun 2019 Aug 2019 50 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellomoroni.com hellomoroni.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
hellotolyatti.com hellotolyatti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellomalabo.com hellomalabo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
DM DM-101492 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
FWHL FWHL-762769 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
hellonagoya.com hellonagoya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
CA CA-PUB-4449341246402301 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
DM DM-101492 May 2019 May 2019 One Off
SVRN SVRN-261774 May 2019 May 2019 One Off
IEX IEX-189205 Jun 2019 Jun 2019 One Off
hellonanaimo.com hellonanaimo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellozibo.com hellozibo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
helloalexandriaegypt.com helloalexandriaegypt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
GTM GTM-UA-118129358-1 Mar 2020 Jan 2021 298 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
hellogaziantep.com hellogaziantep.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
DM DM-101492 Jun 2019 Dec 2019 175 days
ORC ORC-963 May 2019 Oct 2019 159 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
hellomanagua.com hellomanagua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
hellombuji-mayi.com hellombuji-mayi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellonovosibirsk.com hellonovosibirsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
LIJI LIJI-261774 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellotaraz.com hellotaraz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
hellococoa.com hellococoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellolucern.com hellolucern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Mar 2020 1 year, 227 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118129358-1 Feb 2020 Mar 2020 35 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloshanghai.com helloshanghai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
UA UA-121239807 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
hellotahiti.com hellotahiti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellotahlequah.com hellotahlequah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloyazoo.com helloyazoo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-AW-804755169 Oct 2019 Dec 2019 64 days
AOL AOL-6614 Oct 2019 Dec 2019 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellobengaluru.com hellobengaluru.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
DM DM-101492 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloflagstaff.com helloflagstaff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
hellohalifax.com hellohalifax.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
DM DM-101492 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellomenasha.com hellomenasha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
IEX IEX-189205 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellonatchez.com hellonatchez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloneenah.com helloneenah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
helloomaha.com helloomaha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloportsaid.com helloportsaid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
AOL AOL-6614 Oct 2019 Mar 2020 163 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
helloqingdao.com helloqingdao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6614 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Jun 2019 Aug 2019 50 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellosuffolk.com hellosuffolk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellowindhoek.com hellowindhoek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
CA CA-PUB-5369125237996028 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellowinston-salem.com hellowinston-salem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellozaporizhzhya.com hellozaporizhzhya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 May 2019 Jun 2019 48 days
DM DM-101492 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
IEX IEX-189205 Jun 2019 Jun 2019 One Off
hellofez.com hellofez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
UA UA-121239807 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellopinebluff.com hellopinebluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellopoplarbluff.com hellopoplarbluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellosavannah.com hellosavannah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloscottsbluff.com helloscottsbluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloshoreview.com helloshoreview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
AOL AOL-6614 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
hellosiemreap.com hellosiemreap.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6614 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 64 days
GTM GTM-AW-804755169 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellosioux.com hellosioux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
DM DM-101492 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloantigua.com helloantigua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
helloaruba.com helloaruba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellogalt.com hellogalt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
helloluzern.com helloluzern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Mar 2020 1 year, 227 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
hellomoundsview.com hellomoundsview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellonewyorkcity.com hellonewyorkcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
ORC ORC-963 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 260 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
AOL AOL-6614 Jul 2019 Mar 2020 245 days
GUMG GUMG-13810 Jul 2019 Mar 2020 245 days
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
YUME YUME-4016333178 Jul 2019 Mar 2020 245 days
TEAD TEAD-16544 Jul 2019 Mar 2020 245 days
TELA TELA-457 Jul 2019 Mar 2020 245 days
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Jul 2019 Feb 2020 210 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
DM DM-101492 Sep 2019 Mar 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Sep 2019 104 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-261774 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloouagadougou.com helloouagadougou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
IEX IEX-189205 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
helloradcliff.com helloradcliff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellostockholm.com hellostockholm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellotamarac.com hellotamarac.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
DM DM-101492 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
helloutah.com helloutah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloajax.com helloajax.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
DM DM-101492 Jun 2019 Dec 2019 175 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 May 2019 Jun 2019 48 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Jun 2019 Jun 2019 One Off
helloconnecticut.com helloconnecticut.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
DM DM-101492 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
hellofortaleza.com hellofortaleza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
IEX IEX-189205 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
hellogaza.com hellogaza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
DM DM-101492 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
helloglenview.com helloglenview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
AOL AOL-6614 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-5369125237996028 Jun 2019 Jun 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
LIJI LIJI-261774 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
hellograz.com hellograz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
helloizhevsk.com helloizhevsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Nov 2018 Jun 2019 226 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
hellomacomb.com hellomacomb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
DM DM-101492 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
AOL AOL-6614 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 128 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Feb 2020 Feb 2020 One Off
hellonorfolk.com hellonorfolk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
IEX IEX-189205 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellosaintjohn.com hellosaintjohn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellosalem.com hellosalem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellotaunggyi.com hellotaunggyi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
helloanaheim.com helloanaheim.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
ORC ORC-963 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Oct 2019 Dec 2019 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
UA UA-121239807 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
hellobelleview.com hellobelleview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
AOL AOL-6614 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
GTM GTM-AW-804755169 Oct 2019 Dec 2019 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellodearborn.com hellodearborn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Oct 2019 Dec 2019 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
hellogenoa.com hellogenoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
AOL AOL-6614 May 2019 Oct 2019 159 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellohuntsville.com hellohuntsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
AOL AOL-6614 Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
ORC ORC-963 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
DM DM-101492 Nov 2019 Mar 2020 124 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-261774 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
LIJI LIJI-261774 Sep 2019 Nov 2019 65 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellonorwalk.com hellonorwalk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloorem.com helloorem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellosandusky.com hellosandusky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Feb 2020 239 days
AOL AOL-6614 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
hellosaratov.com hellosaratov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
AOL AOL-6614 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-963 May 2019 Jun 2019 48 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
hellothibodaux.com hellothibodaux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
hellothimphu.com hellothimphu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 128 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
helloalsip.com helloalsip.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
IEX IEX-189205 Jun 2019 Aug 2019 50 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
helloeastchicago.com helloeastchicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 May 2019 Jun 2019 48 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
hellofaribault.com hellofaribault.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
ORC ORC-963 Jun 2019 Dec 2019 175 days
DM DM-101492 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
AOL AOL-6614 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellolittleelm.com hellolittleelm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellolodz.com hellolodz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-963 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
hellominneapolis.com hellominneapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
ORC ORC-963 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-261774 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellooakcreek.com hellooakcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Jan 2021 2 years, 68 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-UA-118163407-2 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellooconomowoc.com hellooconomowoc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 Jun 2019 Dec 2019 175 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellosantacruz.com hellosantacruz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
AOL AOL-6614 Oct 2019 Mar 2020 163 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-AW-804755169 Oct 2019 Dec 2019 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
ORC ORC-963 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Dec 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellochattanooga.com hellochattanooga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
hellodc.com hellodc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellograndview.com hellograndview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
helloguelph.com helloguelph.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
IEX IEX-189205 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-6614 May 2019 May 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
hellokentucky.com hellokentucky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
DM DM-101492 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-AW-804755169 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 May 2019 Jun 2019 48 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
IEX IEX-189205 Feb 2020 Feb 2020 One Off
helloqueencreek.com helloqueencreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Jan 2021 2 years, 68 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellosouthlaketahoe.com hellosouthlaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
DM DM-101492 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
hellotelaviv.com hellotelaviv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-11647 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
helloadisabeba.com helloadisabeba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
AOL AOL-6614 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellolibya.com hellolibya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
SVRN SVRN-261774 May 2019 May 2019 One Off
LIJI LIJI-261774 May 2019 May 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
helloottawa.com helloottawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
AOL AOL-6614 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
helloperu.com helloperu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 148 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
CA CA-PUB-5369125237996028 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 26 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
helloplainview.com helloplainview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Jun 2019 Aug 2019 50 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
hellosanmateo.com hellosanmateo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
ORC ORC-963 Jun 2019 Dec 2019 175 days
DM DM-101492 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
hellobellevue.com hellobellevue.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
AOL AOL-6614 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
FWHL FWHL-762769 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
helloistanbul.com helloistanbul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
CONN CONN-102738 Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
DM DM-101492 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CUZ310G2 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Oct 2019 Oct 2019 One Off
NEX NEX-3391 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Dec 2019 Dec 2019 One Off
hellomaiduguri.com hellomaiduguri.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
DM DM-101492 Jun 2019 Dec 2019 175 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
ORC ORC-963 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
hellomalibu.com hellomalibu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Oct 2019 Dec 2019 64 days
AOL AOL-6614 May 2019 May 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
hellomccomb.com hellomccomb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellomerced.com hellomerced.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
TEAD TEAD-16544 Jul 2019 Mar 2020 245 days
LIJI LIJI-261774 Jul 2019 Mar 2020 245 days
TELA TELA-457 Jul 2019 Mar 2020 245 days
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
YUME YUME-4016333178 Jul 2019 Mar 2020 245 days
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
GUMG GUMG-13810 Jul 2019 Mar 2020 245 days
DM DM-101492 Jul 2019 Mar 2020 231 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
ORC ORC-963 Sep 2019 Mar 2020 189 days
LIJI LIJI-265277 Aug 2019 Jan 2020 165 days
TREM TREM-J54V6-5C8FF Aug 2019 Jan 2020 165 days
IEX IEX-189205 Sep 2019 Feb 2020 154 days
GTM GTM-UA-121239807-2 Jul 2019 Dec 2019 146 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
MEDI MEDI-8CU7QPX3O Sep 2019 Nov 2019 65 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
SVRN SVRN-261774 Jul 2019 Aug 2019 21 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Sep 2019 Sep 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
hellomississippi.com hellomississippi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
helloparamaribo.com helloparamaribo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
GTM GTM-UA-118129358-1 Feb 2020 Nov 2020 260 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
helloquebec.com helloquebec.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
DM DM-101492 Aug 2019 Dec 2019 125 days
ORC ORC-963 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloriorancho.com helloriorancho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Jan 2021 1 year, 255 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6614 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
helloschertz.com helloschertz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 175 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
helloblackfoot.com helloblackfoot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
DM DM-101492 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Aug 2019 Aug 2019 One Off
hellolincoln.com hellolincoln.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
DM DM-101492 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellomadrid.com hellomadrid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6614 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 125 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
hellomountainview.com hellomountainview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
hellonewlenox.com hellonewlenox.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
AOL AOL-6614 May 2019 May 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellonewulm.com hellonewulm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
GTM GTM-AW-804755169 Oct 2019 Dec 2019 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Dec 2019 Dec 2019 One Off
hellonorthmiami.com hellonorthmiami.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellopiqua.com hellopiqua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellosaintlouis.com hellosaintlouis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
DM DM-101492 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 193 days
UA UA-121239807 Jun 2019 Dec 2019 193 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Mar 2020 85 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
ORC ORC-963 Jan 2020 Mar 2020 58 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
LIJI LIJI-261774 Mar 2020 Mar 2020 14 days
AOL AOL-6614 Mar 2020 Mar 2020 14 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
hellosaintpaul.com hellosaintpaul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Feb 2020 189 days
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
CONN CONN-102738 Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
AOL AOL-6614 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
hellosanaa.com hellosanaa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellosanluisobispo.com hellosanluisobispo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
hellosantabarbara.com hellosantabarbara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
ORC ORC-963 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
DM DM-101492 Jun 2019 Jan 2020 234 days
AOL AOL-6614 Jun 2019 Jan 2020 234 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 215 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 194 days
UA UA-121239807 Jul 2019 Dec 2019 145 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 145 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
TREM TREM-J54V6-5C8FF Nov 2019 Feb 2020 89 days
SVRN SVRN-261774 Jun 2019 Aug 2019 69 days
LIJI LIJI-265277 Nov 2019 Jan 2020 65 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Jan 2020 40 days
GTM GTM-AW-804755169 Nov 2019 Dec 2019 25 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloshantou.com helloshantou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
AOL AOL-6614 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
TELA TELA-457 Oct 2019 Mar 2020 163 days
AVVID AVVID-7802 Oct 2019 Mar 2020 163 days
CONN CONN-102738 Oct 2019 Mar 2020 163 days
SONO SONO-783272317B Oct 2019 Mar 2020 163 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Mar 2020 163 days
YUME YUME-4016333178 Oct 2019 Mar 2020 163 days
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
GUMG GUMG-13810 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
LIJI LIJI-261774 Oct 2019 Oct 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
hellovaduz.com hellovaduz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
helloabuja.com helloabuja.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Jun 2019 Dec 2019 175 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
AOL AOL-6614 May 2019 Jun 2019 48 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
helloantwerp.com helloantwerp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
DM DM-101492 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-963 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
hellobattlecreek.com hellobattlecreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
hellocouncilbluffs.com hellocouncilbluffs.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
hellocuracao.com hellocuracao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
IEX IEX-189205 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
hellohonolulu.com hellohonolulu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-6614 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellomanitowoc.com hellomanitowoc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
DM DM-101492 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
hellomukilteo.com hellomukilteo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
IEX IEX-189205 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
hellonicaragua.com hellonicaragua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellosamoa.com hellosamoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
hellotaipei.com hellotaipei.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
DM DM-101492 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
IEX IEX-189205 Jun 2019 Aug 2019 50 days
AOL AOL-6614 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
hellowalnutcreek.com hellowalnutcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Jan 2021 1 year, 255 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Jun 2019 Aug 2019 50 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellowaterloo.com hellowaterloo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
hellowinnipeg.com hellowinnipeg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CUZ310G2 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6614 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
SVRN SVRN-261774 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
hellobethlehem.com hellobethlehem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellojacksonville.com hellojacksonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
TEAD TEAD-16544 Jul 2019 Mar 2020 245 days
ORC ORC-963 Jul 2019 Mar 2020 245 days
GUMG GUMG-13810 Jul 2019 Mar 2020 245 days
TELA TELA-457 Jul 2019 Mar 2020 245 days
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
CONN CONN-102738 Jul 2019 Mar 2020 245 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 245 days
YUME YUME-4016333178 Jul 2019 Mar 2020 245 days
LIJI LIJI-261774 Jul 2019 Mar 2020 231 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 210 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
DM DM-101492 Sep 2019 Mar 2020 189 days
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
AOL AOL-6614 Sep 2019 Mar 2020 175 days
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 175 days
TREM TREM-J54V6-5C8FF Aug 2019 Jan 2020 165 days
LIJI LIJI-265277 Sep 2019 Feb 2020 154 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-AW-804755169 May 2019 Jul 2019 77 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
hellolatrobe.com hellolatrobe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
hellolouisville.com hellolouisville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
DM DM-101492 Jun 2019 Mar 2020 292 days
ORC ORC-963 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 262 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
UA UA-121239807 Jun 2019 Dec 2019 193 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
TREM TREM-J54V6-5C8FF Nov 2019 Feb 2020 89 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Jan 2020 Mar 2020 58 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 25 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
hellosouthsioux.com hellosouthsioux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
AOL AOL-6614 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellowoodburn.com hellowoodburn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
helloallouez.com helloallouez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
hellochicago.com hellochicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
DM DM-101492 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CU7QPX3O Oct 2019 Dec 2019 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
hellococonutcreek.com hellococonutcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
AOL AOL-6614 May 2019 Oct 2019 159 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloderby.com helloderby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6614 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
DM DM-101492 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
hellosacramento.com hellosacramento.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Jun 2019 Mar 2020 293 days
ORC ORC-963 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
AOL AOL-6614 Jun 2019 Mar 2020 279 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 260 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Sep 2019 Mar 2020 175 days
LIJI LIJI-265277 Aug 2019 Jan 2020 165 days
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 154 days
GTM GTM-UA-121239807-2 Jul 2019 Dec 2019 145 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-261774 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Jan 2020 40 days
CA CA-PUB-5369125237996028 Sep 2018 Oct 2018 30 days
GTM GTM-AW-804755169 Jul 2019 Jul 2019 One Off
hellotabriz.com hellotabriz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
helloalisoviejo.com helloalisoviejo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 May 2019 May 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
hellocolumbus.com hellocolumbus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
AOL AOL-6614 Jun 2019 Mar 2020 279 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
ORC ORC-963 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
DM DM-101492 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
UA UA-121239807 Jun 2019 Dec 2019 194 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 194 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 154 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Jan 2020 Mar 2020 59 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
helloidaho.com helloidaho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-AW-804755169 May 2019 Jun 2019 48 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellolaketahoe.com hellolaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
hellopasadena.com hellopasadena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
LIJI LIJI-261774 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
DM DM-101492 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 193 days
IEX IEX-189205 Sep 2019 Feb 2020 154 days
TREM TREM-J54V6-5C8FF Sep 2019 Feb 2020 154 days
UA UA-121239807 Jul 2019 Dec 2019 145 days
AOL AOL-6614 Nov 2019 Mar 2020 124 days
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 124 days
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 103 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
ORC ORC-963 Sep 2019 Nov 2019 65 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Aug 2019 Sep 2019 35 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloquanzhou.com helloquanzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
TELA TELA-457 Oct 2019 Mar 2020 163 days
AVVID AVVID-7802 Oct 2019 Mar 2020 163 days
CONN CONN-102738 Oct 2019 Mar 2020 163 days
SONO SONO-783272317B Oct 2019 Mar 2020 163 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Mar 2020 163 days
YUME YUME-4016333178 Oct 2019 Mar 2020 163 days
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
GUMG GUMG-13810 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
AOL AOL-6614 Oct 2019 Feb 2020 128 days
FWHL FWHL-762769 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
hellosaintpetersburg.com hellosaintpetersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Jun 2019 Mar 2020 293 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
TEAD TEAD-16544 Jul 2019 Mar 2020 245 days
ORC ORC-963 Jul 2019 Mar 2020 245 days
TELA TELA-457 Jul 2019 Mar 2020 245 days
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
YUME YUME-4016333178 Jul 2019 Mar 2020 245 days
GUMG GUMG-13810 Jul 2019 Mar 2020 245 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 210 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
CA CA-PUB-5369125237996028 Sep 2018 Apr 2019 209 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
AOL AOL-6614 Sep 2019 Mar 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Jan 2020 165 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-AW-804755169 Sep 2019 Dec 2019 90 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
SVRN SVRN-265277 Dec 2019 Mar 2020 85 days
SVRN SVRN-261774 Jun 2019 Aug 2019 69 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-970193 Dec 2019 Jan 2020 40 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellosunnyvale.com hellosunnyvale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 262 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
DM DM-101492 Jun 2019 Jan 2020 234 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Sep 2019 Feb 2020 154 days
ORC ORC-963 Sep 2019 Jan 2020 131 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-261774 Jun 2019 Aug 2019 68 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Jan 2020 41 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
GTM GTM-AW-804755169 May 2019 Jun 2019 30 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 14 days
AOL AOL-6614 Jun 2019 Jun 2019 One Off
hellotokyo.com hellotokyo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
AOL AOL-6614 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
hellosantaclara.com hellosantaclara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
ORC ORC-963 Jun 2019 Mar 2020 293 days
AOL AOL-6614 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 261 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
DM DM-101492 Jul 2019 Mar 2020 245 days
TEAD TEAD-16544 Jul 2019 Mar 2020 245 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 245 days
TELA TELA-457 Jul 2019 Mar 2020 245 days
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
YUME YUME-4016333178 Jul 2019 Mar 2020 245 days
GUMG GUMG-13810 Jul 2019 Mar 2020 245 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 210 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Sep 2019 Feb 2020 154 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jul 2019 Aug 2019 21 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloarlingtontx.com helloarlingtontx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Mar 2020 1 year, 227 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
AOL AOL-6614 May 2019 Oct 2019 159 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
IEX IEX-189205 Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
helloelk.com helloelk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellohialeah.com hellohialeah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
ORC ORC-963 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
IEX IEX-189205 Feb 2020 Feb 2020 One Off
hellokalamazoo.com hellokalamazoo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
hellolodi.com hellolodi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 175 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
hellooshawa.com hellooshawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
AOL AOL-6614 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
ORC ORC-963 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
hellophiladelphia.com hellophiladelphia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Jul 2019 310 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
AOL AOL-6614 Jun 2019 Mar 2020 278 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 189 days
DM DM-101492 Jun 2019 Nov 2019 168 days
ORC ORC-963 Jun 2019 Nov 2019 168 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-AW-804755169 Sep 2019 Dec 2019 90 days
UA UA-121239807 May 2019 Jul 2019 78 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Jul 2019 Sep 2019 55 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 25 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
hellosantiago.com hellosantiago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellochickasha.com hellochickasha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6614 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
LIJI LIJI-261774 May 2019 May 2019 One Off
helloelko.com helloelko.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
DM DM-101492 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
ORC ORC-963 Jun 2019 Dec 2019 175 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Jun 2019 Jun 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
helloiowa.com helloiowa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 64 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
hellosuisun.com hellosuisun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
IEX IEX-189205 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
DM DM-101492 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
helloaddisababa.com helloaddisababa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 175 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
AOL AOL-6614 May 2019 Jun 2019 48 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellobronx.com hellobronx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-AW-804755169 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Nov 2018 Nov 2018 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
hellocoalinga.com hellocoalinga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Feb 2020 239 days
AOL AOL-6614 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
MEDI MEDI-8CUZ310G2 Jun 2019 Dec 2019 175 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
DM DM-101492 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
hellogurnee.com hellogurnee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
hellohochiminh.com hellohochiminh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
IEX IEX-189205 Feb 2020 Feb 2020 One Off
helloroyaloak.com helloroyaloak.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
hellounionnj.com hellounionnj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Nov 2018 Jun 2019 226 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
helloalbuquerque.com helloalbuquerque.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
DM DM-101492 Jul 2019 Mar 2020 230 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Sep 2019 Mar 2020 189 days
TREM TREM-J54V6-5C8FF Sep 2019 Feb 2020 154 days
UA UA-121239807 Jul 2019 Dec 2019 145 days
AOL AOL-6614 Sep 2019 Jan 2020 131 days
ORC ORC-963 Nov 2019 Mar 2020 110 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
GTM GTM-AW-804755169 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
hellocolumbia.com hellocolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
DM DM-101492 Jun 2019 Nov 2019 169 days
LIJI LIJI-265277 Sep 2019 Feb 2020 154 days
GTM GTM-UA-121239807-2 Jul 2019 Dec 2019 145 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 145 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
UA UA-121239807 Jun 2019 Sep 2019 104 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-261774 Jun 2019 Aug 2019 69 days
AOL AOL-6614 Sep 2019 Nov 2019 65 days
ORC ORC-963 Sep 2019 Nov 2019 65 days
MEDI MEDI-8CU7QPX3O Nov 2019 Jan 2020 65 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Jun 2019 Jul 2019 49 days
AOL AOL-11647 Jan 2020 Feb 2020 24 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
hellofonddulac.com hellofonddulac.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
ORC ORC-963 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Oct 2019 159 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-AW-804755169 Oct 2019 Dec 2019 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Feb 2020 Feb 2020 One Off
hellogatineau.com hellogatineau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
ORC ORC-963 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
hellohaiti.com hellohaiti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
hellohelsinki.com hellohelsinki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
DM DM-101492 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
helloislamabad.com helloislamabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellojaffa.com hellojaffa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
CONN CONN-102738 May 2019 Dec 2019 223 days
SONO SONO-783272317B May 2019 Dec 2019 223 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Dec 2019 223 days
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 175 days
TEAD TEAD-16544 Jun 2019 Dec 2019 175 days
IEX IEX-189205 Jun 2019 Dec 2019 175 days
TELA TELA-457 Jun 2019 Dec 2019 175 days
AVVID AVVID-7802 Jun 2019 Dec 2019 175 days
YUME YUME-4016333178 Jun 2019 Dec 2019 175 days
PUBM PUBM-158017 Jun 2019 Dec 2019 175 days
GUMG GUMG-13810 Jun 2019 Dec 2019 175 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
PRIM PRIM-19139 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-963 May 2019 Jun 2019 48 days
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Dec 2019 Dec 2019 One Off
hellojohnstown.com hellojohnstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
DM DM-101492 Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Jun 2019 Oct 2019 111 days
IEX IEX-189205 Jun 2019 Oct 2019 111 days
TELA TELA-457 Jun 2019 Oct 2019 111 days
AVVID AVVID-7802 Jun 2019 Oct 2019 111 days
YUME YUME-4016333178 Jun 2019 Oct 2019 111 days
PUBM PUBM-158017 Jun 2019 Oct 2019 111 days
GUMG GUMG-13810 Jun 2019 Oct 2019 111 days
CA CA-PUB-5369125237996028 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellonorristown.com hellonorristown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
TEAD TEAD-16544 Jun 2019 Oct 2019 111 days
IEX IEX-189205 Jun 2019 Oct 2019 111 days
TELA TELA-457 Jun 2019 Oct 2019 111 days
AVVID AVVID-7802 Jun 2019 Oct 2019 111 days
YUME YUME-4016333178 Jun 2019 Oct 2019 111 days
PUBM PUBM-158017 Jun 2019 Oct 2019 111 days
GUMG GUMG-13810 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Aug 2019 Aug 2019 One Off
hellooahu.com hellooahu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
AOL AOL-6614 Jun 2019 Mar 2020 292 days
DM DM-101492 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 260 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
UA UA-121239807 Jun 2019 Dec 2019 193 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 193 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
ORC ORC-963 Jun 2019 Nov 2019 168 days
LIJI LIJI-261774 Nov 2019 Mar 2020 124 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Sep 2019 Dec 2019 90 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Jul 2019 Jul 2019 One Off
GTM GTM-AW-804755169 Nov 2019 Nov 2019 One Off
hellobemidji.com hellobemidji.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Feb 2020 287 days
AOL AOL-6614 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
DM DM-101492 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Dec 2019 125 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellofreetown.com hellofreetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
hellogilberttown.com hellogilberttown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
CA CA-PUB-4449341246402301 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
hellomogadishu.com hellomogadishu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 128 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
helloqueenstown.com helloqueenstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloraytown.com helloraytown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
hellosandiego.com hellosandiego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellocorpuschristi.com hellocorpuschristi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Jun 2019 Dec 2019 175 days
DM DM-101492 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Feb 2020 Feb 2020 One Off
hellodavenport.com hellodavenport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
ORC ORC-963 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
DM DM-101492 Jun 2019 Jan 2020 234 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 Jun 2019 Dec 2019 194 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 194 days
LIJI LIJI-265277 Sep 2019 Feb 2020 154 days
IEX IEX-189205 Sep 2019 Feb 2020 154 days
GTM GTM-AW-804755169 May 2019 Sep 2019 133 days
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 120 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-261774 Jun 2019 Aug 2019 69 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
AOL AOL-6614 Jan 2020 Mar 2020 59 days
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 49 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
TREM TREM-J54V6-5C8FF Aug 2019 Sep 2019 35 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellodoylestown.com hellodoylestown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
helloencino.com helloencino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
hellojamestown.com hellojamestown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellosantafa.com hellosantafa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Oct 2019 1 year, 64 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
CONN CONN-102738 May 2019 Dec 2019 223 days
SONO SONO-783272317B May 2019 Dec 2019 223 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Dec 2019 223 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
DM DM-101492 Jun 2019 Dec 2019 175 days
TEAD TEAD-16544 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 Jun 2019 Dec 2019 175 days
TELA TELA-457 Jun 2019 Dec 2019 175 days
AVVID AVVID-7802 Jun 2019 Dec 2019 175 days
YUME YUME-4016333178 Jun 2019 Dec 2019 175 days
PUBM PUBM-158017 Jun 2019 Dec 2019 175 days
GUMG GUMG-13810 Jun 2019 Dec 2019 175 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
AOL AOL-6614 Aug 2019 Dec 2019 125 days
PRIM PRIM-19139 Aug 2019 Dec 2019 125 days
IEX IEX-189205 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-AW-804755169 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Jun 2019 Aug 2019 50 days
ORC ORC-963 Jun 2019 Aug 2019 50 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellospokane.com hellospokane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
PUBM PUBM-158017 Jul 2019 Mar 2020 230 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 230 days
TEAD TEAD-16544 Jul 2019 Mar 2020 230 days
SONO SONO-783272317B Jul 2019 Mar 2020 230 days
DM DM-101492 Jul 2019 Mar 2020 230 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
TELA TELA-457 Jul 2019 Mar 2020 230 days
AVVID AVVID-7802 Jul 2019 Mar 2020 230 days
CONN CONN-102738 Jul 2019 Mar 2020 230 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 230 days
YUME YUME-4016333178 Jul 2019 Mar 2020 230 days
GUMG GUMG-13810 Jul 2019 Mar 2020 230 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
TREM TREM-J54V6-5C8FF Aug 2019 Jan 2020 165 days
UA UA-121239807 Jul 2019 Dec 2019 145 days
GTM GTM-AW-804755169 Jul 2019 Dec 2019 145 days
MEDI MEDI-8CUZ310G2 Sep 2019 Jan 2020 130 days
ORC ORC-963 Sep 2019 Jan 2020 130 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Mar 2020 85 days
LIJI LIJI-265277 Nov 2019 Jan 2020 65 days
AOL AOL-11647 Dec 2019 Jan 2020 40 days
FWHL FWHL-970193 Dec 2019 Jan 2020 40 days
CA CA-PUB-5369125237996028 Sep 2018 Oct 2018 30 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
hellofuzhou.com hellofuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellomiddletown.com hellomiddletown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 111 days
UA UA-121239807 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
hellomilwaukee.com hellomilwaukee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
ORC ORC-963 Sep 2019 Mar 2020 189 days
AOL AOL-6614 Sep 2019 Mar 2020 175 days
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 154 days
TREM TREM-J54V6-5C8FF Sep 2019 Feb 2020 154 days
GTM GTM-UA-121239807-2 Jul 2019 Dec 2019 145 days
DM DM-101492 Sep 2019 Jan 2020 130 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Jan 2020 40 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
SVRN SVRN-265277 Mar 2020 Mar 2020 14 days
UA UA-121239807 Nov 2019 Nov 2019 One Off
hellostjohn.com hellostjohn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 175 days
DM DM-101492 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
hellobiloxi.com hellobiloxi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellocanton.com hellocanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 262 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 260 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
ORC ORC-963 Jun 2019 Jan 2020 233 days
AOL AOL-6614 Jun 2019 Jan 2020 233 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
DM DM-101492 Sep 2019 Mar 2020 189 days
UA UA-121239807 Jul 2019 Dec 2019 145 days
GTM GTM-AW-804755169 Jul 2019 Dec 2019 145 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Jan 2020 40 days
GTM GTM-UA-121239807-2 Nov 2019 Dec 2019 25 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
hellohamptonroads.com hellohamptonroads.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
DM DM-101492 Jun 2019 Mar 2020 278 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 215 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
ORC ORC-963 Jun 2019 Jul 2019 48 days
TREM TREM-J54V6-5C8FF Jan 2020 Feb 2020 24 days
LIJI LIJI-261774 Mar 2020 Mar 2020 14 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Nov 2019 Nov 2019 One Off
IEX IEX-189205 Jan 2020 Jan 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
hellomillbrae.com hellomillbrae.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
DM DM-101492 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
hellomuskego.com hellomuskego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
helloakron.com helloakron.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 Jun 2019 Mar 2020 278 days
CONN CONN-102738 Jun 2019 Mar 2020 278 days
SONO SONO-783272317B Jun 2019 Mar 2020 278 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 278 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 262 days
YUME YUME-4016333178 Jul 2019 Mar 2020 230 days
TEAD TEAD-16544 Jul 2019 Mar 2020 230 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 230 days
TELA TELA-457 Jul 2019 Mar 2020 230 days
AVVID AVVID-7802 Jul 2019 Mar 2020 230 days
PUBM PUBM-158017 Jul 2019 Mar 2020 230 days
GUMG GUMG-13810 Jul 2019 Mar 2020 230 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 193 days
FWHL FWHL-762769 Sep 2019 Mar 2020 175 days
GTM GTM-AW-804755169 Jul 2019 Dec 2019 145 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 145 days
UA UA-121239807 Jul 2019 Dec 2019 145 days
DM DM-101492 Jun 2019 Sep 2019 103 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Aug 2019 Sep 2019 35 days
TREM TREM-J54V6-5C8FF Aug 2019 Sep 2019 35 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
AOL AOL-6614 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
helloboise.com helloboise.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
DM DM-101492 Jun 2019 Jan 2020 234 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Jun 2019 Dec 2019 193 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 193 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
ORC ORC-963 Sep 2019 Mar 2020 175 days
FWHL FWHL-762769 Sep 2019 Mar 2020 175 days
AOL AOL-6614 Jun 2019 Nov 2019 168 days
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 120 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
SVRN SVRN-261774 Jun 2019 Aug 2019 68 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
UA UA-121239807 Jul 2019 Sep 2019 55 days
NEX NEX-3391 Dec 2019 Jan 2020 41 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
hellocrestview.com hellocrestview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
ORC ORC-963 Jun 2019 Mar 2020 274 days
AOL AOL-6614 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
GTM GTM-AW-804755169 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
hellofortbragg.com hellofortbragg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
CA CA-PUB-5369125237996028 Nov 2018 May 2019 178 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-6614 May 2019 May 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
hellohawaii.com hellohawaii.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellononthaburi.com hellononthaburi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellosoho.com hellosoho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CONN CONN-102738 May 2019 Feb 2020 287 days
SONO SONO-783272317B May 2019 Feb 2020 287 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Feb 2020 239 days
ORC ORC-963 Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
TELA TELA-457 Jun 2019 Feb 2020 239 days
AVVID AVVID-7802 Jun 2019 Feb 2020 239 days
YUME YUME-4016333178 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Jun 2019 Feb 2020 239 days
GUMG GUMG-13810 Jun 2019 Feb 2020 239 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 May 2019 Jun 2019 48 days
SVRN SVRN-261774 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
PRIM PRIM-19139 Feb 2020 Feb 2020 One Off
hellocuba.com hellocuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
CA CA-PUB-4449341246402301 Jun 2019 Aug 2019 50 days
TEAD TEAD-16544 Jun 2019 Aug 2019 50 days
AOL AOL-6614 Jun 2019 Aug 2019 50 days
TELA TELA-457 Jun 2019 Aug 2019 50 days
AVVID AVVID-7802 Jun 2019 Aug 2019 50 days
YUME YUME-4016333178 Jun 2019 Aug 2019 50 days
PUBM PUBM-158017 Jun 2019 Aug 2019 50 days
GUMG GUMG-13810 Jun 2019 Aug 2019 50 days
UA UA-121239807 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
IEX IEX-189205 Jun 2019 Jun 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellootsego.com hellootsego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hellosaltlakecity.com hellosaltlakecity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
DM DM-101492 Jul 2019 Mar 2020 230 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
ORC ORC-963 Sep 2019 Mar 2020 189 days
UA UA-121239807 Jul 2019 Dec 2019 145 days
AOL AOL-6614 Nov 2019 Mar 2020 124 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
CA CA-PUB-5369125237996028 Apr 2019 Apr 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellotoledo.com hellotoledo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
TEAD TEAD-16544 Jul 2019 Mar 2020 230 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
TELA TELA-457 Jul 2019 Mar 2020 230 days
AVVID AVVID-7802 Jul 2019 Mar 2020 230 days
CONN CONN-102738 Jul 2019 Mar 2020 230 days
SONO SONO-783272317B Jul 2019 Mar 2020 230 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 230 days
YUME YUME-4016333178 Jul 2019 Mar 2020 230 days
PUBM PUBM-158017 Jul 2019 Mar 2020 230 days
GUMG GUMG-13810 Jul 2019 Mar 2020 230 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
CA CA-PUB-5369125237996028 Sep 2018 Apr 2019 209 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
ORC ORC-963 Jul 2019 Jan 2020 185 days
IEX IEX-189205 Jul 2019 Jan 2020 185 days
FWHL FWHL-762769 Sep 2019 Mar 2020 175 days
TREM TREM-J54V6-5C8FF Aug 2019 Jan 2020 165 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
DM DM-101492 Sep 2019 Nov 2019 65 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Jan 2020 Feb 2020 24 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
hellobardstown.com hellobardstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
TEAD TEAD-16544 Jun 2019 Oct 2019 111 days
IEX IEX-189205 Jun 2019 Oct 2019 111 days
TELA TELA-457 Jun 2019 Oct 2019 111 days
AVVID AVVID-7802 Jun 2019 Oct 2019 111 days
YUME YUME-4016333178 Jun 2019 Oct 2019 111 days
PUBM PUBM-158017 Jun 2019 Oct 2019 111 days
GUMG GUMG-13810 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellocupertino.com hellocupertino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
helloirmo.com helloirmo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-6614 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CUZ310G2 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
hellojuneau.com hellojuneau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-6614 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
DM DM-101492 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellooswego.com hellooswego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
AOL AOL-6614 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
helloperm.com helloperm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
PUBM PUBM-158017 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
TEAD TEAD-16544 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Oct 2019 Feb 2020 128 days
LIJI LIJI-265277 Oct 2019 Feb 2020 128 days
TELA TELA-457 Oct 2019 Feb 2020 128 days
AVVID AVVID-7802 Oct 2019 Feb 2020 128 days
CONN CONN-102738 Oct 2019 Feb 2020 128 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Feb 2020 128 days
YUME YUME-4016333178 Oct 2019 Feb 2020 128 days
GUMG GUMG-13810 Oct 2019 Feb 2020 128 days
PRIM PRIM-19139 Oct 2019 Feb 2020 128 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
ORC ORC-963 Oct 2019 Dec 2019 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
NEX NEX-3391 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellobuckeyetown.com hellobuckeyetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
AOL AOL-6614 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
UA UA-121239807 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloelreno.com helloelreno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
ORC ORC-963 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
helloenumclaw.com helloenumclaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
ORC ORC-963 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
IEX IEX-189205 Jun 2019 Dec 2019 175 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Feb 2020 Feb 2020 One Off
helloyoungstown.com helloyoungstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellobaytown.com hellobaytown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
CA CA-PUB-4449341246402301 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
hellobountiful.com hellobountiful.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
CONN CONN-102738 Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Aug 2019 Feb 2020 189 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
AOL AOL-6614 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Oct 2019 Feb 2020 128 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
IEX IEX-189205 Oct 2019 Dec 2019 64 days
MEDI MEDI-8CUZ310G2 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
ORC ORC-963 Dec 2019 Feb 2020 64 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
hellocincinnati.com hellocincinnati.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 Jul 2019 Mar 2020 230 days
TEAD TEAD-16544 Jul 2019 Mar 2020 230 days
GUMG GUMG-13810 Jul 2019 Mar 2020 230 days
PUBM PUBM-158017 Jul 2019 Mar 2020 230 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
SONO SONO-783272317B Jul 2019 Mar 2020 230 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 230 days
TELA TELA-457 Jul 2019 Mar 2020 230 days
AVVID AVVID-7802 Jul 2019 Mar 2020 230 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 230 days
YUME YUME-4016333178 Jul 2019 Mar 2020 230 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
LIJI LIJI-265277 Sep 2019 Feb 2020 154 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 145 days
ORC ORC-963 Nov 2019 Mar 2020 110 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-AW-804755169 Sep 2019 Dec 2019 90 days
SVRN SVRN-265277 Dec 2019 Mar 2020 85 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
DM DM-101492 Jul 2019 Sep 2019 55 days
SVRN SVRN-261774 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
hellodekalb.com hellodekalb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
ORC ORC-963 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
GTM GTM-AW-804755169 Jun 2019 Dec 2019 175 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellolilongwe.com hellolilongwe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
TEAD TEAD-16544 Jun 2019 Oct 2019 111 days
TELA TELA-457 Jun 2019 Oct 2019 111 days
AVVID AVVID-7802 Jun 2019 Oct 2019 111 days
YUME YUME-4016333178 Jun 2019 Oct 2019 111 days
PUBM PUBM-158017 Jun 2019 Oct 2019 111 days
GUMG GUMG-13810 Jun 2019 Oct 2019 111 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
DM DM-101492 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
ORC ORC-963 May 2019 May 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
hellomontgomery.com hellomontgomery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
LIJI LIJI-261774 Jun 2019 Mar 2020 279 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
GUMG GUMG-13810 Jul 2019 Mar 2020 245 days
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
YUME YUME-4016333178 Jul 2019 Mar 2020 245 days
TEAD TEAD-16544 Jul 2019 Mar 2020 245 days
TELA TELA-457 Jul 2019 Mar 2020 245 days
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
ORC ORC-963 Jul 2019 Nov 2019 121 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
CA CA-PUB-5369125237996028 Sep 2018 Oct 2018 30 days
UA UA-121239807 May 2019 Jun 2019 29 days
SVRN SVRN-261774 Jul 2019 Aug 2019 21 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Jul 2019 Jul 2019 One Off
hellonouakchott.com hellonouakchott.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-UA-118129358-1 Mar 2020 Jan 2021 298 days
DM DM-101492 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
TELA TELA-457 Oct 2019 Mar 2020 163 days
AVVID AVVID-7802 Oct 2019 Mar 2020 163 days
CONN CONN-102738 Oct 2019 Mar 2020 163 days
SONO SONO-783272317B Oct 2019 Mar 2020 163 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Mar 2020 163 days
YUME YUME-4016333178 Oct 2019 Mar 2020 163 days
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
GUMG GUMG-13810 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
GTM GTM-AW-804755169 Oct 2019 Dec 2019 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
AOL AOL-6614 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
helloallentown.com helloallentown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
DM DM-101492 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 May 2019 Oct 2019 159 days
AOL AOL-6614 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hellorowlett.com hellorowlett.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
hellosyracuse.com hellosyracuse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 244 days
DM DM-101492 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
ORC ORC-963 Sep 2019 Mar 2020 175 days
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 175 days
GTM GTM-UA-121239807-2 Jul 2019 Dec 2019 145 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
TREM TREM-J54V6-5C8FF Nov 2019 Feb 2020 89 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Jan 2020 Feb 2020 24 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
SVRN SVRN-265277 Mar 2020 Mar 2020 14 days
hellohiltonhead.com hellohiltonhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
hellomaranatown.com hellomaranatown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 May 2019 232 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
UA UA-121239807 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellomaui.com hellomaui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
IEX IEX-189205 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
CONN CONN-102738 Aug 2019 Feb 2020 189 days
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
DM DM-101492 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-762769 Dec 2019 Feb 2020 64 days
ORC ORC-963 Oct 2019 Dec 2019 64 days
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
hellomuskogee.com hellomuskogee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
hellosoutheuclid.com hellosoutheuclid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 163 days
TELA TELA-457 Oct 2019 Mar 2020 163 days
AVVID AVVID-7802 Oct 2019 Mar 2020 163 days
CONN CONN-102738 Oct 2019 Mar 2020 163 days
SONO SONO-783272317B Oct 2019 Mar 2020 163 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Mar 2020 163 days
YUME YUME-4016333178 Oct 2019 Mar 2020 163 days
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
GUMG GUMG-13810 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
hellowashingtondc.com hellowashingtondc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
DM DM-101492 Sep 2019 Mar 2020 189 days
LIJI LIJI-261774 Sep 2019 Mar 2020 189 days
ORC ORC-963 Jun 2019 Nov 2019 169 days
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
LIJI LIJI-265277 Aug 2019 Nov 2019 100 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
AOL AOL-6614 Mar 2020 Mar 2020 14 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellogalveston.com hellogalveston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
ORC ORC-963 Jul 2019 Mar 2020 230 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
UA UA-121239807 May 2019 Dec 2019 223 days
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 189 days
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 186 days
LIJI LIJI-265277 Sep 2019 Feb 2020 154 days
DM DM-101492 Jul 2019 Nov 2019 120 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Jan 2020 41 days
CA CA-PUB-5369125237996028 Sep 2018 Oct 2018 30 days
IEX IEX-189205 Jan 2020 Feb 2020 23 days
TREM TREM-J54V6-5C8FF Jan 2020 Feb 2020 23 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
hellocharleston.com hellocharleston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
ORC ORC-963 Sep 2019 Mar 2020 189 days
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
LIJI LIJI-265277 Sep 2019 Feb 2020 154 days
LIJI LIJI-261774 Jul 2019 Nov 2019 120 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
GTM GTM-AW-804755169 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
DM DM-101492 Jan 2020 Jan 2020 One Off
hellochicopee.com hellochicopee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
CA CA-PUB-5369125237996028 Nov 2018 Aug 2019 276 days
TEAD TEAD-16544 Jun 2019 Mar 2020 274 days
TELA TELA-457 Jun 2019 Mar 2020 274 days
AVVID AVVID-7802 Jun 2019 Mar 2020 274 days
YUME YUME-4016333178 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
GUMG GUMG-13810 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
AOL AOL-6614 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
DM DM-101492 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 May 2019 Aug 2019 98 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellopeterborough.com hellopeterborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellodubuque.com hellodubuque.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Dec 2019 Jan 2021 1 year, 32 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-6614 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
LIJI LIJI-265277 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
hellopittsburgh.com hellopittsburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
ORC ORC-963 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
DM DM-101492 Jun 2019 Sep 2019 103 days
MEDI MEDI-8CU7QPX3O Jun 2019 Sep 2019 85 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 25 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Jan 2020 Jan 2020 One Off
helloplumborough.com helloplumborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellosarasota.com hellosarasota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
AOL AOL-6614 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
ORC ORC-963 Jun 2019 Mar 2020 278 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
TEAD TEAD-16544 Sep 2019 Mar 2020 189 days
TELA TELA-457 Sep 2019 Mar 2020 189 days
AVVID AVVID-7802 Sep 2019 Mar 2020 189 days
YUME YUME-4016333178 Sep 2019 Mar 2020 189 days
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
GUMG GUMG-13810 Sep 2019 Mar 2020 189 days
PRIM PRIM-19139 Sep 2019 Mar 2020 189 days
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 175 days
LIJI LIJI-261774 Sep 2019 Jan 2020 131 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
IEX IEX-189205 Jan 2020 Feb 2020 23 days
FWHL FWHL-762769 Mar 2020 Mar 2020 14 days
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
DM DM-101492 Sep 2019 Sep 2019 One Off
hellosarajevo.com hellosarajevo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellocarlsbad.com hellocarlsbad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
hellomiami.com hellomiami.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Sep 2019 Mar 2020 189 days
YUME YUME-4016333178 Sep 2019 Mar 2020 189 days
TEAD TEAD-16544 Sep 2019 Mar 2020 189 days
PRIM PRIM-19139 Sep 2019 Mar 2020 189 days
TELA TELA-457 Sep 2019 Mar 2020 189 days
AVVID AVVID-7802 Sep 2019 Mar 2020 189 days
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
LIJI LIJI-261774 Sep 2019 Mar 2020 175 days
IEX IEX-189205 Sep 2019 Feb 2020 154 days
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 154 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Aug 2018 Oct 2018 68 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
AOL AOL-11647 Jan 2020 Feb 2020 24 days
FWHL FWHL-970193 Jan 2020 Feb 2020 24 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
ORC ORC-963 Sep 2019 Sep 2019 One Off
hellonewburgh.com hellonewburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellookmulgee.com hellookmulgee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
helloraleigh.com helloraleigh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
hellovoronezh.com hellovoronezh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
DM DM-101492 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
TEAD TEAD-16544 Jun 2019 Aug 2019 50 days
TELA TELA-457 Jun 2019 Aug 2019 50 days
AVVID AVVID-7802 Jun 2019 Aug 2019 50 days
YUME YUME-4016333178 Jun 2019 Aug 2019 50 days
PUBM PUBM-158017 Jun 2019 Aug 2019 50 days
GUMG GUMG-13810 Jun 2019 Aug 2019 50 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 48 days
UA UA-121239807 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloantananarivo.com helloantananarivo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
hellobirmingham.com hellobirmingham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
TEAD TEAD-16544 Jul 2019 Mar 2020 245 days
GUMG GUMG-13810 Jul 2019 Mar 2020 245 days
YUME YUME-4016333178 Jul 2019 Mar 2020 245 days
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 245 days
TELA TELA-457 Jul 2019 Mar 2020 245 days
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
CONN CONN-102738 Jul 2019 Mar 2020 245 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 245 days
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
ORC ORC-963 Jul 2019 Mar 2020 231 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
DM DM-101492 Jul 2019 Jan 2020 186 days
UA UA-121239807 Jul 2019 Dec 2019 146 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
IEX IEX-189205 Nov 2019 Jan 2020 65 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Jan 2020 Mar 2020 59 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
helloenid.com helloenid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
DM DM-101492 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
AOL AOL-6614 May 2019 Dec 2019 223 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Feb 2020 189 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
helloprovo.com helloprovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-AW-804755169 May 2019 Oct 2019 159 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
helloreno.com helloreno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
TEAD TEAD-16544 Jul 2019 Mar 2020 230 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 230 days
TELA TELA-457 Jul 2019 Mar 2020 230 days
AVVID AVVID-7802 Jul 2019 Mar 2020 230 days
CONN CONN-102738 Jul 2019 Mar 2020 230 days
SONO SONO-783272317B Jul 2019 Mar 2020 230 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 230 days
YUME YUME-4016333178 Jul 2019 Mar 2020 230 days
PUBM PUBM-158017 Jul 2019 Mar 2020 230 days
GUMG GUMG-13810 Jul 2019 Mar 2020 230 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
LIJI LIJI-265277 Aug 2019 Feb 2020 189 days
TREM TREM-J54V6-5C8FF Aug 2019 Jan 2020 165 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Sep 2019 Dec 2019 90 days
SVRN SVRN-265277 Dec 2019 Jan 2020 40 days
SVRN SVRN-261774 Jul 2019 Aug 2019 20 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
CA CA-PUB-5369125237996028 Oct 2018 Oct 2018 One Off
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
DM DM-101492 Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
LIJI LIJI-261774 Jan 2020 Jan 2020 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
helloberwyn.com helloberwyn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellolehi.com hellolehi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-6614 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Oct 2019 Oct 2019 One Off
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Oct 2019 Oct 2019 One Off
hellocabot.com hellocabot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
hellobullhead.com hellobullhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
DM DM-101492 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
hellodelano.com hellodelano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
hellonixa.com hellonixa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
UA UA-121239807 May 2019 Aug 2019 98 days
GTM GTM-UA-121239807-2 May 2019 Aug 2019 98 days
ORC ORC-963 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
MEDI MEDI-8CU7QPX3O Jun 2019 Aug 2019 50 days
TEAD TEAD-16544 Jun 2019 Aug 2019 50 days
TELA TELA-457 Jun 2019 Aug 2019 50 days
AVVID AVVID-7802 Jun 2019 Aug 2019 50 days
YUME YUME-4016333178 Jun 2019 Aug 2019 50 days
PUBM PUBM-158017 Jun 2019 Aug 2019 50 days
GUMG GUMG-13810 Jun 2019 Aug 2019 50 days
DM DM-101492 May 2019 Jun 2019 48 days
LIJI LIJI-261774 May 2019 Jun 2019 48 days
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Jun 2019 Jun 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloleague.com helloleague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Feb 2020 Jan 2021 333 days
DM DM-101492 Feb 2020 Mar 2020 35 days
TEAD TEAD-16544 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
TELA TELA-457 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CU7QPX3O Feb 2020 Mar 2020 35 days
AVVID AVVID-7802 Feb 2020 Mar 2020 35 days
CONN CONN-102738 Feb 2020 Mar 2020 35 days
SONO SONO-783272317B Feb 2020 Mar 2020 35 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Feb 2020 Mar 2020 35 days
YUME YUME-4016333178 Feb 2020 Mar 2020 35 days
PUBM PUBM-158017 Feb 2020 Mar 2020 35 days
GUMG GUMG-13810 Feb 2020 Mar 2020 35 days
PRIM PRIM-19139 Feb 2020 Mar 2020 35 days
NEX NEX-3391 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
IEX IEX-189205 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
hellomarlborough.com hellomarlborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloalaska.com helloalaska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
PUBM PUBM-158017 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 125 days
TEAD TEAD-16544 Aug 2019 Dec 2019 125 days
SONO SONO-783272317B Aug 2019 Dec 2019 125 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
TELA TELA-457 Aug 2019 Dec 2019 125 days
AVVID AVVID-7802 Aug 2019 Dec 2019 125 days
CONN CONN-102738 Aug 2019 Dec 2019 125 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Dec 2019 125 days
YUME YUME-4016333178 Aug 2019 Dec 2019 125 days
GUMG GUMG-13810 Aug 2019 Dec 2019 125 days
PRIM PRIM-19139 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
DM DM-101492 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
helloburbank.com helloburbank.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Dec 2019 Dec 2019 One Off
AOL AOL-6614 Dec 2019 Dec 2019 One Off
DM DM-101492 Feb 2020 Feb 2020 One Off
ORC ORC-963 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellomanhattan.com hellomanhattan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
AOL AOL-6614 Jul 2019 Mar 2020 244 days
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
ORC ORC-963 Jul 2019 Mar 2020 244 days
TELA TELA-457 Jul 2019 Mar 2020 244 days
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
YUME YUME-4016333178 Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
IEX IEX-189205 Sep 2019 Feb 2020 154 days
TREM TREM-J54V6-5C8FF Sep 2019 Feb 2020 154 days
GTM GTM-AW-804755169 Jul 2019 Dec 2019 145 days
GTM GTM-UA-121239807-2 Jul 2019 Dec 2019 145 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
DM DM-101492 Sep 2019 Nov 2019 65 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
hellonassau.com hellonassau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
DM DM-101492 Feb 2020 Mar 2020 35 days
TEAD TEAD-16544 Feb 2020 Mar 2020 35 days
TELA TELA-457 Feb 2020 Mar 2020 35 days
AVVID AVVID-7802 Feb 2020 Mar 2020 35 days
CONN CONN-102738 Feb 2020 Mar 2020 35 days
SONO SONO-783272317B Feb 2020 Mar 2020 35 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Feb 2020 Mar 2020 35 days
YUME YUME-4016333178 Feb 2020 Mar 2020 35 days
PUBM PUBM-158017 Feb 2020 Mar 2020 35 days
GUMG GUMG-13810 Feb 2020 Mar 2020 35 days
PRIM PRIM-19139 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
LIJI LIJI-261774 Feb 2020 Feb 2020 One Off
LIJI LIJI-265277 Feb 2020 Feb 2020 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
IEX IEX-189205 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
hellolenexa.com hellolenexa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
TEAD TEAD-16544 Jun 2019 Aug 2019 50 days
TELA TELA-457 Jun 2019 Aug 2019 50 days
AVVID AVVID-7802 Jun 2019 Aug 2019 50 days
YUME YUME-4016333178 Jun 2019 Aug 2019 50 days
PUBM PUBM-158017 Jun 2019 Aug 2019 50 days
GUMG GUMG-13810 Jun 2019 Aug 2019 50 days
GTM GTM-UA-121239807-2 May 2019 Jun 2019 48 days
AOL AOL-6614 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellodinuba.com hellodinuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
CA CA-PUB-5369125237996028 Sep 2018 Jun 2019 280 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
TEAD TEAD-16544 Jun 2019 Jun 2019 One Off
SVRN SVRN-261774 Jun 2019 Jun 2019 One Off
LIJI LIJI-261774 Jun 2019 Jun 2019 One Off
ORC ORC-963 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CU7QPX3O Jun 2019 Jun 2019 One Off
TELA TELA-457 Jun 2019 Jun 2019 One Off
AVVID AVVID-7802 Jun 2019 Jun 2019 One Off
CONN CONN-102738 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Jun 2019 One Off
YUME YUME-4016333178 Jun 2019 Jun 2019 One Off
PUBM PUBM-158017 Jun 2019 Jun 2019 One Off
GUMG GUMG-13810 Jun 2019 Jun 2019 One Off
hellonewdelhi.com hellonewdelhi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
CA CA-PUB-5369125237996028 Sep 2018 Aug 2019 330 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-AW-804755169 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
LIJI LIJI-265277 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
hellomcdonough.com hellomcdonough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloeureka.com helloeureka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
DM DM-101492 Dec 2019 Dec 2019 One Off
TEAD TEAD-16544 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
ORC ORC-963 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
TELA TELA-457 Dec 2019 Dec 2019 One Off
AVVID AVVID-7802 Dec 2019 Dec 2019 One Off
CONN CONN-102738 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Dec 2019 One Off
YUME YUME-4016333178 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
GUMG GUMG-13810 Dec 2019 Dec 2019 One Off
PRIM PRIM-19139 Dec 2019 Dec 2019 One Off
hellopharr.com hellopharr.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
TEAD TEAD-16544 Oct 2019 Feb 2020 128 days
LIJI LIJI-261774 Oct 2019 Feb 2020 128 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
TELA TELA-457 Oct 2019 Feb 2020 128 days
AVVID AVVID-7802 Oct 2019 Feb 2020 128 days
CONN CONN-102738 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Oct 2019 Feb 2020 128 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Feb 2020 128 days
YUME YUME-4016333178 Oct 2019 Feb 2020 128 days
PUBM PUBM-158017 Oct 2019 Feb 2020 128 days
GUMG GUMG-13810 Oct 2019 Feb 2020 128 days
PRIM PRIM-19139 Oct 2019 Feb 2020 128 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
DM DM-101492 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Oct 2019 Oct 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
helloprospect.com helloprospect.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
LIJI LIJI-265277 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
hellonairobi.com hellonairobi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
LIJI LIJI-261774 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TREM TREM-J54V6-5C8FF Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
helloanoka.com helloanoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Dec 2019 Dec 2019 One Off
DM DM-101492 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Dec 2019 Dec 2019 One Off
TEAD TEAD-16544 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
ORC ORC-963 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
TELA TELA-457 Dec 2019 Dec 2019 One Off
AVVID AVVID-7802 Dec 2019 Dec 2019 One Off
CONN CONN-102738 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Dec 2019 One Off
YUME YUME-4016333178 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
GUMG GUMG-13810 Dec 2019 Dec 2019 One Off
PRIM PRIM-19139 Dec 2019 Dec 2019 One Off
helloglenellyn.com helloglenellyn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
IEX IEX-189205 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
LIJI LIJI-265277 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Oct 2019 Oct 2019 One Off
hellokennesaw.com hellokennesaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6614 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-AW-804755169 May 2019 Dec 2019 223 days
SVRN SVRN-265277 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellosaintbarthelemy.com hellosaintbarthelemy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
LIJI LIJI-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellochambersburgborough.com hellochambersburgborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellowestchicago.com hellowestchicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellotakhmau.com hellotakhmau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Dec 2019 223 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellomoraga.com hellomoraga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellocrevecoeur.com hellocrevecoeur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellomartinique.com hellomartinique.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Mar 2020 Jan 2021 298 days
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
helloamerica.com helloamerica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellomoorhead.com hellomoorhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellonewportnews.com hellonewportnews.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellogeneva.com hellogeneva.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
GTM GTM-AW-804755169 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
SVRN SVRN-261774 May 2019 May 2019 One Off
LIJI LIJI-261774 May 2019 May 2019 One Off
ORC ORC-963 May 2019 May 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
CONN CONN-102738 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 May 2019 One Off
hellodecatur.com hellodecatur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Mar 2020 Jan 2021 298 days
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
helloaligarh.com helloaligarh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobishkek.com hellobishkek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-121239807-2 Aug 2019 Aug 2019 One Off
hellokhabarovsk.com hellokhabarovsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloliuzhou.com helloliuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
hellolugansk.com hellolugansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellorybinsk.com hellorybinsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellotomsk.com hellotomsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobari.com hellobari.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellochangsha.com hellochangsha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellodonetsk.com hellodonetsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellokaraj.com hellokaraj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellolinz.com hellolinz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellobilbao.com hellobilbao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobozhou.com hellobozhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
hellobrno.com hellobrno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobryansk.com hellobryansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellochelyabinsk.com hellochelyabinsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloguangzhou.com helloguangzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
helloirkutsk.com helloirkutsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellorugao.com hellorugao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloulyanovsk.com helloulyanovsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
hellovitebsk.com hellovitebsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloyichun.com helloyichun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloblagoveshchensk.com helloblagoveshchensk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellocantho.com hellocantho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-UA-121239807-2 May 2019 May 2019 One Off
hellohezhou.com hellohezhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-UA-121239807-2 Jun 2019 Jun 2019 One Off
hellokiev.com hellokiev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellokrasnoyarsk.com hellokrasnoyarsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellokryvyirih.com hellokryvyirih.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellolipetsk.com hellolipetsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellomagnitogorsk.com hellomagnitogorsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
hellomurmansk.com hellomurmansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellorizhao.com hellorizhao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
thehindu.com thehindu.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Jan 2020 186 days
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 154 days
IEX IEX-189205 Nov 2019 Jan 2020 65 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
sizzlepixs.com sizzlepixs.com
Attribute Value First Detected Last Detected Overlap Duration
CONN CONN-102738 May 2019 Mar 2020 301 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TREM TREM-J54V6-5C8FF Sep 2019 Feb 2020 167 days
TELA TELA-457 Jul 2019 Nov 2019 116 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Jan 2020 Jan 2020 One Off
devilshockey.org devilshockey.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Aug 2019 Aug 2019 8 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
helloashgabat.com helloashgabat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobamako.com hellobamako.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellobaotou.com hellobaotou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellobarquisimeto.com hellobarquisimeto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobelem.com hellobelem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellobrossard.com hellobrossard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobursa.com hellobursa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellochangzhou.com hellochangzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellocorinth.com hellocorinth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocuritiba.com hellocuritiba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloezhou.com helloezhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellogaozhou.com hellogaozhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellogomel.com hellogomel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloharbin.com helloharbin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohonduras.com hellohonduras.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokabul.com hellokabul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokaduna.com hellokaduna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokaragandy.com hellokaragandy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokatowice.com hellokatowice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokirov.com hellokirov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokitakyushu.com hellokitakyushu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellokitwe.com hellokitwe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokobe.com hellokobe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellokoln.com hellokoln.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloluzhou.com helloluzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomagdeburg.com hellomagdeburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomalmo.com hellomalmo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomanila.com hellomanila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomedicinehat.com hellomedicinehat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Oct 2020 2 years, 20 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomosul.com hellomosul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomuharraq.com hellomuharraq.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellonovaiguacu.com hellonovaiguacu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellonuremberg.com hellonuremberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloorenburg.com helloorenburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopalikir.com hellopalikir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloplovdiv.com helloplovdiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellorabat.com hellorabat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellorawalpindi.com hellorawalpindi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellotengzhou.com hellotengzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellowoodbuffalo.com hellowoodbuffalo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloxintai.com helloxintai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
lifebru.com lifebru.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 267 days
SONO SONO-783272317B Dec 2019 Mar 2020 90 days
FWHL FWHL-762769 Dec 2019 Mar 2020 90 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
pcrmra.ca pcrmra.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Feb 2020 Mar 2020 25 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
dinamani.com dinamani.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 175 days
IEX IEX-189205 Sep 2019 Jan 2020 130 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
helloalmaty.com helloalmaty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobaghdad.com hellobaghdad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobards.com hellobards.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Dec 2019 223 days
UA UA-118129358 Jun 2021 Jan 2022 187 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobeiliu.com hellobeiliu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellobordeaux.com hellobordeaux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellocampinas.com hellocampinas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellochangchun.com hellochangchun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellochemnitz.com hellochemnitz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellochristchurch.com hellochristchurch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellociudadguayana.com hellociudadguayana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocoquitlam.com hellocoquitlam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloduquedecaxias.com helloduquedecaxias.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofreeport.com hellofreeport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofuxin.com hellofuxin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogaborone.com hellogaborone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogwangju.com hellogwangju.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohuzhou.com hellohuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellojoaopessoa.com hellojoaopessoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellokanazawa.com hellokanazawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokano.com hellokano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokaunas.com hellokaunas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokolwezi.com hellokolwezi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokyoto.com hellokyoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolamatanza.com hellolamatanza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloleipzig.com helloleipzig.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellomainz.com hellomainz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellomogilev.com hellomogilev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellonewmarket.com hellonewmarket.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonezahualcoyotl.com hellonezahualcoyotl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellookayama.com hellookayama.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloosaka.com helloosaka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopalermo.com hellopalermo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloportelizabeth.com helloportelizabeth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloquito.com helloquito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellorotherham.com hellorotherham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosalford.com hellosalford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosendai.com hellosendai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellosuizhou.com hellosuizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotaizhou.com hellotaizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellowakefield.com hellowakefield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloyekaterinburg.com helloyekaterinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellozhangjiakou.com hellozhangjiakou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
mapsofworld.com mapsofworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
IEX IEX-189205 Jun 2019 Nov 2019 150 days
PUBM PUBM-158017 Jul 2019 Nov 2019 121 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
biggboss2.net biggboss2.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 273 days
FWHL FWHL-762769 Aug 2019 Feb 2020 175 days
PUBM PUBM-158017 Sep 2019 Feb 2020 131 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
IEX IEX-189205 Nov 2019 Feb 2020 66 days
walterfootball.com walterfootball.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Jan 2020 215 days
PUBM PUBM-158017 Jun 2019 Jan 2020 215 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
helloagra.com helloagra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloahwaz.com helloahwaz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Jan 2021 2 years, 68 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Nov 2018 Nov 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
helloaqaba.com helloaqaba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellobangkok.com hellobangkok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobasra.com hellobasra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloberlin.com helloberlin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobogra.com hellobogra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloburnaby.com helloburnaby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobydgoszcz.com hellobydgoszcz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellochangshu.com hellochangshu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellochennai.com hellochennai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellochiba.com hellochiba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellociudadjuarez.com hellociudadjuarez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellocixi.com hellocixi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellocotonou.com hellocotonou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellodavaocity.com hellodavaocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodaye.com hellodaye.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodongtai.com hellodongtai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloerdenet.com helloerdenet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohavana.com hellohavana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellojakarta.com hellojakarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellojixi.com hellojixi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokermanshah.com hellokermanshah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokursk.com hellokursk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellolapaz.com hellolapaz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellolaspalmas.com hellolaspalmas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomaputo.com hellomaputo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopingdu.com hellopingdu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloportharcourt.com helloportharcourt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotula.com hellotula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovladimir.com hellovladimir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloxuzhou.com helloxuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloyaroslavl.com helloyaroslavl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
helloyuzhou.com helloyuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellozhengzhou.com hellozhengzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
smallbizdaily.com smallbizdaily.com
Attribute Value First Detected Last Detected Overlap Duration
CONN CONN-102738 Sep 2019 Sep 2019 One Off
TELA TELA-457 Sep 2019 Sep 2019 One Off
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
PRIM PRIM-19139 Sep 2019 Sep 2019 One Off
TREM TREM-J54V6-5C8FF Sep 2019 Sep 2019 One Off
tri-townicearena.com tri-townicearena.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 125 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
cdmha.ca cdmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 136 days
FWHL FWHL-762769 Feb 2020 Mar 2020 39 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
deccanherald.com deccanherald.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 247 days
IEX IEX-189205 Sep 2019 Feb 2020 139 days
PUBM PUBM-158017 Dec 2019 Mar 2020 103 days
FWHL FWHL-762737 Jun 2019 Aug 2019 58 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
dgreetings.com dgreetings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Sep 2019 Feb 2020 154 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
helloanqiu.com helloanqiu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellobarnaul.com hellobarnaul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobasrah.com hellobasrah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellobenghazi.com hellobenghazi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobissau.com hellobissau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobrasov.com hellobrasov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellocancun.com hellocancun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellocheboksary.com hellocheboksary.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellochisinau.com hellochisinau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocochabamba.com hellocochabamba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellocordoba.com hellocordoba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
helloflorence.com helloflorence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofrankfurt.com hellofrankfurt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogothenburg.com hellogothenburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohamamatsu.com hellohamamatsu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellohamm.com hellohamm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloheidelberg.com helloheidelberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloheze.com helloheze.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellohiroshima.com hellohiroshima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohuazhou.com hellohuazhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellojinzhou.com hellojinzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellojuarez.com hellojuarez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokharkiv.com hellokharkiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellokumamoto.com hellokumamoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolaiwu.com hellolaiwu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolaizhou.com hellolaizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellolongueuil.com hellolongueuil.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomirat.com hellomirat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomykolaiv.com hellomykolaiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
helloogbomosho.com helloogbomosho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 May 2019 May 2019 One Off
GTM GTM-UA-121239807-2 May 2019 May 2019 One Off
helloorsk.com helloorsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Nov 2018 Nov 2018 One Off
hellooslo.com hellooslo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloperth.com helloperth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloriffa.com helloriffa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellosaanich.com hellosaanich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanpaulo.com hellosanpaulo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloshangqiu.com helloshangqiu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellostpetersburg.com hellostpetersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotongzhou.com hellotongzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovladivostok.com hellovladivostok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellozurich.com hellozurich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
mapsofindia.com mapsofindia.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 260 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
saskchallengecup.com saskchallengecup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
apnamudda.com apnamudda.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Nov 2019 65 days
PUBM PUBM-158017 Sep 2019 Nov 2019 65 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
IEX IEX-189205 Nov 2019 Nov 2019 One Off
thesnhl.com thesnhl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Sep 2019 Mar 2020 198 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Sep 2019 Sep 2019 One Off
celebrityborn.com celebrityborn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 142 days
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
dexerto.fr dexerto.fr
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 149 days
FWHL FWHL-762769 Aug 2019 Sep 2019 51 days
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
FWHL FWHL-762737 May 2019 Jun 2019 41 days
elections.in elections.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
gcmha.com gcmha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
gfmha.ca gfmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
helloalgiers.com helloalgiers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellobarranquilla.com hellobarranquilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobristol.com hellobristol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellobrussels.com hellobrussels.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobudapest.com hellobudapest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocebucity.com hellocebucity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocharleroi.com hellocharleroi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellochatham-kent.com hellochatham-kent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloclujnapoca.com helloclujnapoca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloconakry.com helloconakry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocopenhagen.com hellocopenhagen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellocostarica.com hellocostarica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodammam.com hellodammam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodresden.com hellodresden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellodublin.com hellodublin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloecatepec.com helloecatepec.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
hellogreatersudbury.com hellogreatersudbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogrodno.com hellogrodno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloilorin.com helloilorin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloindonesia.com helloindonesia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
helloinnsbruck.com helloinnsbruck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellojalandhar.com hellojalandhar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokaliningrad.com hellokaliningrad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokinshasa.com hellokinshasa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolaplata.com hellolaplata.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloluanda.com helloluanda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellolubumbashi.com hellolubumbashi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomanama.com hellomanama.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellombabane.com hellombabane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellomunster.com hellomunster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 24 days
hellonanchang.com hellonanchang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloparis.com helloparis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellophilippines.com hellophilippines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloportoalegre.com helloportoalegre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloprague.com helloprague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellopuertovallarta.com hellopuertovallarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellopusan.com hellopusan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloreykjavik.com helloreykjavik.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosansalvador.com hellosansalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Oct 2020 2 years, 58 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellostrasbourg.com hellostrasbourg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellotaiyuan.com hellotaiyuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellotegucigalpa.com hellotegucigalpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloteheran.com helloteheran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellothunderbay.com hellothunderbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Nov 2021 Sep 2022 294 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotientsin.com hellotientsin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellotoronto.com hellotoronto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellotripoli.com hellotripoli.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jul 2020 Jan 2021 188 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloturin.com helloturin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellovalletta.com hellovalletta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellovarna.com hellovarna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellovientiane.com hellovientiane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellovisakhapatnam.com hellovisakhapatnam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
kgha.ca kgha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 58 days
AOL AOL-6614 Feb 2020 Mar 2020 31 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
newstm.in newstm.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 114 days
FWHL FWHL-762769 Feb 2020 Mar 2020 27 days
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
IEX IEX-189205 Jul 2019 Jul 2019 One Off
nssll.ca nssll.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 209 days
FWHL FWHL-762769 Oct 2019 Mar 2020 148 days
FWHL FWHL-762737 Jul 2019 Aug 2019 38 days
AOL AOL-6614 Dec 2019 Dec 2019 One Off
osoyoosdesertclassic.com osoyoosdesertclassic.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 161 days
FWHL FWHL-762737 May 2019 Jul 2019 47 days
AOL AOL-6614 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
rickheinz.com rickheinz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
allaccess.com allaccess.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 260 days
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
apmha.org apmha.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 84 days
FWHL FWHL-762769 Aug 2019 Sep 2019 41 days
FWHL FWHL-762737 Jul 2019 Aug 2019 16 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
10tv.in 10tv.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 88 days
IEX IEX-189205 Jul 2019 Jul 2019 One Off
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
tephockey.com tephockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
AOL AOL-6614 Jan 2020 Mar 2020 44 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
becauseofthemwecan.com becauseofthemwecan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 154 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
bhaskar.com bhaskar.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
vanderhoofminorhockey.ca vanderhoofminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 198 days
FWHL FWHL-762737 May 2019 Jul 2019 48 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
boldsky.com boldsky.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 48 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
IEX IEX-189205 Jan 2020 Jan 2020 One Off
dexerto.com dexerto.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 90 days
FWHL FWHL-762769 Aug 2019 Sep 2019 51 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
firstcry.com firstcry.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
FWHL FWHL-762769 Jan 2020 Mar 2020 58 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 23 days
IEX IEX-189205 Sep 2019 Sep 2019 One Off
harbourcitylakersringette.com harbourcitylakersringette.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
helloabidjan.com helloabidjan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloaccra.com helloaccra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloamritsar.com helloamritsar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobelarus.com hellobelarus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobielefeld.com hellobielefeld.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobogota.com hellobogota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobraila.com hellobraila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobrantford.com hellobrantford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobrisbane.com hellobrisbane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobucaramanga.com hellobucaramanga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocairo.com hellocairo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocaloocan.com hellocaloocan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellocozumel.com hellocozumel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellofoshan.com hellofoshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellogateshead.com hellogateshead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloguatemala.com helloguatemala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloguatemalacity.com helloguatemalacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellohamburg.com hellohamburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellohubli.com hellohubli.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloibadan.com helloibadan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellolima.com hellolima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellolusaka.com hellolusaka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellomelekeok.com hellomelekeok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomontreal.com hellomontreal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellomuscat.com hellomuscat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloniigata.com helloniigata.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopalmademallorca.com hellopalmademallorca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopuebla.com hellopuebla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellorajkot.com hellorajkot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellorepentigny.com hellorepentigny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118129358 Mar 2022 May 2022 74 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellorosario.com hellorosario.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloshishi.com helloshishi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloshizuoka.com helloshizuoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloshymkent.com helloshymkent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosuzhouanhui.com hellosuzhouanhui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotallinn.com hellotallinn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellothessaloniki.com hellothessaloniki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellotianshui.com hellotianshui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellowroclaw.com hellowroclaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellozapopan.com hellozapopan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hindisahayta.in hindisahayta.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 273 days
IEX IEX-189205 Jun 2019 Dec 2019 174 days
FWHL FWHL-762769 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
nativeplanet.com nativeplanet.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
novahockey.ca novahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 309 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 210 days
FWHL FWHL-762769 Oct 2019 Mar 2020 148 days
FWHL FWHL-762737 May 2019 May 2019 One Off
nsmmhl.com nsmmhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 114 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 111 days
FWHL FWHL-762737 Jul 2019 Aug 2019 38 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
opwhl.com opwhl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 110 days
FWHL FWHL-762737 May 2019 Aug 2019 83 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
plmha.ca plmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Oct 2019 162 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
sportspyder.com sportspyder.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
PUBM PUBM-158017 Sep 2019 Jan 2020 130 days
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 110 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
tamilsuvai.com tamilsuvai.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 135 days
FWHL FWHL-762769 Nov 2019 Mar 2020 135 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 100 days
IEX IEX-189205 Nov 2019 Feb 2020 100 days
cufla.ca cufla.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 183 days
FWHL FWHL-762737 Jun 2019 Aug 2019 58 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
cvba.ca cvba.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Dec 2019 114 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Sep 2019 Sep 2019 One Off
ddmba.net ddmba.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Dec 2019 Mar 2020 103 days
FWHL FWHL-762737 Jun 2019 Aug 2019 58 days
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 10 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
drivespark.com drivespark.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
ggha.ca ggha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 58 days
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 2 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
guelphminorfootball.net guelphminorfootball.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
helloacapulco.com helloacapulco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloarequipa.com helloarequipa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloastana.com helloastana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloathens.com helloathens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloaustria.com helloaustria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobanjul.com hellobanjul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobelgrade.com hellobelgrade.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellobremen.com hellobremen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellobuenosaires.com hellobuenosaires.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellocapetown.com hellocapetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocasablanca.com hellocasablanca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodouala.com hellodouala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
hellodusseldorf.com hellodusseldorf.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloedinburg.com helloedinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellogent.com hellogent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogibraltar.com hellogibraltar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloglasgow.com helloglasgow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
helloguarulhos.com helloguarulhos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogujranwala.com hellogujranwala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohamadtown.com hellohamadtown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojodhpur.com hellojodhpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
hellokaluga.com hellokaluga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokemerovo.com hellokemerovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokiel.com hellokiel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolimerick.com hellolimerick.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloliverpool.com helloliverpool.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellolubeck.com hellolubeck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomilan.com hellomilan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellomontegobay.com hellomontegobay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomonterrey.com hellomonterrey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellonaypyidaw.com hellonaypyidaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloqiqihar.com helloqiqihar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloqom.com helloqom.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jan 2022 187 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellorostock.com hellorostock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosalzburg.com hellosalzburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellosanluispotosi.com hellosanluispotosi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosapporo.com hellosapporo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosochi.com hellosochi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosurakarta.com hellosurakarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotirana.com hellotirana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellotoluca.com hellotoluca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotoulouse.com hellotoulouse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloutrecht.com helloutrecht.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellovenice.com hellovenice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
helloyaounde.com helloyaounde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloyerevan.com helloyerevan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellozaria.com hellozaria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
kanatabasketball.ca kanatabasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 170 days
FWHL FWHL-762737 Jun 2019 Aug 2019 45 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
maplesofthawks.com maplesofthawks.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Mar 2020 214 days
FWHL FWHL-762769 Aug 2019 Feb 2020 195 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 115 days
FWHL FWHL-762737 May 2019 May 2019 One Off
rezysa.com rezysa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 304 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 158 days
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
rmfhl.com rmfhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Feb 2020 118 days
FWHL FWHL-762737 Jul 2019 Aug 2019 32 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
aberdeenminorhockey.ca aberdeenminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Mar 2020 185 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 143 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
saskatoonballhockey.com saskatoonballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 104 days
FWHL FWHL-762737 May 2019 Aug 2019 79 days
AOL AOL-6614 Jan 2020 Jan 2020 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
uppercanadacyclones.com uppercanadacyclones.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 198 days
FWHL FWHL-762769 Sep 2019 Mar 2020 179 days
FWHL FWHL-762737 May 2019 Aug 2019 73 days
AOL AOL-6614 Sep 2019 Nov 2019 65 days
businessbru.com businessbru.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 105 days
NEX NEX-3391 Feb 2020 Feb 2020 12 days
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
cbhl.org cbhl.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Nov 2019 209 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 136 days
FWHL FWHL-762769 Nov 2019 Mar 2020 106 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
coqmoodyringette.com coqmoodyringette.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 184 days
AOL AOL-6614 Dec 2019 Feb 2020 66 days
FWHL FWHL-762737 May 2019 Jun 2019 39 days
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
fundysoccernb.com fundysoccernb.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Oct 2019 155 days
AOL AOL-6614 Oct 2019 Dec 2019 65 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
goodreturns.in goodreturns.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
helloallahabad.com helloallahabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobangui.com hellobangui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobelmopan.com hellobelmopan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellobijie.com hellobijie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobochum.com hellobochum.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobucharest.com hellobucharest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocairns.com hellocairns.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellocatania.com hellocatania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocologne.com hellocologne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloduisburg.com helloduisburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodunlaoghaire.com hellodunlaoghaire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloessen.com helloessen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellofife.com hellofife.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellofukuoka.com hellofukuoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellohaltonhills.com hellohaltonhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohermosillo.com hellohermosillo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohohhot.com hellohohhot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloivanovo.com helloivanovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojohannesburg.com hellojohannesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellokanpur.com hellokanpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
hellokawasaki.com hellokawasaki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellokitchener.com hellokitchener.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellokrasnodar.com hellokrasnodar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokualalumpur.com hellokualalumpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
hellokuwaitcity.com hellokuwaitcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellolahore.com hellolahore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellolasi.com hellolasi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomelbourne.com hellomelbourne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellomexicali.com hellomexicali.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomexicocity.com hellomexicocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellomontecarlo.com hellomontecarlo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomoscow.com hellomoscow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
hellomunich.com hellomunich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonakhonratchasima.com hellonakhonratchasima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Jul 2022 315 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellonicosia.com hellonicosia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 63 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellopenza.com hellopenza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopodgorica.com hellopodgorica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
helloquebeccity.com helloquebeccity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloquezoncity.com helloquezoncity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellorio.com hellorio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloriodejaneiro.com helloriodejaneiro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosaguenay.com hellosaguenay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosalvador.com hellosalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloseongnam.com helloseongnam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosereisaophoan.com hellosereisaophoan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosydney.com hellosydney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellotunis.com hellotunis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellovancouver.com hellovancouver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellovictoria.com hellovictoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 24 days
hellovolgograd.com hellovolgograd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellozaragoza.com hellozaragoza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
huskermax.com huskermax.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 186 days
FWHL FWHL-762769 Sep 2019 Mar 2020 175 days
MEDI MEDI-8CU7QPX3O Jun 2019 Sep 2019 85 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
indiantelevision.com indiantelevision.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
FWHL FWHL-762769 Sep 2019 Mar 2020 175 days
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 154 days
jerusalemonline.com jerusalemonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
kannadaprabha.com kannadaprabha.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Jan 2020 65 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
mid-day.com mid-day.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
nlva.net nlva.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 210 days
AOL AOL-6614 Aug 2019 Feb 2020 184 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
rmfhs.ca rmfhs.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 204 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 157 days
AOL AOL-6614 Nov 2019 Mar 2020 141 days
rumbunter.com rumbunter.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
archauthority.com archauthority.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
afflfootball.com afflfootball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 21 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
sefha.ca sefha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 203 days
FWHL FWHL-762769 Jan 2020 Mar 2020 74 days
AOL AOL-6614 Jul 2019 Jul 2019 One Off
shabiba.com shabiba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 163 days
FWHL FWHL-762769 Sep 2019 Nov 2019 63 days
FWHL FWHL-762737 May 2019 Jul 2019 47 days
allucanheat.com allucanheat.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
somha.ca somha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
AOL AOL-6614 Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
spartanavenue.com spartanavenue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
srsoccerleague.ca srsoccerleague.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 204 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 101 days
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
stripehype.com stripehype.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
abaceltics.ca abaceltics.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
anganwadirecruitment.in anganwadirecruitment.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 205 days
FWHL FWHL-762769 Jan 2020 Mar 2020 53 days
FWHL FWHL-762737 Jul 2019 Aug 2019 16 days
atvrider.com atvrider.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
awinninghabit.com awinninghabit.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
theedd.ca theedd.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 152 days
FWHL FWHL-762737 May 2019 Aug 2019 75 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
thelandryhat.com thelandryhat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
themobileindian.com themobileindian.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
IEX IEX-189205 Jan 2020 Feb 2020 23 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
bamsmackpow.com bamsmackpow.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
tpwhl.com tpwhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Mar 2020 179 days
FWHL FWHL-762737 May 2019 Aug 2019 74 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
udahl.com udahl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Mar 2020 232 days
FWHL FWHL-762769 Sep 2019 Mar 2020 178 days
FWHL FWHL-762737 Jul 2019 Aug 2019 26 days
beyondtheflag.com beyondtheflag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
birdsandblooms.com birdsandblooms.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bitjunkey.com bitjunkey.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 106 days
IEX IEX-189205 Nov 2019 Feb 2020 80 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
vegashockeyknight.com vegashockeyknight.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 73 days
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
victorybellrings.com victorybellrings.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
vidmax.com vidmax.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Nov 2019 Jan 2020 65 days
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
vnexpress.net vnexpress.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
IEX IEX-189205 Jan 2020 Jan 2020 One Off
wheatfieldblades.com wheatfieldblades.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 196 days
FWHL FWHL-762737 May 2019 May 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
wimp.com wimp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
CA CA-PUB-4449341246402301 Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
wizofawes.com wizofawes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
buffalowdown.com buffalowdown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
wlalacrosse.com wlalacrosse.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 94 days
AOL AOL-6614 Nov 2019 Nov 2019 One Off
writingillini.com writingillini.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
byfa.ca byfa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Mar 2020 277 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
ccjhl.net ccjhl.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
zhiphopcleveland.com zhiphopcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
clonesconfidential.com clonesconfidential.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
cltampa.com cltampa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Jan 2020 130 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
customercarecontacts.com customercarecontacts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cyclevolta.com cyclevolta.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 108 days
FWHL FWHL-762769 Aug 2019 Sep 2019 50 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
dailydot.com dailydot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
dailyfaceoff.com dailyfaceoff.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Mar 2020 45 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
NEX NEX-3391 Jan 2020 Jan 2020 One Off
dairylandexpress.com dairylandexpress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
dexerto.es dexerto.es
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 108 days
SONO SONO-783272317B Jun 2019 Sep 2019 108 days
FWHL FWHL-762769 Aug 2019 Sep 2019 51 days
djcup.ca djcup.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 133 days
AOL AOL-6614 Mar 2020 Mar 2020 5 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
dlmha.ca dlmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Dec 2019 116 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
draftthreads.com draftthreads.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 132 days
FWHL FWHL-762737 May 2019 Jun 2019 42 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
durhamwestjr.com durhamwestjr.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 8 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
entertainmentforus.com entertainmentforus.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 283 days
FWHL FWHL-762769 Aug 2019 Feb 2020 185 days
FWHL FWHL-762737 Jun 2019 Aug 2019 55 days
eplfootballmatch.com eplfootballmatch.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Jun 2019 Aug 2019 45 days
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
frozenfutures.com frozenfutures.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
gotceleb.com gotceleb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 189 days
IEX IEX-189205 Jul 2019 Jan 2020 186 days
PUBM PUBM-158017 Sep 2019 Jan 2020 130 days
halohangout.com halohangout.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
headstory.com headstory.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Dec 2019 Dec 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
helloaachen.com helloaachen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloalbertlea.com helloalbertlea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloalhambra.com helloalhambra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloamman.com helloamman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloarkansas.com helloarkansas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloauckland.com helloauckland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobarcelona.com hellobarcelona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobattambang.com hellobattambang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobermuda.com hellobermuda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobethesda.com hellobethesda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloboyntonbeach.com helloboyntonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobrampton.com hellobrampton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobucheon.com hellobucheon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobuckscounty.com hellobuckscounty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocaledon.com hellocaledon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocerritos.com hellocerritos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocraiova.com hellocraiova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloculiacan.com helloculiacan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodaejeon.com hellodaejeon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodanyang.com hellodanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodaqing.com hellodaqing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodeerfieldbeach.com hellodeerfieldbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodortmund.com hellodortmund.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodudley.com hellodudley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloeastmoline.com helloeastmoline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloeugene.com helloeugene.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofargo.com hellofargo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloflorida.com helloflorida.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Dec 2020 2 years, 133 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofortwayne.com hellofortwayne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofuqing.com hellofuqing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogallatin.com hellogallatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogardengrove.com hellogardengrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogerman.com hellogerman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jun 2020 1 year, 305 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
GTM GTM-UA-118129358-1 Jun 2020 Jun 2020 One Off
hellogilber.com hellogilber.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
helloglencove.com helloglencove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogreatfalls.com hellogreatfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohamhung.com hellohamhung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloisfahan.com helloisfahan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
hellojeffersonville.com hellojeffersonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellojoliet.com hellojoliet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokamloops.com hellokamloops.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokansas.com hellokansas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokhartoum.com hellokhartoum.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolacoruna.com hellolacoruna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolamirada.com hellolamirada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolaval.com hellolaval.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolefkada.com hellolefkada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolevis.com hellolevis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolianjiang.com hellolianjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolisbon.com hellolisbon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolockport.com hellolockport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolosgatos.com hellolosgatos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolynchburg.com hellolynchburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomaceio.com hellomaceio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomanaus.com hellomanaus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomannheim.com hellomannheim.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomineola.com hellomineola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomountjuliet.com hellomountjuliet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomudanjiang.com hellomudanjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomykonos.com hellomykonos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonantes.com hellonantes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonewport.com hellonewport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonewportbeach.com hellonewportbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloniamey.com helloniamey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonorthfield.com hellonorthfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonorthvancouver.com hellonorthvancouver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellooakville.com hellooakville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloopelousas.com helloopelousas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopascagoula.com hellopascagoula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopickering.com hellopickering.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Nov 2020 One Off
hellopleasantgrove.com hellopleasantgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopompanobeach.com hellopompanobeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopostfalls.com hellopostfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopraia.com hellopraia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
helloqidong.com helloqidong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloreggiocalabria.com helloreggiocalabria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellorochesterhills.com hellorochesterhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellorostovondon.com hellorostovondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloruian.com helloruian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosanangelo.com hellosanangelo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanbernardino.com hellosanbernardino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosaoluis.com hellosaoluis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosarnia.com hellosarnia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloseville.com helloseville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloshouguang.com helloshouguang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloskopelos.com helloskopelos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosolanabeach.com hellosolanabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosuwon.com hellosuwon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloterrebonne.com helloterrebonne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellotimisoara.com hellotimisoara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotogo.com hellotogo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotortola.com hellotortola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotukwila.com hellotukwila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotver.com hellotver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloulaanbaatar.com helloulaanbaatar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellovail.com hellovail.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovirgingorda.com hellovirgingorda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovirginiabeach.com hellovirginiabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellowaltham.com hellowaltham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloweinan.com helloweinan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowiesbaden.com hellowiesbaden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowoodlandhills.com hellowoodlandhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloxinyang.com helloxinyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hhringette.ca hhringette.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
hiddenremote.com hiddenremote.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
hoyosrevenge.com hoyosrevenge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Jul 2019 49 days
iceboltztournament.com iceboltztournament.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 221 days
AOL AOL-6614 Oct 2019 Dec 2019 64 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
idcmha.ca idcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 320 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Aug 2019 98 days
inkonindy.com inkonindy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
insideibrox.com insideibrox.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 128 days
FWHL FWHL-762737 Jun 2019 Aug 2019 47 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
jetlaggin.com jetlaggin.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 220 days
SONO SONO-783272317B Oct 2019 Mar 2020 159 days
FWHL FWHL-762769 Feb 2020 Mar 2020 32 days
kingsofkauffman.com kingsofkauffman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
raisingzona.com raisingzona.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
lametropolesports.com lametropolesports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Jul 2019 49 days
leasticoulddo.com leasticoulddo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 186 days
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 55 days
NEX NEX-3391 Jan 2020 Feb 2020 23 days
lombardiave.com lombardiave.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
luxandlush.com luxandlush.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 231 days
FWHL FWHL-762769 Aug 2019 Dec 2019 127 days
FWHL FWHL-762737 Jun 2019 Aug 2019 42 days
motorcitybengals.com motorcitybengals.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
mycolumbuspower.com mycolumbuspower.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
myspiritdc.com myspiritdc.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
netflixlife.com netflixlife.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
nflmocks.com nflmocks.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
ramblinfan.com ramblinfan.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
nipawinmha.ca nipawinmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 49 days
AOL AOL-6614 Dec 2019 Dec 2019 One Off
nsjhl.ca nsjhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 49 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
AOL AOL-6614 Oct 2019 Oct 2019 One Off
nugglove.com nugglove.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
oilersnation.com oilersnation.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 14 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
orangeintheoven.com orangeintheoven.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
otowns11.com otowns11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
ottawalittlesens.com ottawalittlesens.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Oct 2019 114 days
FWHL FWHL-762737 May 2019 May 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
parolesmania.com parolesmania.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
phoenixnewtimes.com phoenixnewtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Nov 2019 169 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
proceso.com.mx proceso.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 May 2019 Aug 2019 81 days
AOL AOL-6614 Jan 2020 Feb 2020 54 days
puckettspond.com puckettspond.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
reginaballhockey.com reginaballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 201 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 158 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
renfrewminorhockey.ca renfrewminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Jan 2020 66 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 43 days
AOL AOL-6614 Oct 2019 Oct 2019 One Off
rhodyrampage.com rhodyrampage.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
acidcow.com acidcow.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
IEX IEX-189205 Jan 2020 Jan 2020 One Off
rubbingtherock.com rubbingtherock.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
sabrenoise.com sabrenoise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
sacnilk.com sacnilk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 169 days
PUBM PUBM-158017 Feb 2020 Mar 2020 22 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
saturdayblitz.com saturdayblitz.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
saucyrecipes.com saucyrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Nov 2019 163 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
saveur.com saveur.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
shabdkosh.com shabdkosh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 163 days
FWHL FWHL-762737 May 2019 May 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
arrowheadaddict.com arrowheadaddict.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
simbaly.com simbaly.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 116 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
skyscraperblues.com skyscraperblues.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
sooball.com sooball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
soundersnation.com soundersnation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
sportdfw.com sportdfw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
taxguru.in taxguru.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
terezowens.com terezowens.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
azlyrics.com azlyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
therealdeal.com therealdeal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
baggersmag.com baggersmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
balldurham.com balldurham.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
baseballoshawa.com baseballoshawa.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 206 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Nov 2019 Nov 2019 One Off
bbmha.ca bbmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 17 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
uovmhl.ca uovmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 32 days
FWHL FWHL-762769 Aug 2019 Sep 2019 28 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
videotoolbox.com videotoolbox.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
bnwr.ca bnwr.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 208 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Nov 2019 Nov 2019 One Off
bostonbulldogshockey.com bostonbulldogshockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 186 days
FWHL FWHL-762769 Nov 2019 Feb 2020 66 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
boxofficeindia.com boxofficeindia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
bricksareawesome.com bricksareawesome.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 176 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 86 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
bustingbrackets.com bustingbrackets.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wzakcleveland.com wzakcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
calltothepen.com calltothepen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
hailfloridahail.com hailfloridahail.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
cardiaccane.com cardiaccane.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
care2.com care2.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Feb 2020 Mar 2020 47 days
causewaycrowd.com causewaycrowd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cityofchampionssports.com cityofchampionssports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
cobrashockeyaa.net cobrashockeyaa.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 135 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Dec 2019 Dec 2019 One Off
cpdynamo.com cpdynamo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 76 days
FWHL FWHL-762737 Jun 2019 Aug 2019 59 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
divyabhaskar.co.in divyabhaskar.co.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
familyevents.com familyevents.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
empirewritesback.com empirewritesback.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
floridaleague.com floridaleague.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
AOL AOL-6614 Jan 2020 Mar 2020 59 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
floridatravellife.com floridatravellife.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
followfollow.com followfollow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
football.com football.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 124 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
gobmha.ca gobmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
AOL AOL-6614 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
helloaguascalientes.com helloaguascalientes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloalamogordo.com helloalamogordo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloanyang.com helloanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloarlingtonheights.com helloarlingtonheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloasmara.com helloasmara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloasuncion.com helloasuncion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloaustin.com helloaustin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobandarlampung.com hellobandarlampung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobangdung.com hellobangdung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobeijing.com hellobeijing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobelize.com hellobelize.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellochamplin.com hellochamplin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellochangde.com hellochangde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellochesterfield.com hellochesterfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellochillicothe.com hellochillicothe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloclarington.com helloclarington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellococoabeach.com hellococoabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodaniabeach.com hellodaniabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodatong.com hellodatong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodel.com hellodel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodownersgrove.com hellodownersgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloeastbethel.com helloeastbethel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloedina.com helloedina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloelpaso.com helloelpaso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloencinitas.com helloencinitas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofarmersbranch.com hellofarmersbranch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofes.com hellofes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellofortwaltonbeach.com hellofortwaltonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogalati.com hellogalati.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogoiania.com hellogoiania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogoyang.com hellogoyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogretna.com hellogretna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloguadalajara.com helloguadalajara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloguangyuan.com helloguangyuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloguiping.com helloguiping.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaiphong.com hellohaiphong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohandan.com hellohandan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaora.com hellohaora.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohayward.com hellohayward.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohelena.com hellohelena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohengyang.com hellohengyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohuntingtonbeach.com hellohuntingtonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloimperialbeach.com helloimperialbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloindiana.com helloindiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloindianola.com helloindianola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloindiantrail.com helloindiantrail.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloirvine.com helloirvine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellojalgaon.com hellojalgaon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojianyang.com hellojianyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojining.com hellojining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokhulna.com hellokhulna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokumasi.com hellokumasi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloleeds.com helloleeds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloliege.com helloliege.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloliuyang.com helloliuyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolivonia.com hellolivonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellolongbeach.com hellolongbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloluoyang.com helloluoyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomapleridge.com hellomapleridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomarseilles.com hellomarseilles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomessina.com hellomessina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomianyang.com hellomianyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomikonos.com hellomikonos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomodesto.com hellomodesto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomyrtlebeach.com hellomyrtlebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-121239807 Sep 2019 Sep 2019 One Off
GTM GTM-UA-121239807-2 Sep 2019 Sep 2019 One Off
hellonanan.com hellonanan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonanyang.com hellonanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonewwestminster.com hellonewwestminster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonizhnynovgorod.com hellonizhnynovgorod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonorthlasvegas.com hellonorthlasvegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellooman.com hellooman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
helloonalaska.com helloonalaska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloorlando.com helloorlando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloostrava.com helloostrava.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopalmdesert.com hellopalmdesert.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopalmettobay.com hellopalmettobay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopittsburg.com hellopittsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloplano.com helloplano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopoznan.com hellopoznan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopyongyang.com hellopyongyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloqianjiang.com helloqianjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloreims.com helloreims.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellorennes.com hellorennes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloryazan.com helloryazan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosaintetienne.com hellosaintetienne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosamara.com hellosamara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosangabriel.com hellosangabriel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanjuancapistrano.com hellosanjuancapistrano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanmarcos.com hellosanmarcos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosantarosa.com hellosantarosa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosiouxfalls.com hellosiouxfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellostuttgart.com hellostuttgart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellosuining.com hellosuining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotaishan.com hellotaishan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotemecula.com hellotemecula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloteresina.com helloteresina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotexasusa.com hellotexasusa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotianmen.com hellotianmen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotopeka.com hellotopeka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotshwane.com hellotshwane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotyumen.com hellotyumen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
helloweifang.com helloweifang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowestpalmbeach.com hellowestpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloxining.com helloxining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellozakynthos.com hellozakynthos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellozhanjiang.com hellozhanjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
higherlevelsportsacademy.com higherlevelsportsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Mar 2020 273 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 124 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
housesforrent.ws housesforrent.ws
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
houstonpress.com houstonpress.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
huskercorner.com huskercorner.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
jugofsnyder.com jugofsnyder.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
kcmha.ca kcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 131 days
FWHL FWHL-762737 May 2019 May 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
kingjamesgospel.com kingjamesgospel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
lakeshowlife.com lakeshowlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
lawlessrepublic.com lawlessrepublic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
lumsdencubs.ca lumsdencubs.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 167 days
AOL AOL-6614 Oct 2019 Mar 2020 153 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
luusports.com luusports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 42 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
lyrster.com lyrster.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Jan 2020 Mar 2020 59 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
meijeraaahockey.com meijeraaahockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 166 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
metalinjection.net metalinjection.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
miramichiminorhockey.ca miramichiminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Feb 2020 236 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 165 days
FWHL FWHL-762769 Feb 2020 Mar 2020 28 days
mlsmultiplex.com mlsmultiplex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
mqtmutineers.com mqtmutineers.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 310 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 165 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
mykhel.com mykhel.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Oct 2019 113 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
octopusthrower.com octopusthrower.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
olehottytoddy.com olehottytoddy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
omhahockey.ca omhahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Mar 2020 261 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 110 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
ovffl.com ovffl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 110 days
AOL AOL-6614 Feb 2020 Mar 2020 25 days
FWHL FWHL-762769 Feb 2020 Mar 2020 25 days
paininthearsenal.com paininthearsenal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 56 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
parentztalk.com parentztalk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 227 days
FWHL FWHL-762737 May 2019 Jul 2019 47 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
pelhamhockey.com pelhamhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Oct 2019 114 days
FWHL FWHL-762737 May 2019 Jul 2019 48 days
AOL AOL-6614 Jan 2020 Jan 2020 One Off
pointstreak.com pointstreak.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Sep 2019 Mar 2020 189 days
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
portageminorhockey.com portageminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 160 days
FWHL FWHL-762737 May 2019 Aug 2019 82 days
AOL AOL-6614 May 2019 Jul 2019 47 days
puradsi.com puradsi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 223 days
FWHL FWHL-762737 Jul 2019 Aug 2019 34 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
rap4ever.org rap4ever.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 48 days
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
rayscoloredglasses.com rayscoloredglasses.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
riverfrontball.com riverfrontball.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
riverfronttimes.com riverfronttimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Nov 2019 169 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
sackvilleminorhockey.ca sackvilleminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 105 days
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
sacurrent.com sacurrent.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-6614 Jun 2019 Jul 2019 48 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
saskatoonredwings.ca saskatoonredwings.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Mar 2020 255 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 41 days
FWHL FWHL-762737 Jul 2019 Aug 2019 31 days
scubadiving.com scubadiving.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
airalamo.com airalamo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
senshot.com senshot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 78 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
sgmha.com sgmha.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 203 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
shootforthestarshockey.com shootforthestarshockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Nov 2019 115 days
FWHL FWHL-762737 Jul 2019 Aug 2019 30 days
AOL AOL-6614 Sep 2019 Sep 2019 One Off
articlebio.com articlebio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
spacecityscoop.com spacecityscoop.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
sportsmedia101.com sportsmedia101.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 218 days
FWHL FWHL-762769 Sep 2019 Mar 2020 181 days
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
sportingsota.com sportingsota.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
stack.com stack.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 76 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 38 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
12thmanrising.com 12thmanrising.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
stormthepaint.com stormthepaint.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
atlantafire.com atlantafire.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Mar 2020 172 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 18 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
atwateraviators.com atwateraviators.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Jan 2020 Mar 2020 41 days
FWHL FWHL-762737 Jul 2019 Aug 2019 15 days
audiophix.com audiophix.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 173 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tenntruth.com tenntruth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
thebeatdfw.com thebeatdfw.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
thejetpress.com thejetpress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
theprideoflondon.com theprideoflondon.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
thesphl.com thesphl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 145 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
thunderousintentions.com thunderousintentions.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
trivia.com trivia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Nov 2019 65 days
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
undeadwalking.com undeadwalking.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bigredlouie.com bigredlouie.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 131 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
utvdriver.com utvdriver.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Nov 2019 167 days
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 May 2019 Jul 2019 48 days
blogredmachine.com blogredmachine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
wcmha.ca wcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 296 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 197 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
bpringette.ca bpringette.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 179 days
AOL AOL-6614 Nov 2019 Mar 2020 106 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 80 days
westword.com westword.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
wildaaa.ca wildaaa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Mar 2020 193 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 148 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
wiznation.com wiznation.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
woodbuffaloballhockeyleague.ca woodbuffaloballhockeyleague.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Jan 2020 Mar 2020 63 days
camhl.com camhl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 136 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
ycmha.ca ycmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Nov 2019 Mar 2020 111 days
FWHL FWHL-762737 Jun 2019 Aug 2019 70 days
yellowjackedup.com yellowjackedup.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
yourchords.com yourchords.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Jan 2020 Mar 2020 59 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
zonazealots.com zonazealots.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
cqst.ca cqst.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 76 days
FWHL FWHL-762737 Jun 2019 Aug 2019 59 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
cubbiescrib.com cubbiescrib.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
editorinleaf.com editorinleaf.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
emeraldcityswagger.com emeraldcityswagger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
eprmha.ca eprmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 167 days
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 6 days
AOL AOL-6614 Dec 2019 Dec 2019 One Off
everythingontap.com everythingontap.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
foxync.com foxync.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
gaara.ca gaara.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 124 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
gonepuckwild.com gonepuckwild.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
helloacworth.com helloacworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloadelanto.com helloadelanto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloalgonquin.com helloalgonquin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloatlanticcity.com helloatlanticcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobahamas.com hellobahamas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobayonne.com hellobayonne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobelgorod.com hellobelgorod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloberea.com helloberea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobujumbura.com hellobujumbura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocheyenne.com hellocheyenne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocorona.com hellocorona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodallas.com hellodallas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodelraybeach.com hellodelraybeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodeltona.com hellodeltona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofortsmith.com hellofortsmith.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofountainhills.com hellofountainhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogongzhuling.com hellogongzhuling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogreatbritain.com hellogreatbritain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogreenfield.com hellogreenfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloguigang.com helloguigang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohagen.com hellohagen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohartford.com hellohartford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohechuan.com hellohechuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohims.com hellohims.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jan 2022 187 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohuainan.com hellohuainan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojacksonvillebeach.com hellojacksonvillebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellojinjiang.com hellojinjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokaohsiung.com hellokaohsiung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokelso.com hellokelso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloklamathfalls.com helloklamathfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloleicester.com helloleicester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolibreville.com hellolibreville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellologansport.com hellologansport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloloslunas.com helloloslunas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolublin.com hellolublin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloludhiana.com helloludhiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomariupol.com hellomariupol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomombasa.com hellomombasa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomoncton.com hellomoncton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomonrovia.com hellomonrovia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellomonticello.com hellomonticello.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomysore.com hellomysore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloneijiang.com helloneijiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonewbedford.com hellonewbedford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonewburyport.com hellonewburyport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonewsmyrnabeach.com hellonewsmyrnabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonorthmyrtlebeach.com hellonorthmyrtlebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopacificbeach.com hellopacificbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopadova.com hellopadova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopawtucket.com hellopawtucket.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloplymouth.com helloplymouth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopristina.com hellopristina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloredondobeach.com helloredondobeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellorichmondhill.com hellorichmondhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Jul 2020 Jan 2021 188 days
GTM GTM-UA-118129358-1 Jul 2020 Jan 2021 188 days
hellorome.com hellorome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloroyalpalmbeach.com helloroyalpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosaintthomas.com hellosaintthomas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosamarkand.com hellosamarkand.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosanbenito.com hellosanbenito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosandwell.com hellosandwell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosanrafael.com hellosanrafael.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloselma.com helloselma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloshreveport.com helloshreveport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosolapur.com hellosolapur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosouthfield.com hellosouthfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosrinagar.com hellosrinagar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellostamford.com hellostamford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosudan.com hellosudan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotaichung.com hellotaichung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotangier.com hellotangier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellothane.com hellothane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotijuana.com hellotijuana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotorreon.com hellotorreon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotroisrivieres.com hellotroisrivieres.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Jul 2022 315 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotulsa.com hellotulsa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloulsan.com helloulsan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellovegas.com hellovegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovernonhills.com hellovernonhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovienna.com hellovienna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowadsworth.com hellowadsworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellowichitafalls.com hellowichitafalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellowuppertal.com hellowuppertal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloxingyang.com helloxingyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloyarmouth.com helloyarmouth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloyiyang.com helloyiyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hoopshabit.com hoopshabit.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
houseofhouston.com houseofhouston.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
ipowerrichmond.com ipowerrichmond.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
irtv98.com irtv98.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 96 days
IEX IEX-189205 Dec 2019 Feb 2020 61 days
NEX NEX-3391 Dec 2019 Feb 2020 61 days
jagranjosh.com jagranjosh.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 159 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 60 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
jrbanditsaaa.com jrbanditsaaa.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 171 days
FWHL FWHL-762769 Aug 2019 Aug 2019 5 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
kaorinusantara.or.id kaorinusantara.or.id
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Jun 2019 48 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
lazers.ca lazers.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 215 days
AOL AOL-6614 Oct 2019 Mar 2020 155 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
localpov.com localpov.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 194 days
FWHL FWHL-762737 Jun 2019 Aug 2019 42 days
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
marlinmaniac.com marlinmaniac.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 56 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
metrotimes.com metrotimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Nov 2019 169 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
midlevelexceptional.com midlevelexceptional.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
motorcyclistonline.com motorcyclistonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
ndusc.ca ndusc.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 85 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 50 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
ngoisao.net ngoisao.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
ntbhl.ca ntbhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
ntnews.com ntnews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 83 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 48 days
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
phlacademy.ca phlacademy.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
popsci.com popsci.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
praisedc.com praisedc.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
percolately.com percolately.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 63 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Jan 2020 Jan 2020 One Off
puckermob.com puckermob.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
AOL AOL-6614 Jun 2019 Jul 2019 48 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
qysa.ca qysa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Feb 2020 183 days
FWHL FWHL-762769 Aug 2019 Feb 2020 183 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 44 days
raptorsrapture.com raptorsrapture.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 78 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
reddevilarmada.com reddevilarmada.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 147 days
FWHL FWHL-762737 May 2019 Aug 2019 80 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
scroll.in scroll.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
section215.com section215.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
senbhl.net senbhl.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
AOL AOL-6614 May 2019 May 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
sfmha.ca sfmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 40 days
AOL AOL-6614 May 2019 May 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
allcougdup.com allcougdup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 49 days
FWHL FWHL-762737 Jun 2019 Jul 2019 49 days
shoppinglifestyle.com shoppinglifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
sohh.com sohh.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
southsideshowdown.com southsideshowdown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
sportdiver.com sportdiver.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
sputnikmusic.com sputnikmusic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
atlallday.com atlallday.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
swbulldogs.com swbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Jan 2020 Mar 2020 70 days
AOL AOL-6614 May 2019 May 2019 One Off
alloverthehill.com alloverthehill.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
talking12.com talking12.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
tenacityfastpitch.com tenacityfastpitch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 75 days
AOL AOL-6614 Jan 2020 Mar 2020 69 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 36 days
terraceadulthockey.ca terraceadulthockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 116 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 36 days
AOL AOL-6614 Mar 2020 Mar 2020 19 days
thebaltimorewire.com thebaltimorewire.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thehuskyhaul.com thehuskyhaul.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
thelightnc.com thelightnc.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
timesofoman.com timesofoman.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Nov 2019 169 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
tomahawktake.com tomahawktake.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
bcbha.com bcbha.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 82 days
FWHL FWHL-762737 Jun 2019 Aug 2019 62 days
AOL AOL-6614 Jun 2019 Jun 2019 One Off
trumanstales.com trumanstales.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 78 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
ultrasurfing.com ultrasurfing.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
birdswatcher.com birdswatcher.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
valleyofthesuns.com valleyofthesuns.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bluelinestation.com bluelinestation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
bluemanhoop.com bluemanhoop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
boltsbythebay.com boltsbythebay.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
bosoxinjection.com bosoxinjection.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
withthefirstpick.com withthefirstpick.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wreckemred.com wreckemred.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cbwmh.ca cbwmh.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 185 days
AOL AOL-6614 Nov 2019 Mar 2020 113 days
FWHL FWHL-762769 Aug 2019 Sep 2019 47 days
chmbarockets.com chmbarockets.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 136 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
AOL AOL-6614 Sep 2019 Nov 2019 64 days
citybeat.com citybeat.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Nov 2019 Nov 2019 One Off
coingape.com coingape.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
PUBM PUBM-158017 Feb 2020 Mar 2020 45 days
IEX IEX-189205 Feb 2020 Feb 2020 10 days
coolimba.com coolimba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 248 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
cycleworld.com cycleworld.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
deathvalleyvoice.com deathvalleyvoice.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
denofgeek.com denofgeek.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
dirtrider.com dirtrider.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
districtondeck.com districtondeck.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
eckvilleminorhockey.com eckvilleminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 181 days
FWHL FWHL-762737 Jun 2019 Aug 2019 56 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
estevanminorhockey.com estevanminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 217 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
fansided.com fansided.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
fieldandstream.com fieldandstream.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
flameforthought.com flameforthought.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
fnsflagfootball.ca fnsflagfootball.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 68 days
FWHL FWHL-762737 Jun 2019 Aug 2019 53 days
AOL AOL-6614 Dec 2019 Dec 2019 One Off
gizbot.com gizbot.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 48 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
goldenbearlair.com goldenbearlair.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 131 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 78 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
guelphknightsbasketball.ca guelphknightsbasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
heavy.com heavy.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
helloalameda.com helloalameda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloanegada.com helloanegada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloanshan.com helloanshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloastrakhan.com helloastrakhan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloaventura.com helloaventura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobarbuda.com hellobarbuda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobazhong.com hellobazhong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobolton.com hellobolton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobrazzaville.com hellobrazzaville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118129358 Apr 2022 Jul 2022 90 days
hellobrighton.com hellobrighton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellobulawayo.com hellobulawayo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodaytonabeach.com hellodaytonabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodebrecen.com hellodebrecen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodesoto.com hellodesoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodestin.com hellodestin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodnipro.com hellodnipro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodoncaster.com hellodoncaster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodouglas.com hellodouglas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodrummondville.com hellodrummondville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloegypt.com helloegypt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloelcerrito.com helloelcerrito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloeunice.com helloeunice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofairfield.com hellofairfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofrankfort.com hellofrankfort.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogaithersburg.com hellogaithersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogdynia.com hellogdynia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogelsenkirchen.com hellogelsenkirchen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogijon.com hellogijon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogreenwich.com hellogreenwich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogriffin.com hellogriffin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohaicheng.com hellohaicheng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaimen.com hellohaimen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohannover.com hellohannover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohermosabeach.com hellohermosabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohongkong.com hellohongkong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohurricane.com hellohurricane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellojabalpur.com hellojabalpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojamshedpur.com hellojamshedpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojessore.com hellojessore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojuba.com hellojuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Nov 2020 2 years, 87 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokaifeng.com hellokaifeng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokawarthalakes.com hellokawarthalakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokazan.com hellokazan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokingston.com hellokingston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokurgan.com hellokurgan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolagunabeach.com hellolagunabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolakezurich.com hellolakezurich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolawrence.com hellolawrence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolebanon.com hellolebanon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolemongrove.com hellolemongrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolufeng.com hellolufeng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomedellin.com hellomedellin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomilpitas.com hellomilpitas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomontanausa.com hellomontanausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomortongrove.com hellomortongrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomultan.com hellomultan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonaucalpan.com hellonaucalpan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonevada.com hellonevada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonorthmankato.com hellonorthmankato.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonovato.com hellonovato.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellooviedo.com hellooviedo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopalmbeach.com hellopalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopaloalto.com hellopaloalto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopaloshills.com hellopaloshills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopapuanewguinea.com hellopapuanewguinea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloparma.com helloparma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopingdingshan.com hellopingdingshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopittsfield.com hellopittsfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloprincegeorge.com helloprincegeorge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloriverfalls.com helloriverfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellorockford.com hellorockford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosaintjerome.com hellosaintjerome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosalinas.com hellosalinas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosaultstemarie.com hellosaultstemarie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellosausalito.com hellosausalito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloshijiazhuang.com helloshijiazhuang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloskiathos.com helloskiathos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosomerset.com hellosomerset.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellostcatharines.com hellostcatharines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
helloszczecin.com helloszczecin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotashkent.com hellotashkent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellothehague.com hellothehague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellotrieste.com hellotrieste.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloturkscaicos.com helloturkscaicos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovadodara.com hellovadodara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellovicksburg.com hellovicksburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovilnius.com hellovilnius.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowafangdian.com hellowafangdian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowarrensburg.com hellowarrensburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellowellington.com hellowellington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowujiang.com hellowujiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellozaporizhia.com hellozaporizhia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hockeyfights.com hockeyfights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
huskerboard.com huskerboard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
iadityak.com iadityak.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
insidetheloudhouse.com insidetheloudhouse.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
jigsawpuzz.com jigsawpuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
leoboivinshowcase.ca leoboivinshowcase.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 168 days
AOL AOL-6614 Dec 2019 Mar 2020 90 days
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
loopjamaica.com loopjamaica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 124 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
lyricsondemand.com lyricsondemand.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
mahshl.com mahshl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 195 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 116 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
mdhlmi.com mdhlmi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 115 days
FWHL FWHL-762737 Jun 2019 Aug 2019 41 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
milehighmaniac.com milehighmaniac.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
mirchi9.com mirchi9.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 276 days
FWHL FWHL-762769 Aug 2019 Dec 2019 127 days
FWHL FWHL-762737 May 2019 Aug 2019 87 days
nafe.com nafe.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 161 days
FWHL FWHL-762737 May 2019 Aug 2019 86 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
nbgha.com nbgha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 211 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 50 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
nbjbhl.com nbjbhl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Dec 2019 Feb 2020 57 days
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
nflspinzone.com nflspinzone.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
oilonwhyte.com oilonwhyte.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 55 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
okz.ca okz.ca
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 226 days
FWHL FWHL-762737 May 2019 Aug 2019 84 days
FWHL FWHL-762769 Aug 2019 Oct 2019 63 days
onthebright.com onthebright.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 146 days
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
ottawajr67aaa.com ottawajr67aaa.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 208 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
pelicandebrief.com pelicandebrief.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
penguinmd.com penguinmd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 183 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 173 days
FWHL FWHL-762737 May 2019 Aug 2019 83 days
pippenainteasy.com pippenainteasy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
playingfor90.com playingfor90.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
popphoto.com popphoto.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
puckprose.com puckprose.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 182 days
FWHL FWHL-762737 May 2019 Aug 2019 81 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
razorbackers.com razorbackers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
redbirdrants.com redbirdrants.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
reviewingthebrew.com reviewingthebrew.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
riggosrag.com riggosrag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
ripcityproject.com ripcityproject.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
risingapple.com risingapple.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
rocklandicerink.com rocklandicerink.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 157 days
AOL AOL-6614 Feb 2020 Mar 2020 23 days
achhikhabar.com achhikhabar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 55 days
IEX IEX-189205 Jan 2020 Feb 2020 20 days
rotter.net rotter.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
IEX IEX-189205 Nov 2019 Nov 2019 One Off
actoniansrfc.com actoniansrfc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
rushthecourt.net rushthecourt.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
saamtv.com saamtv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 64 days
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
arcamax.com arcamax.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AVVID AVVID-7802 Nov 2019 Jan 2020 65 days
saveig.org saveig.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Feb 2020 39 days
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
sbobrfc.co.uk sbobrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
ardsrugby.co.uk ardsrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B May 2019 Jun 2019 34 days
seattlepi.com seattlepi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
aiyinsitanblog.ml aiyinsitanblog.ml
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Nov 2019 122 days
IEX IEX-189205 Jul 2019 Nov 2019 122 days
sedmha.com sedmha.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Nov 2019 64 days
AOL AOL-6614 Nov 2019 Nov 2019 One Off
sekrima.org sekrima.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Jul 2019 One Off
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
alternateuni.com alternateuni.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
shaalaa.com shaalaa.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Jan 2020 129 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
alugha.com alugha.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
showt.com showt.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 229 days
FWHL FWHL-762769 Aug 2019 Jan 2020 151 days
sircharlesincharge.com sircharlesincharge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
skmov.com skmov.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Jan 2020 130 days
IEX IEX-189205 Sep 2019 Jan 2020 130 days
skywayshoutout.com skywayshoutout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
smll.ca smll.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
soaringtoglory.com soaringtoglory.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
sonichits.com sonichits.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
southbaystorm.com southbaystorm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 117 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
soy502.com soy502.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
soycarmin.com soycarmin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 May 2019 Aug 2019 77 days
sportsmashup.com sportsmashup.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
arsenalfootball.co arsenalfootball.co
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Jul 2019 35 days
PUBM PUBM-158017 Jun 2019 Jul 2019 35 days
sscportal.in sscportal.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 71 days
IEX IEX-189205 Jan 2020 Feb 2020 36 days
stemha.ca stemha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 38 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
stlyrics.com stlyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
stormininnorman.com stormininnorman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
strettynews.com strettynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
sufcacademy.com sufcacademy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
sundreminorhockey.ca sundreminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Nov 2019 Jan 2020 66 days
super9.org super9.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 28 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
survivinginfidelity.com survivinginfidelity.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
svmhl.ca svmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 164 days
FWHL FWHL-762769 Aug 2019 Nov 2019 88 days
atraccion360.com atraccion360.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Aug 2019 15 days
thaivisa.com thaivisa.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 231 days
IEX IEX-189205 Jul 2019 Feb 2020 210 days
thebiglead.com thebiglead.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
theboxhouston.com theboxhouston.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
thecanuckway.com thecanuckway.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
theglhl.com theglhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 27 days
AOL AOL-6614 Jan 2020 Jan 2020 One Off
bachpan.com bachpan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 181 days
IEX IEX-189205 Sep 2019 Jan 2020 131 days
thevikingage.com thevikingage.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
theweek.com theweek.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thongsbridgecricketclub.co.uk thongsbridgecricketclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
threebridgesfc.co.uk threebridgesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
tikout.com tikout.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
tinthethao.com.vn tinthethao.com.vn
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
baseballessential.com baseballessential.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
tollypics.com tollypics.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 256 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
tolucalabellacd.com tolucalabellacd.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 251 days
IEX IEX-189205 Jul 2019 Nov 2019 118 days
top5.com top5.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
bermudatriplecrown.com bermudatriplecrown.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
tutsmake.com tutsmake.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 250 days
IEX IEX-189205 Jul 2019 Jul 2019 One Off
bia2.tv bia2.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
updatepedia.com updatepedia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 131 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 96 days
bitrixc.info bitrixc.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
vbha.com vbha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 17 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
veblr.com veblr.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 249 days
IEX IEX-189205 Jul 2019 Feb 2020 214 days
bladesofteal.com bladesofteal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
blognife.com blognife.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 8 days
IEX IEX-189205 Feb 2020 Feb 2020 One Off
boatingmag.com boatingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
bobcatattack.com bobcatattack.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
wbir.com wbir.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wcoanimedub.tv wcoanimedub.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 194 days
IEX IEX-189205 Sep 2019 Feb 2020 159 days
wcoanimesub.tv wcoanimesub.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 178 days
IEX IEX-189205 Sep 2019 Feb 2020 159 days
wcoastswing.com wcoastswing.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Sep 2019 One Off
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
boxofficebuz.com boxofficebuz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 44 days
IEX IEX-189205 Jan 2020 Feb 2020 23 days
browardpalmbeach.com browardpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
wikiholics.com wikiholics.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 63 days
IEX IEX-189205 Jan 2020 Feb 2020 28 days
wildcatbluenation.com wildcatbluenation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bshl.ca bshl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 186 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
bsmf.ca bsmf.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Feb 2020 188 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 80 days
btimesonline.com btimesonline.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 48 days
IEX IEX-189205 Feb 2020 Feb 2020 13 days
winsloecharlottetownfc.ca winsloecharlottetownfc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Mar 2020 231 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 29 days
wjbq.com wjbq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wkyc.com wkyc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
worldwideinterweb.com worldwideinterweb.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Jul 2019 Jul 2019 One Off
wrcsoccer.com wrcsoccer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 111 days
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
wrrv.com wrrv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
buzztl.com buzztl.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 105 days
IEX IEX-189205 Nov 2019 Feb 2020 78 days
xbad.info xbad.info
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
yabo0990.com yabo0990.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
yallalive.tv yallalive.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
ymcahc.ie ymcahc.ie
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
youlike89.com youlike89.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
zoffar.com zoffar.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
classicrock961.com classicrock961.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
concealednation.org concealednation.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
consequenceofsound.net consequenceofsound.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
convert-me.com convert-me.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
cowboylyrics.com cowboylyrics.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cuidatudinero.com cuidatudinero.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
curiosity.com curiosity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cyanogenmods.org cyanogenmods.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Feb 2020 198 days
PUBM PUBM-158017 Mar 2020 Mar 2020 6 days
dailyknicks.com dailyknicks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 181 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
dailythanthi.com dailythanthi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
FWHL FWHL-762769 Jan 2020 Mar 2020 45 days
dbzgames.org dbzgames.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Feb 2020 Feb 2020 One Off
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
decaregina.ca decaregina.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
directexpose.com directexpose.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 116 days
FWHL FWHL-762737 May 2019 Jun 2019 41 days
doramatv.live doramatv.live
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
doramatv.me doramatv.me
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
dramha.com dramha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Aug 2019 49 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
dumbbell-exercises.com dumbbell-exercises.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Feb 2020 Feb 2020 One Off
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
dynamitenews.com dynamitenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 167 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 136 days
ebaumsworld.com ebaumsworld.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ebook3000.biz ebook3000.biz
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Feb 2020 131 days
PUBM PUBM-158017 Oct 2019 Feb 2020 131 days
eclecticesoterica.com eclecticesoterica.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
eleconomistaamerica.com eleconomistaamerica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
eleconomistaamerica.pe eleconomistaamerica.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
empireofthekop.com empireofthekop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 185 days
FWHL FWHL-762737 Jun 2019 Aug 2019 55 days
esakal.com esakal.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
expreso.ec expreso.ec
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 55 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
fieldandstreamexpo.com fieldandstreamexpo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Dec 2019 218 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
floor8.com floor8.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
flyingmag.com flyingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
francetabs.com francetabs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 53 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
freegameempire.com freegameempire.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
fresh2refresh.com fresh2refresh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
FWHL FWHL-762769 Jan 2020 Mar 2020 45 days
fstoppers.com fstoppers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
fulltvshows.org fulltvshows.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
ganderminorhockey.ca ganderminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 177 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
garnetandcocky.com garnetandcocky.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
gbmwolverine.com gbmwolverine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
geekextreme.com geekextreme.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
ggpan.com ggpan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 225 days
IEX IEX-189205 Aug 2019 Feb 2020 191 days
glamsham.com glamsham.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
gojoebruin.com gojoebruin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
gtaall.net gtaall.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
gtavicecity.ru gtavicecity.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
haccricket.org haccricket.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
hackr.io hackr.io
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
hagomitarea.com hagomitarea.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 124 days
FWHL FWHL-762737 May 2019 May 2019 One Off
helloaltoona.com helloaltoona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloanchorage.com helloanchorage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloanguilla.com helloanguilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 14 days
helloannapolis.com helloannapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloaspen.com helloaspen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloatlanta.com helloatlanta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobakersfield.com hellobakersfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobalchsprings.com hellobalchsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobaltimore.com hellobaltimore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobatonrouge.com hellobatonrouge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobeaverton.com hellobeaverton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobloomingdale.com hellobloomingdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloboulder.com helloboulder.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobrainerd.com hellobrainerd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobridgeport.com hellobridgeport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobroomfield.com hellobroomfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobrownsburg.com hellobrownsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocalifornia.com hellocalifornia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocapecoral.com hellocapecoral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocedarburg.com hellocedarburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocentralpoint.com hellocentralpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocharlotte.com hellocharlotte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellochesapeake.com hellochesapeake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellochulavista.com hellochulavista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocleveland.com hellocleveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocolorado.com hellocolorado.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloconcord.com helloconcord.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocostamesa.com hellocostamesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocresthill.com hellocresthill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodamascus.com hellodamascus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Aug 2018 Sep 2018 38 days
hellodarien.com hellodarien.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodecatural.com hellodecatural.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodecaturil.com hellodecaturil.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodeerpark.com hellodeerpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodelmar.com hellodelmar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodepere.com hellodepere.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloduluth.com helloduluth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloeagan.com helloeagan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloeastpoint.com helloeastpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloeastridge.com helloeastridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloforestgrove.com helloforestgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofremont.com hellofremont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofullerton.com hellofullerton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogardner.com hellogardner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogatlinburg.com hellogatlinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogloucester.com hellogloucester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogoleta.com hellogoleta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogoodyear.com hellogoodyear.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellograndisland.com hellograndisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellograndprairie.com hellograndprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellograndrapids.com hellograndrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloharlingen.com helloharlingen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohavelock.com hellohavelock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohaverhill.com hellohaverhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohempsteadvillage.com hellohempsteadvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohollysprings.com hellohollysprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohoover.com hellohoover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohuntingtonpark.com hellohuntingtonpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloidahofalls.com helloidahofalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloillinois.com helloillinois.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloisrael.com helloisrael.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojapan.com hellojapan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellokeywest.com hellokeywest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolagunaniguel.com hellolagunaniguel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolaredo.com hellolaredo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolauderhill.com hellolauderhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolinolakes.com hellolinolakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
hellolongmont.com hellolongmont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolowell.com hellolowell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolubbock.com hellolubbock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomadagascar.com hellomadagascar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomaine.com hellomaine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomamaroneck.com hellomamaroneck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomarana.com hellomarana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomargate.com hellomargate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomaryland.com hellomaryland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomemphis.com hellomemphis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomesquite.com hellomesquite.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomilford.com hellomilford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomontebello.com hellomontebello.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomorenovalley.com hellomorenovalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomountpleasant.com hellomountpleasant.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonashville.com hellonashville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonebraska.com hellonebraska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewbritain.com hellonewbritain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewhampshire.com hellonewhampshire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewmexico.com hellonewmexico.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonorthport.com hellonorthport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooakland.com hellooakland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooceancity.com hellooceancity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloolathe.com helloolathe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloopelika.com helloopelika.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopicayune.com hellopicayune.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopleasantprairie.com hellopleasantprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloponca.com helloponca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloqueens.com helloqueens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloraymore.com helloraymore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorevere.com hellorevere.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorichmond.com hellorichmond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloriverside.com helloriverside.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorohnertpark.com hellorohnertpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloromulus.com helloromulus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellorosemead.com hellorosemead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloroundrock.com helloroundrock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosafetyharbor.com hellosafetyharbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosaginaw.com hellosaginaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosaintcroix.com hellosaintcroix.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosantaana.com hellosantaana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloscandinavia.com helloscandinavia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 12 days
helloscottsdale.com helloscottsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosherbrooke.com hellosherbrooke.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosinteustatius.com hellosinteustatius.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosiouxcity.com hellosiouxcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloskokie.com helloskokie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosmyrna.com hellosmyrna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosouthaven.com hellosouthaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosouthbend.com hellosouthbend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosouthcarolina.com hellosouthcarolina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellostevenspoint.com hellostevenspoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellostpeters.com hellostpeters.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosulphur.com hellosulphur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosunprairie.com hellosunprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotemple.com hellotemple.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloterrell.com helloterrell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotonga.com hellotonga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellotwinsburg.com hellotwinsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellovalparaiso.com hellovalparaiso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellovanburen.com hellovanburen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellovaticancity.com hellovaticancity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellovermont.com hellovermont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellovillapark.com hellovillapark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestlafayette.com hellowestlafayette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestvirginia.com hellowestvirginia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowilkesbarre.com hellowilkesbarre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowilsonville.com hellowilsonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowoodlandpark.com hellowoodlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowoodstock.com hellowoodstock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloyork.com helloyork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
history101.com history101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 May 2019 One Off
hothardware.com hothardware.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
hotspurhq.com hotspurhq.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
hoy.com.do hoy.com.do
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 May 2019 Aug 2019 97 days
huashengblg.com huashengblg.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 64 days
IEX IEX-189205 Dec 2019 Feb 2020 63 days
huntsvillehavoc.com huntsvillehavoc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
AOL AOL-6614 Feb 2020 Mar 2020 34 days
indgovtjobs.in indgovtjobs.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Dec 2019 64 days
MEDI MEDI-8CUZ310G2 Oct 2019 Dec 2019 64 days
indiaparenting.com indiaparenting.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
inetgalaxy.com inetgalaxy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 61 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
inquisitr.com inquisitr.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 186 days
italiaflyers.com italiaflyers.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 172 days
FWHL FWHL-762737 May 2019 Aug 2019 95 days
jagran.com jagran.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
jdf-ref.com jdf-ref.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 171 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
jpost.com jpost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 242 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 47 days
kamloopsballhockey.com kamloopsballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Dec 2019 Feb 2020 61 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
kardashiandish.com kardashiandish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 5 days
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
koimoi.com koimoi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
kool1017.com kool1017.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kto-chto-gde.ru kto-chto-gde.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 91 days
IEX IEX-189205 Dec 2019 Feb 2020 56 days
kumudam.com kumudam.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 217 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 182 days
lastwordonsports.com lastwordonsports.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 260 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
letsthinkeasy.com letsthinkeasy.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 90 days
IEX IEX-189205 Dec 2019 Feb 2020 55 days
miaminewtimes.com miaminewtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 121 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
linkingsky.com linkingsky.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 119 days
FWHL FWHL-762769 Dec 2019 Mar 2020 89 days
lmhatournament.com lmhatournament.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 214 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
lnka.tw lnka.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 54 days
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
lonestar995fm.com lonestar995fm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
loudwiremusicfestival.com loudwiremusicfestival.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
lwos.life lwos.life
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Feb 2020 231 days
PUBM PUBM-158017 Jun 2019 Dec 2019 178 days
lwosports.com lwosports.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Feb 2020 186 days
IEX IEX-189205 Aug 2019 Feb 2020 180 days
lyricsmania.com lyricsmania.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
madhyamam.com madhyamam.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
maindy.co.uk maindy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
mdzol.com mdzol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
mendotareporter.com mendotareporter.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Mar 2020 231 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
menscrown.com menscrown.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Feb 2020 230 days
PUBM PUBM-158017 Jun 2019 Jun 2019 One Off
metsmerizedonline.com metsmerizedonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
momspresso.com momspresso.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 178 days
FWHL FWHL-762769 Dec 2019 Mar 2020 86 days
moneyintern.com moneyintern.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 86 days
IEX IEX-189205 Dec 2019 Feb 2020 51 days
mpsctoday.com mpsctoday.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
musipedia.org musipedia.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
mybaltimorespirit.com mybaltimorespirit.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mysticscripts.com mysticscripts.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
naibuzz.com naibuzz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Feb 2020 228 days
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
nertazw.com nertazw.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
newsbugz.com newsbugz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 211 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 176 days
newstalkcleveland.com newstalkcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
nhknightshockey.com nhknightshockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 47 days
AOL AOL-6614 Oct 2019 Oct 2019 One Off
nigeriaworld.com nigeriaworld.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 260 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
nocartridge.com nocartridge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 38 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
range365.com range365.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 82 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
novelcool.com novelcool.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Aug 2019 Feb 2020 175 days
nsfll.ca nsfll.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 111 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
obozrevatel.com obozrevatel.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Nov 2019 120 days
PUBM PUBM-158017 Jul 2019 Nov 2019 120 days
odishatv.in odishatv.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 175 days
oomph.co.id oomph.co.id
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 261 days
IEX IEX-189205 Jul 2019 Dec 2019 180 days
openlist.com openlist.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Sep 2019 Feb 2020 154 days
readberserk.com readberserk.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 257 days
IEX IEX-189205 Jul 2019 Feb 2020 222 days
pay-box.in pay-box.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Jan 2020 65 days
IEX IEX-189205 Oct 2019 Oct 2019 One Off
pcmha.com pcmha.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Oct 2019 162 days
AOL AOL-6614 Oct 2019 Oct 2019 One Off
peninsulaclarion.com peninsulaclarion.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
FWHL FWHL-762769 Mar 2020 Mar 2020 14 days
phpclasses.hu phpclasses.hu
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 208 days
IEX IEX-189205 Aug 2019 Feb 2020 173 days
picbear.org picbear.org
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Feb 2020 224 days
PUBM PUBM-158017 Jul 2019 Aug 2019 51 days
pikstagram.net pikstagram.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
pmfa.ca pmfa.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 160 days
FWHL FWHL-762769 Oct 2019 Feb 2020 120 days
prepvolleyball.com prepvolleyball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
pucksandpitchforks.com pucksandpitchforks.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
punchng.com punchng.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
quizpeek.com quizpeek.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 200 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 108 days
registercitizen.com registercitizen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
rmx.com.mx rmx.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 201 days
FWHL FWHL-762737 Jul 2019 Aug 2019 32 days
abreo.co abreo.co
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
achoylake.com achoylake.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 80 days
SONO SONO-783272317B May 2019 Jun 2019 32 days
rsvponline.mx rsvponline.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 79 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
ryanshay.ca ryanshay.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 204 days
FWHL FWHL-762769 Nov 2019 Mar 2020 140 days
sabrehockey.com sabrehockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 105 days
AOL AOL-6614 Feb 2020 Mar 2020 22 days
arhlhockey.com arhlhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
scarletandgame.com scarletandgame.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
sendscraps.com sendscraps.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
seo-fast.ru seo-fast.ru
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
shnc.co.uk shnc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Sep 2019 100 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
am66g.com am66g.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
ankaclan.com ankaclan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
IEX IEX-189205 Sep 2019 Sep 2019 One Off
slapthesign.com slapthesign.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
slotbackwaggle.com slotbackwaggle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 129 days
FWHL FWHL-762737 May 2019 Jul 2019 47 days
smdsc.com.au smdsc.com.au
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
angelswin.com angelswin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 124 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
sovsport.ru sovsport.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
sprmha.com sprmha.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 154 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
stamfordadvocate.com stamfordadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
starsandsticks.com starsandsticks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
starcrush.com starcrush.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1007sandiego.com 1007sandiego.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
1027kord.com 1027kord.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stlfinder.com stlfinder.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Nov 2019 63 days
PUBM PUBM-158017 Sep 2019 Nov 2019 63 days
1428elm.com 1428elm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
suke.in suke.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
admiralshockey.ca admiralshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
albat.com.mx albat.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 65 days
FWHL FWHL-762769 Aug 2019 Sep 2019 40 days
surfer.com surfer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
surfturfandmurph.com surfturfandmurph.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
swanagefc.com swanagefc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
anchoragebucs.com anchoragebucs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 118 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 19 days
aspsnippets.com aspsnippets.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
atozproxy.com atozproxy.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 182 days
IEX IEX-189205 Sep 2019 Feb 2020 147 days
teluguz.com teluguz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 198 days
IEX IEX-189205 Sep 2019 Feb 2020 163 days
terraceminorhockey.ca terraceminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
AOL AOL-6614 Mar 2020 Mar 2020 One Off
tettybetty.com tettybetty.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 89 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thatballsouttahere.com thatballsouttahere.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
awkwardmom.com awkwardmom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
awwthings.com awwthings.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 107 days
IEX IEX-189205 Nov 2019 Feb 2020 82 days
thedailyworld.com thedailyworld.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 59 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
thegameraccess.com thegameraccess.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Feb 2020 210 days
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
babsonfashion1.com babsonfashion1.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
backgrounddownload.com backgrounddownload.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 181 days
IEX IEX-189205 Sep 2019 Feb 2020 146 days
therooster.com therooster.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 124 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
thesmokingcuban.com thesmokingcuban.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
banana1015.com banana1015.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tidbitsofexperience.com tidbitsofexperience.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
tipofthetower.com tipofthetower.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
timeskerala.com timeskerala.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 33 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
tmofans.com tmofans.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Jul 2019 One Off
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
bawarchi.com bawarchi.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Sep 2019 93 days
PUBM PUBM-158017 Jun 2019 Sep 2019 93 days
topnewsthamizh.com topnewsthamizh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 33 days
FWHL FWHL-762769 Mar 2020 Mar 2020 18 days
bearinsider.com bearinsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 56 days
trabzonilkadimgayrimenkul.com trabzonilkadimgayrimenkul.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
beebom.com beebom.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
behindwoods.com behindwoods.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
truthandaction.org truthandaction.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
ttcp5577.com ttcp5577.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
bernieburkegolf.ca bernieburkegolf.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 180 days
AOL AOL-6614 Nov 2019 Mar 2020 106 days
typingclub.com typingclub.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
ulifestyle.com.hk ulifestyle.com.hk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 131 days
IEX IEX-189205 Nov 2019 Feb 2020 96 days
bikemag.com bikemag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
blackamericaweb.com blackamericaweb.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
blackfaldsminorhockey.com blackfaldsminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
vinepair.com vinepair.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-19139 Aug 2019 Jan 2020 165 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
viralplot.com viralplot.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 65 days
IEX IEX-189205 Jan 2020 Feb 2020 30 days
vivaligamx.com vivaligamx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 May 2019 Aug 2019 72 days
bmgmediasolutions.com bmgmediasolutions.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Nov 2019 208 days
FWHL FWHL-762737 Jun 2019 Aug 2019 62 days
volleyballpei.com volleyballpei.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
vtflameshockey.com vtflameshockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 149 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
bollywood3.in bollywood3.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 79 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
boltbeat.com boltbeat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
boundingintocomics.com boundingintocomics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 45 days
FWHL FWHL-762737 May 2019 Jun 2019 37 days
wgna.com wgna.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
broadstreetbuzz.com broadstreetbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
brookingsregister.com brookingsregister.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jan 2020 186 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
buddhanet01.com buddhanet01.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Feb 2020 79 days
PUBM PUBM-158017 Feb 2020 Mar 2020 48 days
winteriscoming.net winteriscoming.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 56 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
workingmother.com workingmother.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
wowkeren.com wowkeren.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
bvayouthsoccer.com bvayouthsoccer.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 209 days
AOL AOL-6614 Nov 2019 Mar 2020 105 days
bwha.ca bwha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 137 days
FWHL FWHL-762769 Aug 2019 Sep 2019 46 days
wxc-yl.com wxc-yl.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
xclient.info xclient.info
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 247 days
IEX IEX-189205 Jul 2019 Feb 2020 212 days
canaln.pe canaln.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 216 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
hailwv.com hailwv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
capebretontradesmen.com capebretontradesmen.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 136 days
FWHL FWHL-762737 May 2019 Jun 2019 38 days
yachtingmagazine.com yachtingmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
yesplz.co yesplz.co
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 103 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
yovizag.com yovizag.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Jan 2020 130 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
catchnews.com catchnews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 78 days
IEX IEX-189205 Nov 2019 Feb 2020 78 days
yucatan.com.mx yucatan.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
NEX NEX-3391 Jan 2020 Jan 2020 One Off
ysyl222.com ysyl222.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
chopchat.com chopchat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
chowderandchampions.com chowderandchampions.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
clevescene.com clevescene.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
AOL AOL-6614 Nov 2019 Nov 2019 One Off
clintonnc.com clintonnc.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 104 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
cnynews.com cnynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
convertfiles.com convertfiles.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
couleeregionsledhockey.com couleeregionsledhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
cricketfox.com cricketfox.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Feb 2020 Feb 2020 One Off
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
cricketpakistan.com.pk cricketpakistan.com.pk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 175 days
NEX NEX-3391 Feb 2020 Feb 2020 One Off
cute2w.in cute2w.in
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Feb 2020 130 days
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
dailyarmy.com dailyarmy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 108 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
dainikgomantak.com dainikgomantak.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 37 days
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
data-base.pro data-base.pro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Dec 2019 64 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dawgpounddaily.com dawgpounddaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
dawindycity.com dawindycity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
deshtv.in deshtv.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 138 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
devilsindetail.com devilsindetail.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
didyouknowfacts.com didyouknowfacts.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 168 days
FWHL FWHL-762737 May 2019 Aug 2019 90 days
dinamalar.com dinamalar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 231 days
IEX IEX-189205 Jul 2019 Feb 2020 210 days
discuss.com.hk discuss.com.hk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
doyouremember.com doyouremember.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 56 days
dupagepistolshrimp.com dupagepistolshrimp.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 8 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
dwmhoa.com dwmhoa.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 181 days
FWHL FWHL-762737 Jun 2019 Aug 2019 56 days
einerd.com.br einerd.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 167 days
IEX IEX-189205 Oct 2019 Feb 2020 131 days
eldestaperadio.com eldestaperadio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 Aug 2019 Aug 2019 6 days
eleconomista.es eleconomista.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 45 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
eleconomistaamerica.cl eleconomistaamerica.cl
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 102 days
FWHL FWHL-762737 Aug 2019 Aug 2019 6 days
eleconomistaamerica.co eleconomistaamerica.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
elheraldo.hn elheraldo.hn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
elkhadra.com elkhadra.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 102 days
IEX IEX-189205 Dec 2019 Feb 2020 71 days
embhl.ca embhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Oct 2019 Mar 2020 166 days
entertainmentdaily.co.uk entertainmentdaily.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 55 days
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
etnet.com.hk etnet.com.hk
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Jan 2020 65 days
PUBM PUBM-158017 Nov 2019 Jan 2020 65 days
expansion.com expansion.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
expertsphp.com expertsphp.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 38 days
IEX IEX-189205 Feb 2020 Feb 2020 3 days
extratimetalk.com extratimetalk.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Feb 2020 193 days
PUBM PUBM-158017 Aug 2019 Feb 2020 190 days
factoryofsadness.co factoryofsadness.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
fashionnewsera.com fashionnewsera.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
followmanga.com followmanga.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 101 days
IEX IEX-189205 Dec 2019 Feb 2020 68 days
foxiauto.com foxiauto.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Dec 2019 124 days
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
galido.net galido.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 36 days
IEX IEX-189205 Feb 2020 Feb 2020 1 day
gameob.com gameob.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Feb 2020 Feb 2020 One Off
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
gbpicsonline.com gbpicsonline.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
gem021.com gem021.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 165 days
IEX IEX-189205 Oct 2019 Feb 2020 131 days
globalgrind.com globalgrind.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
goldengatesports.com goldengatesports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
greatlakesleague.org greatlakesleague.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
FWHL FWHL-762769 Aug 2019 Dec 2019 124 days
gtpositive.com gtpositive.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
IEX IEX-189205 Dec 2019 Feb 2020 65 days
hdtuto.com hdtuto.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Aug 2019 Aug 2019 One Off
helloaberdeen.com helloaberdeen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloalbany.com helloalbany.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloalmadabad.com helloalmadabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloamarillo.com helloamarillo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloannarbor.com helloannarbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloardmore.com helloardmore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloavenal.com helloavenal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobatavia.com hellobatavia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobensenville.com hellobensenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobessemer.com hellobessemer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobismarck.com hellobismarck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobloomington.com hellobloomington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobowie.com hellobowie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobradenton.com hellobradenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobuenapark.com hellobuenapark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocamas.com hellocamas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocedarhill.com hellocedarhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocedarrapids.com hellocedarrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellochandler.com hellochandler.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloclevelandheights.com helloclevelandheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocollegepark.com hellocollegepark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocottagegrove.com hellocottagegrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocudahy.com hellocudahy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodelaware.com hellodelaware.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodenmark.com hellodenmark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Aug 2018 One Off
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellodetroit.com hellodetroit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloeastorange.com helloeastorange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloeldorado.com helloeldorado.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloellensburg.com helloellensburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloelmirage.com helloelmirage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloelsalvador.com helloelsalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloevansville.com helloevansville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofayetteville.com hellofayetteville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloflint.com helloflint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloglendale.com helloglendale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellograyslake.com hellograyslake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogreenbay.com hellogreenbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloguadeloupe.com helloguadeloupe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellogulfshores.com hellogulfshores.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohannibal.com hellohannibal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohattiesburg.com hellohattiesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloherriman.com helloherriman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloholladay.com helloholladay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloindianapolis.com helloindianapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloiowacity.com helloiowacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellojerseycity.com hellojerseycity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloliberal.com helloliberal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolincolnpark.com hellolincolnpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolittleton.com hellolittleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
hellolivermore.com hellolivermore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolosangeles.com hellolosangeles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellolouisiana.com hellolouisiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomanassaspark.com hellomanassaspark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomcallen.com hellomcallen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomendocino.com hellomendocino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomequon.com hellomequon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
hellomethuen.com hellomethuen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellominden.com hellominden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellominnetonka.com hellominnetonka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomountainbrook.com hellomountainbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloneworleans.com helloneworleans.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonicholasville.com hellonicholasville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonorthdakota.com hellonorthdakota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonorthplatte.com hellonorthplatte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonorthsaltlake.com hellonorthsaltlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooaklandpark.com hellooaklandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloogden.com helloogden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooklahoma.com hellooklahoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloouterbanks.com helloouterbanks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloowatonna.com helloowatonna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopampa.com hellopampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopennsylvania.com hellopennsylvania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloperrysburg.com helloperrysburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopetaluma.com hellopetaluma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopoway.com hellopoway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopretoria.com hellopretoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopuertorico.com hellopuertorico.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloranchocucamonga.com helloranchocucamonga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellorhodeisland.com hellorhodeisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloroanoke.com helloroanoke.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorolla.com hellorolla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosaintmaarten.com hellosaintmaarten.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosanfernando.com hellosanfernando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosanfrancisco.com hellosanfrancisco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosantaclarita.com hellosantaclarita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosantafe.com hellosantafe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosartell.com hellosartell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloseattle.com helloseattle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosedalia.com hellosedalia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloseguin.com helloseguin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloslidell.com helloslidell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosoledad.com hellosoledad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosouthdakota.com hellosouthdakota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosouthsanfrancisco.com hellosouthsanfrancisco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellospanishfork.com hellospanishfork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellospartanburg.com hellospartanburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellospringhill.com hellospringhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosuperior.com hellosuperior.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotacoma.com hellotacoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotrenton.com hellotrenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellounionca.com hellounionca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellovirginiausa.com hellovirginiausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellowaco.com hellowaco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestland.com hellowestland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestlinn.com hellowestlinn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestmont.com hellowestmont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowhitefishbay.com hellowhitefishbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowilmette.com hellowilmette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowinona.com hellowinona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowyandotte.com hellowyandotte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloyuba.com helloyuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
heraldspot.com heraldspot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
hhla.ca hhla.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
hip-hopvibe.com hip-hopvibe.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
hiphopnc.com hiphopnc.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
hiplatina.com hiplatina.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 May 2019 Aug 2019 97 days
hket-work.com hket-work.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
IEX IEX-189205 Oct 2019 Feb 2020 128 days
hole-io.com hole-io.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
hoosierstateofmind.com hoosierstateofmind.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
horoscope520.com horoscope520.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 63 days
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
iasexamportal.com iasexamportal.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Feb 2020 188 days
IEX IEX-189205 Aug 2019 Feb 2020 187 days
imleagues.com imleagues.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
FWHL FWHL-762737 May 2019 Aug 2019 96 days
indezine.com indezine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
iranitv.com iranitv.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 221 days
IEX IEX-189205 Aug 2019 Feb 2020 186 days
itsolutionstuff.com itsolutionstuff.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Feb 2020 236 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
java2novice.com java2novice.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 220 days
IEX IEX-189205 Aug 2019 Feb 2020 185 days
jaysjournal.com jaysjournal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
jejakpiknik.com jejakpiknik.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 159 days
IEX IEX-189205 Oct 2019 Feb 2020 124 days
joblo.com joblo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
jobsarkari.com jobsarkari.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Feb 2020 62 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 59 days
kekbfm.com kekbfm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kens5.com kens5.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
kicks105.com kicks105.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kixs.com kixs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
korrespondent.net korrespondent.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 124 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
ktvb.com ktvb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Dec 2019 65 days
FWHL FWHL-762737 May 2019 May 2019 One Off
laprensagrafica.com laprensagrafica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
laraza.com laraza.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
lecap.net lecap.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Feb 2020 181 days
PUBM PUBM-158017 Dec 2019 Mar 2020 90 days
lifeandstylemag.com lifeandstylemag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
lightpollutionmap.info lightpollutionmap.info
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 154 days
IEX IEX-189205 Oct 2019 Feb 2020 119 days
list25.com list25.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
listindiario.com listindiario.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
livemusicblog.com livemusicblog.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
magicbaltimore.com magicbaltimore.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
maharajas-express-india.com maharajas-express-india.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Feb 2020 59 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 53 days
manacinema.com manacinema.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 265 days
IEX IEX-189205 Jun 2019 Feb 2020 230 days
marketrealist.com marketrealist.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Mar 2020 Mar 2020 14 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
massbaychiefs.com massbaychiefs.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 213 days
FWHL FWHL-762737 Jun 2019 Aug 2019 41 days
matadornetwork.com matadornetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
PRIM PRIM-19139 Nov 2019 Mar 2020 110 days
mediotiempo.com mediotiempo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
metacafe.com metacafe.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
mirchistatus.com mirchistatus.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 116 days
FWHL FWHL-762769 Dec 2019 Mar 2020 86 days
mmasucka.com mmasucka.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Aug 2019 51 days
IEX IEX-189205 Jul 2019 Aug 2019 51 days
montevistajournal.com montevistajournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Mar 2020 189 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
mwsoccer.com mwsoccer.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Dec 2019 Feb 2020 57 days
mycleo.tv mycleo.tv
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Oct 2019 62 days
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
myhoustonmajic.com myhoustonmajic.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mypraiseatl.com mypraiseatl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
nbafullhd.com nbafullhd.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Aug 2019 52 days
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
neepawaminorhockey.ca neepawaminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 50 days
FWHL FWHL-762737 May 2019 May 2019 One Off
nfldraftdiamonds.com nfldraftdiamonds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 124 days
ninernoise.com ninernoise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
nlvideo.com nlvideo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Feb 2020 121 days
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
nnshshl.com nnshshl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 163 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
nonilo.com nonilo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 113 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
nvshl.org nvshl.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
nycbl.com nycbl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Feb 2020 121 days
AOL AOL-6614 Dec 2019 Dec 2019 One Off
nymag.com nymag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 198 days
FWHL FWHL-762737 May 2019 Aug 2019 84 days
obsev.com obsev.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B May 2019 May 2019 One Off
odishareporter.in odishareporter.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 175 days
offcampusjobs4u.com offcampusjobs4u.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 112 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
ohahockey.ca ohahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 111 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
okjeffersoncity.com okjeffersoncity.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
okmagazine.com okmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
orient-news.net orient-news.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 81 days
IEX IEX-189205 Dec 2019 Feb 2020 46 days
orlandoweekly.com orlandoweekly.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 104 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
outlookindia.com outlookindia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
FWHL FWHL-762769 Jan 2020 Mar 2020 45 days
pamha.ca pamha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 109 days
AOL AOL-6614 Jan 2020 Jan 2020 One Off
peifootball.ca peifootball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jan 2020 Jan 2020 One Off
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
penslabyrinth.com penslabyrinth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
petawawaminorhockey.ca petawawaminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
AOL AOL-6614 Jan 2020 Jan 2020 One Off
picpug.com picpug.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
pikstagram.org pikstagram.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Aug 2019 Aug 2019 One Off
plainsman.com plainsman.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Mar 2020 293 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
playfa.com playfa.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 144 days
IEX IEX-189205 Oct 2019 Feb 2020 109 days
pokespost.com pokespost.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 200 days
FWHL FWHL-762737 Jul 2019 Aug 2019 35 days
popcrush.com popcrush.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
prajavani.net prajavani.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 172 days
FWHL FWHL-762737 Jul 2019 Aug 2019 34 days
premierballhockey.net premierballhockey.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Jan 2020 129 days
pswolves.com pswolves.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
qqsssj.com qqsssj.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
racer.com racer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
ran-myrosso.com ran-myrosso.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
rochakkhabare.com rochakkhabare.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 204 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 169 days
robesonian.com robesonian.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Sep 2019 Sep 2019 One Off
acrediteounao.com acrediteounao.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 185 days
IEX IEX-189205 Sep 2019 Jan 2020 130 days
rslkings.com rslkings.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 204 days
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
accessauburn.com accessauburn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
rwbhc.co.uk rwbhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
sachhoc.com sachhoc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
safetxt.us safetxt.us
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 140 days
IEX IEX-189205 Nov 2019 Feb 2020 105 days
sailingworld.com sailingworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
adswiki.net adswiki.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
saskballhockey.com saskballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 41 days
scpringette.com scpringette.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 203 days
AOL AOL-6614 Aug 2019 Aug 2019 One Off
setalarmclock.net setalarmclock.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 255 days
IEX IEX-189205 Jul 2019 Feb 2020 220 days
allaboutjazz.com allaboutjazz.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
alladsnetwork.com alladsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 119 days
IEX IEX-189205 Nov 2019 Feb 2020 84 days
altpress.com altpress.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
amongtech.com amongtech.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
IEX IEX-189205 Jul 2019 Jul 2019 One Off
silverbelt.com silverbelt.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Mar 2020 202 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
singletrackworld.com singletrackworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
slambasketball.ca slambasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 202 days
AOL AOL-6614 May 2019 May 2019 One Off
sleafordcc.co.uk sleafordcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
skyelitenews.com skyelitenews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 254 days
IEX IEX-189205 Jul 2019 Feb 2020 219 days
autzenzoo.com autzenzoo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
answertrade.com answertrade.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 118 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 83 days
songtextemania.com songtextemania.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
spikeduppsychedup.com spikeduppsychedup.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
sqsiil.com sqsiil.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
ssbasketball.ca ssbasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 38 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
ssbcrack.com ssbcrack.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 137 days
IEX IEX-189205 Nov 2019 Feb 2020 102 days
asianage.com asianage.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 56 days
0199962.com 0199962.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
statliners.com statliners.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
1073popcrush.com 1073popcrush.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
12up.com 12up.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
streetchopperweb.com streetchopperweb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
studio92.com studio92.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
subject.com.ua subject.com.ua
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 254 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
suntamiltv.net suntamiltv.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
sweetimg.com sweetimg.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Jul 2019 One Off
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
anabelmagazine.com anabelmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 18 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
syriaohr.com syriaohr.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Nov 2019 63 days
PUBM PUBM-158017 Sep 2019 Nov 2019 63 days
astrologycircle.com astrologycircle.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
tasteofcountry.com tasteofcountry.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tchadcarriere.com tchadcarriere.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 50 days
IEX IEX-189205 Jan 2020 Feb 2020 34 days
techdeed.com techdeed.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 69 days
IEX IEX-189205 Jan 2020 Feb 2020 34 days
terrapinstationmd.com terrapinstationmd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
awkward.com awkward.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Aug 2019 14 days
thedailymash.co.uk thedailymash.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
thebuzzcincy.com thebuzzcincy.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
therattrick.com therattrick.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
theodysseyonline.com theodysseyonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
theurbandaily.com theurbandaily.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
throughthephog.com throughthephog.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
tinymixtapes.com tinymixtapes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
torl.ca torl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
torotimes.com torotimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bealestreetbears.com bealestreetbears.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
beamingnotes.com beamingnotes.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
totalprosports.com totalprosports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
bedfordrock.com bedfordrock.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 206 days
AOL AOL-6614 Jun 2019 Jun 2019 One Off
trmzzdg.club trmzzdg.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
tvnotas.com.mx tvnotas.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 114 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 33 days
twgram.me twgram.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Nov 2019 118 days
IEX IEX-189205 Jul 2019 Nov 2019 118 days
twistity.com twistity.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
AOL AOL-6614 Jan 2020 Jan 2020 One Off
uconndoit.com uconndoit.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 May 2019 May 2019 One Off
unionandblue.com unionandblue.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
upbeatnews.com upbeatnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
IEX IEX-189205 Sep 2019 Sep 2019 One Off
upscsuccess.com upscsuccess.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Nov 2019 66 days
PUBM PUBM-158017 Sep 2019 Nov 2019 66 days
usmagazine.com usmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
bitul.in bitul.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 180 days
IEX IEX-189205 Sep 2019 Feb 2020 145 days
valleygardenscc.com valleygardenscc.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Jan 2020 Jan 2020 One Off
value101.net value101.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 65 days
IEX IEX-189205 Jan 2020 Feb 2020 30 days
blackenterprise.com blackenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
blackoutdallas.com blackoutdallas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
bleedinblue.com bleedinblue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
vimeo.com vimeo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
MEDI MEDI-8CU7QPX3O Jan 2020 Jan 2020 One Off
bobshideout.com bobshideout.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
wakeupmrwest.com wakeupmrwest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
warman3on3.com warman3on3.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 29 days
AOL AOL-6614 Jul 2019 Jul 2019 One Off
boxingtribune-news.com boxingtribune-news.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 216 days
FWHL FWHL-762737 Jul 2019 Aug 2019 12 days
westcoastconvo.com westcoastconvo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 56 days
whshl.com whshl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 196 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
wikitelegraph.com wikitelegraph.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Jan 2020 65 days
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
wiltonbulletin.com wiltonbulletin.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bucksphoenixnc.co.uk bucksphoenixnc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
wndietcs.com wndietcs.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Nov 2019 65 days
PUBM PUBM-158017 Sep 2019 Nov 2019 65 days
bulliomvault.com bulliomvault.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Feb 2020 Feb 2020 One Off
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
worldlifestyle.com worldlifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wpgtalkradio.com wpgtalkradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 168 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wsbs.com wsbs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wsrkfm.com wsrkfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 168 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wxq68.com wxq68.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
wynyardminorhockey.ca wynyardminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 148 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
cahlhockey.net cahlhockey.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
careerjobs360.in careerjobs360.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
yeahmotor.com yeahmotor.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
yinbuzz.com yinbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 111 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 26 days
catcrave.com catcrave.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
catholicnewsagency.com catholicnewsagency.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
caughtoffside.com caughtoffside.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cbseportal.com cbseportal.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jul 2019 Feb 2020 200 days
celebjar.com celebjar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 46 days
IEX IEX-189205 Feb 2020 Feb 2020 11 days
celebmafia.com celebmafia.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Jan 2020 215 days
PUBM PUBM-158017 Jun 2019 Jan 2020 215 days
cesarsway.com cesarsway.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cgsentinel.com cgsentinel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Nov 2019 65 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
chocolate.com chocolate.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
chron.com chron.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
churchpop.com churchpop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cinemapettai.com cinemapettai.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Feb 2020 Feb 2020 One Off
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
circuitdigest.com circuitdigest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 217 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 199 days
ciudad.com.ar ciudad.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Sep 2019 Nov 2019 64 days
clickrnews.com clickrnews.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 66 days
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
closerweekly.com closerweekly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
coinagereport.com coinagereport.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Feb 2020 Feb 2020 10 days
courttv.com courttv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 59 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
cpgha.ca cpgha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 184 days
FWHL FWHL-762769 Aug 2019 Sep 2019 49 days
cravecanada.com cravecanada.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 76 days
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
cruisingworld.com cruisingworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
cyahs.club cyahs.club
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 104 days
IEX IEX-189205 Dec 2019 Feb 2020 75 days
dailyconservative.com dailyconservative.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 218 days
NEX NEX-3391 Dec 2019 Feb 2020 56 days
dawnofthedawg.com dawnofthedawg.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
digit.in digit.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
IEX IEX-189205 Jan 2020 Feb 2020 24 days
discordhelp.net discordhelp.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 232 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
diversitybestpractices.com diversitybestpractices.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
divinity.es divinity.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
diyphotography.net diyphotography.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
dnaindia.com dnaindia.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
doctorlib.info doctorlib.info
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 172 days
IEX IEX-189205 Oct 2019 Feb 2020 137 days
drumhellerraptorshockey.com drumhellerraptorshockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Feb 2020 Mar 2020 36 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
dynamitecandy.com dynamitecandy.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 103 days
IEX IEX-189205 Dec 2019 Feb 2020 72 days
eleconomistaamerica.com.ar eleconomistaamerica.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
eleconomistaamerica.com.br eleconomistaamerica.com.br
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
elfarandi.com elfarandi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 92 days
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
eluniversalclasificados.com eluniversalclasificados.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
eluniversaldiario.com eluniversaldiario.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
elyrics.net elyrics.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
esportsx.com esportsx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 55 days
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
ettingersmithmemorial.org ettingersmithmemorial.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 124 days
FWHL FWHL-762769 Aug 2019 Dec 2019 119 days
eyesonisles.com eyesonisles.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
femalefirst.co.uk femalefirst.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
SONO SONO-783272317B Sep 2019 Jan 2020 130 days
filehippo.com filehippo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
filmibeat.com filmibeat.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Feb 2020 24 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
firefaucet.win firefaucet.win
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Dec 2019 124 days
IEX IEX-189205 Dec 2019 Feb 2020 68 days
fishstock.com fishstock.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
fonddulacbears.com fonddulacbears.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
foodchannel.com foodchannel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
fraghero.com fraghero.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 222 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
free-power-point-templates.com free-power-point-templates.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
friarsonbase.com friarsonbase.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
fullmatch24.com fullmatch24.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 35 days
IEX IEX-189205 Feb 2020 Feb 2020 2 days
gamesided.com gamesided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
gcinee.net gcinee.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
gconnect.in gconnect.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 101 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 67 days
geeksided.com geeksided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
getsongbpm.com getsongbpm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 58 days
FWHL FWHL-762737 Jun 2019 Aug 2019 51 days
gmenhq.com gmenhq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
gogram.club gogram.club
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
gohealth01.com gohealth01.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 100 days
IEX IEX-189205 Dec 2019 Feb 2020 66 days
goldandgopher.com goldandgopher.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
govipersgo.com govipersgo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 176 days
AOL AOL-6614 Aug 2019 Aug 2019 One Off
gpucheck.com gpucheck.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 60 days
IEX IEX-189205 Aug 2019 Aug 2019 One Off
graduatez.com graduatez.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 157 days
greatandhra.com greatandhra.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
gridironnewjersey.com gridironnewjersey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
gtaall.com gtaall.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
gtaall.com.br gtaall.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
gtaall.eu gtaall.eu
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 273 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
halifaxhockey.ca halifaxhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 175 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
hardwoodhoudini.com hardwoodhoudini.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
haribhoomi.com haribhoomi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
heatwaved.com heatwaved.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
helloallenpark.com helloallenpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloaltus.com helloaltus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloamorgos.com helloamorgos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloansonia.com helloansonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloartesia.com helloartesia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloaugusta.com helloaugusta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloaurora.com helloaurora.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloavondale.com helloavondale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobali.com hellobali.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellobeautiful.com hellobeautiful.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
NEX NEX-3391 Feb 2020 Feb 2020 One Off
hellobenbrook.com hellobenbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloblacksburg.com helloblacksburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobowlinggreen.com hellobowlinggreen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobrigham.com hellobrigham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobrookpark.com hellobrookpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobrownsville.com hellobrownsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocarmel.com hellocarmel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocasselberry.com hellocasselberry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocaymanislands.com hellocaymanislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellochapelhill.com hellochapelhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocharlottesville.com hellocharlottesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellochinohills.com hellochinohills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellochowchilla.com hellochowchilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocloquet.com hellocloquet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocolombia.com hellocolombia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocoralgables.com hellocoralgables.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocoralsprings.com hellocoralsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocorcoran.com hellocorcoran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodanbury.com hellodanbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodearbornheights.com hellodearbornheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodenver.com hellodenver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellodoral.com hellodoral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloeaglepass.com helloeaglepass.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloeastpeoria.com helloeastpeoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloedinburgh.com helloedinburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloedmonton.com helloedmonton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
helloelmonte.com helloelmonte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloescondido.com helloescondido.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloeuless.com helloeuless.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofairbanks.com hellofairbanks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofalklandislands.com hellofalklandislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloflight.com helloflight.com
Attribute Value First Detected Last Detected Overlap Duration
CONN CONN-102738 Jun 2019 Mar 2020 293 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
helloforestlake.com helloforestlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofortlauderdale.com hellofortlauderdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofranklinpark.com hellofranklinpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogainesville.com hellogainesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogardena.com hellogardena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellograndforks.com hellograndforks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohamlake.com hellohamlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohamtramck.com hellohamtramck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohanahan.com hellohanahan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohialeahgardens.com hellohialeahgardens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohopkinsville.com hellohopkinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohornlake.com hellohornlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohouma.com hellohouma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellojamaica.com hellojamaica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellojohnsoncity.com hellojohnsoncity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellokent.com hellokent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloketchikan.com helloketchikan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellokingman.com hellokingman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloknoxville.com helloknoxville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellokuna.com hellokuna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolafayette.com hellolafayette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolagrande.com hellolagrande.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolamesa.com hellolamesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
hellolancaster.com hellolancaster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolaporte.com hellolaporte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolavergne.com hellolavergne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolawrenceville.com hellolawrenceville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloleesburg.com helloleesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolittlerock.com hellolittlerock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomachesneypark.com hellomachesneypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomauldin.com hellomauldin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomeriden.com hellomeriden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomichigan.com hellomichigan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomontereypark.com hellomontereypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomontserrat.com hellomontserrat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellomoore.com hellomoore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewark.com hellonewark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewberg.com hellonewberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewjersey.com hellonewjersey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewnan.com hellonewnan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewportrichey.com hellonewportrichey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewyork.com hellonewyork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonorthlittlerock.com hellonorthlittlerock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooakforest.com hellooakforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloocala.com helloocala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooceansprings.com hellooceansprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooklahomacity.com hellooklahomacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloorangeburg.com helloorangeburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooshkosh.com hellooshkosh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooxnard.com hellooxnard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopalmbay.com hellopalmbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopalmsprings.com hellopalmsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopanamacity.com hellopanamacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloparagould.com helloparagould.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloparamount.com helloparamount.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopeabody.com hellopeabody.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopeekskill.com hellopeekskill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopensacola.com hellopensacola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopinellaspark.com hellopinellaspark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloportarthur.com helloportarthur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloporthueneme.com helloporthueneme.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloprovidence.com helloprovidence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloredwood.com helloredwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorexburg.com hellorexburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloriverbank.com helloriverbank.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorochester.com hellorochester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorockhill.com hellorockhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorockvillecentre.com hellorockvillecentre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosaintnevis.com hellosaintnevis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosaintvincent.com hellosaintvincent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosalina.com hellosalina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosanantonio.com hellosanantonio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosanjose.com hellosanjose.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosantafesprings.com hellosantafesprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosearcy.com hellosearcy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloseymour.com helloseymour.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosouthgate.com hellosouthgate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellostatecollege.com hellostatecollege.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosteamboatsprings.com hellosteamboatsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosteubenville.com hellosteubenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotaiwan.com hellotaiwan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellotalladega.com hellotalladega.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotampa.com hellotampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotennessee.com hellotennessee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotulare.com hellotulare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellounitedkingdom.com hellounitedkingdom.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellouniversal.com hellouniversal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellouniversitypark.com hellouniversitypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellourbana.com hellourbana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellovaldosta.com hellovaldosta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellovannuys.com hellovannuys.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowakeforest.com hellowakeforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowarwick.com hellowarwick.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestallis.com hellowestallis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestcovina.com hellowestcovina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowesthaven.com hellowesthaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestjordan.com hellowestjordan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowestpoint.com hellowestpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowhitehall.com hellowhitehall.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowichita.com hellowichita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowindsor.com hellowindsor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloyonkers.com helloyonkers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloyorbalinda.com helloyorbalinda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hookemheadlines.com hookemheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
hotbikeweb.com hotbikeweb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
hothiphopdetroit.com hothiphopdetroit.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
hvgbminorsoccer.ca hvgbminorsoccer.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
ibpsguide.com ibpsguide.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Dec 2019 64 days
MEDI MEDI-8CUZ310G2 Oct 2019 Dec 2019 64 days
indiaglitz.com indiaglitz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Jul 2019 Sep 2019 55 days
indiehoy.com indiehoy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 96 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
infoprediksi4d.com infoprediksi4d.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
islands.com islands.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
istory01.com istory01.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 61 days
PUBM PUBM-158017 Feb 2020 Mar 2020 33 days
javaconceptoftheday.com javaconceptoftheday.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 60 days
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
jeevansathi.com jeevansathi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
jobinfoguru.in jobinfoguru.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
kalakkalcinema.com kalakkalcinema.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Feb 2020 237 days
IEX IEX-189205 Jun 2019 Aug 2019 50 days
kemmerergazette.com kemmerergazette.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Mar 2020 269 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
keralakaumudi.com keralakaumudi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 157 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 122 days
kiiitv.com kiiitv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
klapboardpost.com klapboardpost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 121 days
FWHL FWHL-762769 Feb 2020 Mar 2020 31 days
knowyourmeme.com knowyourmeme.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
koolfmabilene.com koolfmabilene.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
ksdk.com ksdk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
laopinion.com laopinion.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
lapatilla.com lapatilla.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
lastwordonrugby.com lastwordonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Dec 2019 177 days
IEX IEX-189205 Jun 2019 Jun 2019 One Off
latestpricealert.com latestpricealert.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Dec 2019 65 days
IEX IEX-189205 Oct 2019 Oct 2019 One Off
laurinburgexchange.com laurinburgexchange.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jan 2020 186 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
lcghl.com lcghl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 118 days
FWHL FWHL-762737 May 2019 Aug 2019 90 days
listenonrepeat.com listenonrepeat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 124 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
lmhockey.com lmhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
lmhtf.com lmhtf.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
lobandsmash.com lobandsmash.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 8 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
loophaiti.com loophaiti.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 153 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 116 days
lyrical-nonsense.com lyrical-nonsense.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 153 days
FWHL FWHL-762737 May 2019 May 2019 One Off
manalokam.com manalokam.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 152 days
IEX IEX-189205 Oct 2019 Feb 2020 117 days
maplestage.com maplestage.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 44 days
IEX IEX-189205 Jan 2020 Feb 2020 23 days
mediotejo.net mediotejo.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 152 days
IEX IEX-189205 Oct 2019 Feb 2020 117 days
meganews.mx meganews.mx
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
NEX NEX-3391 Dec 2019 Dec 2019 One Off
milehighsticking.com milehighsticking.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
milenio.com milenio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
mixtapemonkey.com mixtapemonkey.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Aug 2019 51 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
mmll.ca mmll.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 40 days
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
modernhealth.net modernhealth.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 51 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 51 days
monctonminorhockey.ca monctonminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 165 days
AOL AOL-6614 Feb 2020 Mar 2020 28 days
moodycountyenterprise.com moodycountyenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 311 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
morellmustangs.ca morellmustangs.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Dec 2019 Dec 2019 One Off
motorcyclecruiser.com motorcyclecruiser.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
muscleandfitness.com muscleandfitness.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
musketfire.com musketfire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
muzikum.eu muzikum.eu
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
mydailyviral.com mydailyviral.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 275 days
FWHL FWHL-762769 Aug 2019 Mar 2020 212 days
mynation.com mynation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
FWHL FWHL-762737 May 2019 May 2019 One Off
naidunia.com naidunia.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 57 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
namechk.com namechk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
nbbha.com nbbha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Dec 2019 225 days
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 50 days
ncyfjdyp.cn ncyfjdyp.cn
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
neuquahockey.org neuquahockey.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
newstimes.com newstimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
nnjie.com nnjie.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
nnusc.com nnusc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 210 days
nolanwritin.com nolanwritin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
nsfoa.ca nsfoa.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
nsrjhl.com nsrjhl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 111 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
oldnorthbanter.com oldnorthbanter.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
ootyindia.com ootyindia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Dec 2019 65 days
MEDI MEDI-8CUZ310G2 Oct 2019 Dec 2019 65 days
orlandomagicdaily.com orlandomagicdaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
osbrad.com osbrad.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 46 days
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
oswh.ca oswh.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Oct 2019 114 days
CA CA-PUB-4449341246402301 Jul 2019 Aug 2019 51 days
outdoorlife.com outdoorlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
outinstl.com outinstl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Oct 2019 Oct 2019 One Off
NEX NEX-3391 Dec 2019 Dec 2019 One Off
ringettepei.ca ringettepei.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Mar 2020 205 days
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 158 days
perfil.com perfil.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
phpclasses.org phpclasses.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 244 days
IEX IEX-189205 Jul 2019 Feb 2020 209 days
pilotmountainnews.com pilotmountainnews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Nov 2019 121 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
praisephilly.com praisephilly.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
praiserichmond.com praiserichmond.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
prcmba.ca prcmba.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 45 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
prizegrab.com prizegrab.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Mar 2020 231 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
progolfnow.com progolfnow.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
qaumiawaz.com qaumiawaz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Feb 2020 54 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 43 days
radionowindy.com radionowindy.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
raftaar.in raftaar.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
rasfoiesc.com rasfoiesc.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Feb 2020 107 days
PUBM PUBM-158017 Jan 2020 Mar 2020 77 days
readdetectiveconan.com readdetectiveconan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
readhxh.com readhxh.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
readkingdom.com readkingdom.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Oct 2019 115 days
PUBM PUBM-158017 Jul 2019 Oct 2019 115 days
reckontalk.com reckontalk.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 205 days
IEX IEX-189205 Aug 2019 Feb 2020 170 days
aroundthefoghorn.com aroundthefoghorn.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
rothiracryptowallet.com rothiracryptowallet.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Nov 2019 63 days
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
roxpile.com roxpile.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
achanationals.com achanationals.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 21 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
rslgha.ca rslgha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 May 2019 Dec 2019 204 days
rushthekop.com rushthekop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
sahlonline.ca sahlonline.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
sakalsports.com sakalsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 105 days
FWHL FWHL-762769 Jan 2020 Mar 2020 74 days
sakaltimes.com sakaltimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 168 days
FWHL FWHL-762769 Aug 2019 Jan 2020 129 days
salud180.com salud180.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 175 days
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
samachar.com samachar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 260 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
samacharjagat.com samacharjagat.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 168 days
FWHL FWHL-762769 Feb 2020 Mar 2020 22 days
saturdaydownsouth.com saturdaydownsouth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
MEDI MEDI-8CU7QPX3O Jan 2020 Mar 2020 59 days
scarymommy.com scarymommy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Mar 2020 293 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
scienceintro.com scienceintro.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
NEX NEX-3391 Jan 2020 Jan 2020 One Off
screencrush.com screencrush.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
sfchronicle.com sfchronicle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
alamosanews.com alamosanews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Jan 2020 130 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
ashbridgesvolleyball.com ashbridgesvolleyball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 42 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
allfortennessee.com allfortennessee.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
sickchirpse.com sickchirpse.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
sify.com sify.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Feb 2020 89 days
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
sixpackspeak.com sixpackspeak.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 189 days
andhrajyothy.com andhrajyothy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 106 days
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
soyfutbol.com soyfutbol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 May 2019 Jul 2019 48 days
soytecno.com soytecno.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
sportschatplace.com sportschatplace.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jan 2020 234 days
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
sportskeeda.com sportskeeda.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
IEX IEX-189205 Jul 2019 Jan 2020 186 days
stackovernet.com stackovernet.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 117 days
IEX IEX-189205 Nov 2019 Feb 2020 102 days
stackoverrun.com stackoverrun.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 117 days
IEX IEX-189205 Nov 2019 Feb 2020 102 days
stairwayto11.com stairwayto11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 76 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
1390granitecitysports.com 1390granitecitysports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stwalburghockey.com stwalburghockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
summersideunited.com summersideunited.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 37 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
acidigital.com acidigital.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 66 days
acistampa.com acistampa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 66 days
actitudfem.com actitudfem.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
albat.com albat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 184 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
swzhockey.ca swzhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 28 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
szbjq.com szbjq.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
tabs-database.com tabs-database.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
tamilcrowhd.com tamilcrowhd.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
taskandpurpose.com taskandpurpose.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 56 days
NEX NEX-3391 Dec 2019 Jan 2020 40 days
tellonym.me tellonym.me
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
textnow.com textnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
thegolfnewsnet.com thegolfnewsnet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
thehindubusinessline.com thehindubusinessline.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Jan 2020 Jan 2020 One Off
thepewterplank.com thepewterplank.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
thisisfutbol.com thisisfutbol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
bagshotcc.co.uk bagshotcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 84 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bamahammer.com bamahammer.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
timesleader.com timesleader.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Nov 2019 121 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
timesnowtamil.com timesnowtamil.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 179 days
IEX IEX-189205 Sep 2019 Feb 2020 163 days
timesoccer.com timesoccer.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
IEX IEX-189205 Sep 2019 Sep 2019 One Off
tiny.cc tiny.cc
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
tipchasers.com tipchasers.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Nov 2019 117 days
PUBM PUBM-158017 Jul 2019 Sep 2019 53 days
tokeofthetown.com tokeofthetown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
baseballamerica.com baseballamerica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
toptenz.net toptenz.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
totalsportswire.com totalsportswire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
bcpfa.ca bcpfa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 108 days
AOL AOL-6614 Nov 2019 Nov 2019 One Off
bedequeminorhockey.com bedequeminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 17 days
AOL AOL-6614 Nov 2019 Nov 2019 One Off
tutuapp.me tutuapp.me
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 114 days
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 97 days
bet-boom294.com bet-boom294.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
ukulele-tabs.com ukulele-tabs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
NEX NEX-3391 Jan 2020 Feb 2020 24 days
uwants.com uwants.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 274 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
uwants.net uwants.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
blabber.buzz blabber.buzz
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 49 days
IEX IEX-189205 Feb 2020 Feb 2020 14 days
venomstrikes.com venomstrikes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
blackandteal.com blackandteal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
vika-ag.com vika-ag.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
IEX IEX-189205 Nov 2019 Nov 2019 One Off
wakeboardingmag.com wakeboardingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wamha.ca wamha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
wco.tv wco.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Jan 2020 64 days
PUBM PUBM-158017 Nov 2019 Jan 2020 64 days
wealthtl.com wealthtl.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
break.com break.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
breatheheavy.com breatheheavy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
brokensilenze.net brokensilenze.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
bsebportal.com bsebportal.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Feb 2020 131 days
PUBM PUBM-158017 Nov 2019 Mar 2020 114 days
witl.com witl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wltx.com wltx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
wokesloth.com wokesloth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 127 days
AOL AOL-6614 May 2019 May 2019 One Off
wpdh.com wpdh.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
business-standard.com business-standard.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
wynncash11.com wynncash11.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Nov 2019 65 days
PUBM PUBM-158017 Sep 2019 Nov 2019 65 days
buzzworthy.com buzzworthy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
byacoedsoftballtournament.com byacoedsoftballtournament.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Feb 2020 177 days
xmenfansite.com xmenfansite.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Mar 2020 192 days
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
caneswarning.com caneswarning.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
canveyislandfc.com canveyislandfc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
yeah1music.net yeah1music.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 126 days
IEX IEX-189205 Nov 2019 Feb 2020 91 days
casebriefs.com casebriefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
cbcmha.ca cbcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 78 days
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
zetarepublic.com zetarepublic.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Mar 2020 190 days
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
zodiac168.com zodiac168.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 46 days
IEX IEX-189205 Jan 2020 Feb 2020 25 days
zodiacsigns-horoscope.com zodiacsigns-horoscope.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
clik.pw clik.pw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
clubvitaleu.com clubvitaleu.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
cnhockey.com cnhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 184 days
AOL AOL-6614 Jun 2019 Dec 2019 172 days
components101.com components101.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 248 days
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
cosmicbook.news cosmicbook.news
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 268 days
IEX IEX-189205 Jun 2019 Feb 2020 239 days
coveralia.com coveralia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
NEX NEX-3391 Jan 2020 Jan 2020 One Off
csmba.ca csmba.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 123 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
cuatro.com cuatro.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
cubaheadlines.com cubaheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Feb 2020 66 days
FWHL FWHL-762737 Jun 2019 Aug 2019 58 days
cumberlandminorhockey.ca cumberlandminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 316 days
FWHL FWHL-762737 Aug 2019 Aug 2019 9 days
czattcn.com czattcn.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 66 days
PUBM PUBM-158017 Dec 2019 Feb 2020 66 days
diabeteshealthpage.com diabeteshealthpage.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 173 days
IEX IEX-189205 Sep 2019 Sep 2019 One Off
diario.mx diario.mx
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
doctorwhowatch.com doctorwhowatch.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
dorksideoftheforce.com dorksideoftheforce.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
dunyanews.tv dunyanews.tv
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
NEX NEX-3391 Jan 2020 Jan 2020 One Off
ealingcc.co.uk ealingcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
SONO SONO-783272317B May 2019 Jun 2019 42 days
eastcoastdaily.com eastcoastdaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 36 days
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 5 days
economiahoy.mx economiahoy.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
FWHL FWHL-762769 Feb 2020 Mar 2020 36 days
edexlive.com edexlive.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Feb 2020 131 days
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
edmhunters.com edmhunters.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Feb 2020 131 days
PUBM PUBM-158017 Oct 2019 Feb 2020 131 days
ehow.co.uk ehow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
ehpenguins.org ehpenguins.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 131 days
AOL AOL-6614 May 2019 Aug 2019 92 days
eightcount.tv eightcount.tv
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 5 days
NEX NEX-3391 Feb 2020 Feb 2020 One Off
elbotiquin.mx elbotiquin.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 118 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
elcolombiano.com elcolombiano.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
elcomercio.com elcomercio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
eldestapeweb.com eldestapeweb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
eldiariodechihuahua.mx eldiariodechihuahua.mx
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
eleconomista.com.mx eleconomista.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 166 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
eleconomista.net eleconomista.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 220 days
FWHL FWHL-762737 Aug 2019 Aug 2019 6 days
elkintribune.com elkintribune.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jul 2019 48 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
eltiempohoy.es eltiempohoy.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 55 days
FWHL FWHL-762769 Aug 2019 Oct 2019 54 days
emailondeck.com emailondeck.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
enpareja.com enpareja.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Aug 2019 5 days
ensaz.com ensaz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Aug 2019 45 days
PUBM PUBM-158017 Jun 2019 Aug 2019 45 days
ensiklopediya.az ensiklopediya.az
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
enufh.com enufh.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
espn1420.com espn1420.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
examveda.com examveda.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Dec 2019 169 days
PUBM PUBM-158017 Jun 2019 Dec 2019 169 days
excellup.com excellup.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 23 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
feedclub.com.br feedclub.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 168 days
IEX IEX-189205 Dec 2019 Feb 2020 67 days
femalehockeychallenge.com femalehockeychallenge.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Oct 2019 154 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
fightful.com fightful.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Aug 2019 Mar 2020 227 days
fightinggobbler.com fightinggobbler.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
fightmatrix.com fightmatrix.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 3 days
IEX IEX-189205 Aug 2019 Aug 2019 One Off
flyershockey.ca flyershockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
folkestonerugbyclub.co.uk folkestonerugbyclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 50 days
SONO SONO-783272317B May 2019 Jun 2019 45 days
foodsided.com foodsided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
heraldnet.com heraldnet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
fullmatchesandshows.com fullmatchesandshows.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Oct 2019 Oct 2019 One Off
funsubstance.com funsubstance.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 120 days
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
gamingsym.com gamingsym.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 2 days
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
ghafla.com ghafla.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 100 days
IEX IEX-189205 Dec 2019 Feb 2020 66 days
gifimage.net gifimage.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 165 days
IEX IEX-189205 Oct 2019 Feb 2020 131 days
gildshire.com gildshire.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 100 days
IEX IEX-189205 Dec 2019 Feb 2020 65 days
glacierpilots.com glacierpilots.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 2 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
gmcacsports.org gmcacsports.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 51 days
AOL AOL-6614 Feb 2020 Mar 2020 35 days
gnashockey.com gnashockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Jun 2019 Jun 2019 One Off
gojhl.ca gojhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 126 days
FWHL FWHL-762737 May 2019 Aug 2019 98 days
goneoutdoors.com goneoutdoors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 97 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 66 days
grab4d.net grab4d.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
gshlonline.ca gshlonline.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 222 days
AOL AOL-6614 Mar 2020 Mar 2020 One Off
guiadecocinafacil.com guiadecocinafacil.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 223 days
FWHL FWHL-762737 Aug 2019 Aug 2019 1 day
hadd.world hadd.world
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
hancinema.net hancinema.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Feb 2020 154 days
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
happydays365.org happydays365.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
hawkeyenation.com hawkeyenation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 189 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
helloagawam.com helloagawam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloalabamausa.com helloalabamausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloalexandria.com helloalexandria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloaltamontesprings.com helloaltamontesprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloandover.com helloandover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloarizona.com helloarizona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloauburnhills.com helloauburnhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloavonlake.com helloavonlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobeaumont.com hellobeaumont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobellaire.com hellobellaire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobenicia.com hellobenicia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobeverlyhills.com hellobeverlyhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobocaraton.com hellobocaraton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobolivia.com hellobolivia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloboston.com helloboston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobrooklynpark.com hellobrooklynpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellobuffalo.com hellobuffalo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloburlingame.com helloburlingame.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocathedral.com hellocathedral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocarrboro.com hellocarrboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocedarcity.com hellocedarcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocedarpark.com hellocedarpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellochampaign.com hellochampaign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloclearwater.com helloclearwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloclemson.com helloclemson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocoloradospings.com hellocoloradospings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Sep 2018 38 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellocolumbiaheights.com hellocolumbiaheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocrowley.com hellocrowley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellocrownpoint.com hellocrownpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodayton.com hellodayton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodaytona.com hellodaytona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodeserthotsprings.com hellodeserthotsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodesmoines.com hellodesmoines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodominicanrepublic.com hellodominicanrepublic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellodover.com hellodover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloduncan.com helloduncan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodurham.com hellodurham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellodyersburg.com hellodyersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloearth.com helloearth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 May 2019 Dec 2019 223 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloeastlake.com helloeastlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloedenprairie.com helloedenprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloelgin.com helloelgin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloelmwoodpark.com helloelmwoodpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloennis.com helloennis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloerie.com helloerie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloerlanger.com helloerlanger.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
helloforestpark.com helloforestpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofortcollins.com hellofortcollins.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofortmyers.com hellofortmyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofortworth.com hellofortworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellofrontroyal.com hellofrontroyal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogarfieldheights.com hellogarfieldheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogarland.com hellogarland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogeorgia.com hellogeorgia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogolden.com hellogolden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogreensboro.com hellogreensboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellogreenville.com hellogreenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohamilton.com hellohamilton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloharrisburg.com helloharrisburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohomerglen.com hellohomerglen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohopewell.com hellohopewell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellohouston.com hellohouston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloithaca.com helloithaca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellojacksonhole.com hellojacksonhole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellojenks.com hellojenks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellojoplin.com hellojoplin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellojordan.com hellojordan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellokansascity.com hellokansascity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellokenya.com hellokenya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokilleen.com hellokilleen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolakeforest.com hellolakeforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolakeinthehills.com hellolakeinthehills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolakeland.com hellolakeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolaquinta.com hellolaquinta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloleessummit.com helloleessummit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolindenhurst.com hellolindenhurst.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolomalinda.com hellolomalinda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellolondon.com hellolondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolynwood.com hellolynwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomandeville.com hellomandeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomanteca.com hellomanteca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomarietta.com hellomarietta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomarinette.com hellomarinette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomassachusetts.com hellomassachusetts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomedina.com hellomedina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomesa.com hellomesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomidland.com hellomidland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomilwaukie.com hellomilwaukie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellominnesota.com hellominnesota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomiramar.com hellomiramar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomoseslake.com hellomoseslake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomosspoint.com hellomosspoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomuncie.com hellomuncie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellomurrieta.com hellomurrieta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonampa.com hellonampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonaples.com hellonaples.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewhaven.com hellonewhaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonewhope.com hellonewhope.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonorthcarolina.com hellonorthcarolina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonorthogden.com hellonorthogden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellonorway.com hellonorway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Sep 2018 38 days
hellooakpark.com hellooakpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloohio.com helloohio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooran.com hellooran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloorangecounty.com helloorangecounty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellooverlandpark.com hellooverlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopainesville.com hellopainesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopalatine.com hellopalatine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloparkforest.com helloparkforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopassaic.com hellopassaic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellopflugerville.com hellopflugerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
hellophoenix.com hellophoenix.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellopierre.com hellopierre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloplover.com helloplover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
hellopomona.com hellopomona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloportland.com helloportland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloprichard.com helloprichard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloradford.com helloradford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorichfield.com hellorichfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorosemount.com hellorosemount.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellorwanda.com hellorwanda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosaintmartin.com hellosaintmartin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Aug 2018 One Off
hellosanibelisland.com hellosanibelisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloscarsdale.com helloscarsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosebastian.com hellosebastian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosheboygan.com hellosheboygan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloshelbyville.com helloshelbyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosherman.com hellosherman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosouthsaltlake.com hellosouthsaltlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellostafford.com hellostafford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellostudiocity.com hellostudiocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosugarland.com hellosugarland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellosunlandpark.com hellosunlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotallahassee.com hellotallahassee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotarponsprings.com hellotarponsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotempe.com hellotempe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotexarkana.com hellotexarkana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellothecolony.com hellothecolony.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotualatin.com hellotualatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotullahoma.com hellotullahoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellotwentyninepalms.com hellotwentyninepalms.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
helloutica.com helloutica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowatauga.com hellowatauga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowauwatosa.com hellowauwatosa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowhitebearlake.com hellowhitebearlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hellowoodland.com hellowoodland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 68 days
helloworcester.com helloworcester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
GTM GTM-UA-118163407-2 Aug 2018 Nov 2018 92 days
hmtvlive.com hmtvlive.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 223 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 188 days
hockeybuzz.com hockeybuzz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Mar 2020 321 days
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 112 days
hot963.com hot963.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
howlinhockey.com howlinhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
humansoftumblr.com humansoftumblr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
icloudconfigure10.net icloudconfigure10.net
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Jun 2019 One Off
PUBM PUBM-158017 Jun 2019 Jun 2019 One Off
icshl.org icshl.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jan 2020 Jan 2020 One Off
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
imagenradio.com.mx imagenradio.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 96 days
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
imgrumsite.com imgrumsite.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 161 days
IEX IEX-189205 Oct 2019 Feb 2020 126 days
insidetheiggles.com insidetheiggles.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
instagimg.com instagimg.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Aug 2019 50 days
PUBM PUBM-158017 Jun 2019 Aug 2019 50 days
iqhockey.ca iqhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Oct 2019 162 days
FWHL FWHL-762737 Jun 2019 Aug 2019 47 days
irctchelp.in irctchelp.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Feb 2020 127 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 125 days
irlamvale.co.uk irlamvale.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
iwkprohockeydraft.com iwkprohockeydraft.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 172 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
jantakiawaz.org jantakiawaz.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 185 days
FWHL FWHL-762769 Dec 2019 Mar 2020 95 days
jobalerthindi.com jobalerthindi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 123 days
FWHL FWHL-762769 Feb 2020 Mar 2020 32 days
jobschat.in jobschat.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 59 days
FWHL FWHL-762769 Feb 2020 Mar 2020 32 days
jobtapu.com jobtapu.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Aug 2019 50 days
PUBM PUBM-158017 Jun 2019 Aug 2019 50 days
jsclasses.org jsclasses.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 219 days
IEX IEX-189205 Aug 2019 Feb 2020 184 days
juneauempire.com juneauempire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 59 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
justblogbaby.com justblogbaby.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
jyghxsm.com jyghxsm.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Dec 2019 6 days
AOL AOL-6614 Aug 2019 Aug 2019 One Off
kagstv.com kagstv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
katsfm.com katsfm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kbxhockey.com kbxhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 58 days
FWHL FWHL-762737 May 2019 May 2019 One Off
kcentv.com kcentv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 131 days
FWHL FWHL-762737 Jun 2019 Aug 2019 45 days
kckingdom.com kckingdom.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
keepingitheel.com keepingitheel.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
khppf.com khppf.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 92 days
IEX IEX-189205 Dec 2019 Feb 2020 57 days
kmmohockey.org kmmohockey.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
kolkata24x7.com kolkata24x7.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 121 days
FWHL FWHL-762769 Feb 2020 Mar 2020 31 days
kora-star.tv kora-star.tv
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Oct 2019 62 days
PUBM PUBM-158017 Aug 2019 Oct 2019 62 days
kul.vn kul.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 91 days
IEX IEX-189205 Dec 2019 Feb 2020 56 days
lady67s.ca lady67s.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
AOL AOL-6614 Feb 2020 Feb 2020 One Off
lasportshub.com lasportshub.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
lessdebt.com lessdebt.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 154 days
IEX IEX-189205 Oct 2019 Feb 2020 119 days
lfg.co lfg.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Dec 2019 64 days
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
lfgcomic.com lfgcomic.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
SONO SONO-783272317B Jan 2020 Jan 2020 One Off
livingsharp.com livingsharp.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 266 days
IEX IEX-189205 Jun 2019 Feb 2020 231 days
loopslu.com loopslu.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 215 days
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 116 days
lovebackyard.com lovebackyard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
lssgame.com lssgame.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 60 days
IEX IEX-189205 Dec 2019 Feb 2020 54 days
lwofs.com lwofs.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Mar 2020 266 days
IEX IEX-189205 Jun 2019 Feb 2020 231 days
makingstarwars.net makingstarwars.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 278 days
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 260 days
maroonandwhitenation.com maroonandwhitenation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
miramichiunited.ca miramichiunited.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 52 days
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
mtmad.es mtmad.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 39 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
musc.ca musc.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 139 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
musselburghathleticfc.co.uk musselburghathleticfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
myha.org myha.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 211 days
FWHL FWHL-762769 Aug 2019 Feb 2020 185 days
myjoyonline.com myjoyonline.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
mymajicdc.com mymajicdc.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
nbcmhl.ca nbcmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 112 days
AOL AOL-6614 Aug 2019 Aug 2019 One Off
nbfoa.ca nbfoa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
AOL AOL-6614 Jul 2019 Jul 2019 One Off
niadd.com niadd.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 211 days
IEX IEX-189205 Aug 2019 Feb 2020 176 days
notepad-plus-plus.org notepad-plus-plus.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 124 days
IEX IEX-189205 Nov 2019 Feb 2020 89 days
nsmmaaahl.ca nsmmaaahl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
AOL AOL-6614 Dec 2019 Dec 2019 One Off
oldielyrics.com oldielyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 189 days
NEX NEX-3391 Dec 2019 Feb 2020 64 days
onlymyhealth.com onlymyhealth.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
IEX IEX-189205 Nov 2019 Nov 2019 One Off
ourmidland.com ourmidland.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
oyenminorhockey.com oyenminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
AOL AOL-6614 Aug 2019 Aug 2019 One Off
pcpitstop.nl pcpitstop.nl
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
pcrecordtimes.com pcrecordtimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Nov 2019 Mar 2020 124 days
AOL AOL-6748 Aug 2019 Aug 2019 One Off
pembinavalleymha.com pembinavalleymha.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Aug 2019 114 days
AOL AOL-6614 Jan 2020 Jan 2020 One Off
phlaleagues.ca phlaleagues.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 47 days
AOL AOL-6614 Feb 2020 Feb 2020 One Off
pikdo.one pikdo.one
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
IEX IEX-189205 Jul 2019 Jul 2019 One Off
pistonpowered.com pistonpowered.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
pngimage.net pngimage.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 259 days
IEX IEX-189205 Jul 2019 Feb 2020 224 days
poresto.net poresto.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-6614 Nov 2019 Nov 2019 One Off
powder.com powder.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
praisecharlotte.com praisecharlotte.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
predlines.com predlines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
predominantlyorange.com predominantlyorange.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
radaronline.com radaronline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
radiopup.com radiopup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
rajasthankhabre.com rajasthankhabre.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 171 days
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
rcunited.ca rcunited.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jan 2020 Feb 2020 54 days
FWHL FWHL-762769 Aug 2019 Aug 2019 19 days
referatele.com referatele.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 205 days
IEX IEX-189205 Oct 2019 Jan 2020 66 days
repairmymobile.in repairmymobile.in
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Feb 2020 107 days
PUBM PUBM-158017 Jan 2020 Mar 2020 76 days
reportingkc.com reportingkc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 201 days
FWHL FWHL-762737 Jul 2019 Aug 2019 33 days
rihannasnavy.com rihannasnavy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 80 days
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
rinkroyalty.com rinkroyalty.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 48 days
ripbladehockeyeast.com ripbladehockeyeast.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 205 days
AOL AOL-6614 Jan 2020 Feb 2020 53 days
abnormalreturns.com abnormalreturns.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
apptrigger.com apptrigger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
rmev.cn rmev.cn
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Nov 2019 63 days
rochesterrams.org rochesterrams.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
rock967online.com rock967online.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
romewolvesathletics.com romewolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 119 days
aberystwythleague.co.uk aberystwythleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 32 days
rollingstone.com rollingstone.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
achahockey.org achahockey.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jan 2020 Mar 2020 45 days
acpathletics.com acpathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
actionsportstoday.com actionsportstoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jan 2020 235 days
acadianapostgame.com acadianapostgame.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
rubiconownersforum.com rubiconownersforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rugbyonslaught.com rugbyonslaught.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Mar 2020 75 days
rugerpistolforums.com rugerpistolforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ruathletics.com ruathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
russellvilleathletics.com russellvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
rvathletics.com rvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
saab92x.com saab92x.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
aciprensa.com aciprensa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
saladoeaglenation.org saladoeaglenation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
salemathletics.com salemathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 118 days
salemathletics.org salemathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 118 days
samandfuzzy.com samandfuzzy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
adminkali.xyz adminkali.xyz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 12 days
sanlian0898.com sanlian0898.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
advancedsportsmedia.com advancedsportsmedia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 85 days
santabanta.com santabanta.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Jan 2020 130 days
santacruzsentinel.com santacruzsentinel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
santafeforums.com santafeforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
saskatoontouchfootball.com saskatoontouchfootball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Feb 2020 Feb 2020 One Off
saskatoonwild.com saskatoonwild.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
savingcountrymusic.com savingcountrymusic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
sci-techmaven.io sci-techmaven.io
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
sciencealert.com sciencealert.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
sciencetimes.com sciencetimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
scoopduck.com scoopduck.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 200 days
scottbulldogs.org scottbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
scseaglenation.com scseaglenation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 117 days
sdfpl.co.uk sdfpl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
aggieathletics.org aggieathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 56 days
ahoramismo.com ahoramismo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
ahgstats.com ahgstats.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
secretui.com secretui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 267 days
sebeka-trojans.com sebeka-trojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Nov 2019 64 days
secondnexus.com secondnexus.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
akwesasneminorlacrosse.com akwesasneminorlacrosse.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 142 days
akronnewsreporter.com akronnewsreporter.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
sepiratesathletics.com sepiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
sfasawmill.com sfasawmill.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 182 days
alaskabaseballleague.org alaskabaseballleague.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 20 days
sgvtribune.com sgvtribune.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
shebeigongsi.com shebeigongsi.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
allfreecopycatrecipes.com allfreecopycatrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allfreeholidaycrafts.com allfreeholidaycrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allfreesewing.com allfreesewing.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
albumoftheyear.org albumoftheyear.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
allwrestling.com allwrestling.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
siennachat.com siennachat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sicem365.com sicem365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 201 days
simplycrochetmag.co.uk simplycrochetmag.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
simplysewingmag.com simplysewingmag.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 184 days
siouxcityjournal.com siouxcityjournal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
americanthinker.com americanthinker.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
sjjhl.ca sjjhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Sep 2019 52 days
sjraidersathletics.com sjraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
anroll.net anroll.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 17 days
ans-wer.com ans-wer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
slatedroid.com slatedroid.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
armtv.org armtv.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 118 days
anfieldindex.com anfieldindex.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
anfieldleague.co.uk anfieldleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 204 days
slwceaglenationathletics.com slwceaglenationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 117 days
animalchannel.co animalchannel.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
smfsports.com smfsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
smnwcougars.com smnwcougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 233 days
animescx.org animescx.org
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 18 days
smokingmeatforums.com smokingmeatforums.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
snowmobileworld.com snowmobileworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
soapoperadigest.com soapoperadigest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
sojo1049.com sojo1049.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
solsticeforum.com solsticeforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
soobluedevils.com soobluedevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
sonerai.net sonerai.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 137 days
specktra.net specktra.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
sparktalk.com sparktalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
spartanation300.com spartanation300.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
sportbikes.com sportbikes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
splitsider.com splitsider.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
spnhunters.com spnhunters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 77 days
sportressofblogitude.com sportressofblogitude.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
sportsgrid.com sportsgrid.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
sportsradio1250.com sportsradio1250.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
springlakeathletics.com springlakeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 117 days
spstallions.com spstallions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 120 days
spudnet.co spudnet.co
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Jan 2020 66 days
sputnamathletics.com sputnamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 182 days
artfullywed.com artfullywed.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
staffordshirecsl.co.uk staffordshirecsl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 100 days
arvadawestsports.com arvadawestsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 122 days
1039thebreezealbany.com 1039thebreezealbany.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
103wjod.com 103wjod.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stcharlessports.com stcharlessports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
stdrivers.co.uk stdrivers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
10thtyper.com 10thtyper.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
1280ksli.com 1280ksli.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
stvmathletics.com stvmathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
abplive.com abplive.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 12 days
suitlandathletics.com suitlandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
adjfa.org.uk adjfa.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 268 days
summerfieldathletics.com summerfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
allfreecrochetafghanpatterns.com allfreecrochetafghanpatterns.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
alternet.org alternet.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
swagvilla.com swagvilla.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Feb 2020 239 days
swarmandsting.com swarmandsting.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
suzuki-forums.com suzuki-forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
suzuki-forums.net suzuki-forums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
suzukiatvforums.com suzukiatvforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
svcardinals.com svcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
svhsathletics.org svhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
sweetyhigh.com sweetyhigh.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
swellinfo.com swellinfo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
androidpit.de androidpit.de
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
synonym.com synonym.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
szglhssy.com szglhssy.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
syracusetitansstrong.com syracusetitansstrong.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 116 days
tailieu.vn tailieu.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
taftathletics.com taftathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 180 days
taftraiderathletics.com taftraiderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 180 days
takmp3.com takmp3.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
taopjw.com taopjw.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
astrologyanswers.com astrologyanswers.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
astucesympa.com astucesympa.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
atascaderonews.com atascaderonews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 104 days
taylortitansathletics.com taylortitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 180 days
atlasetut.com atlasetut.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
tctrojanpride.com tctrojanpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 117 days
atv.com atv.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
atvinsurance.com atvinsurance.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
techienewsnetwork.com techienewsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
techsupportforum.com techsupportforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
techz.vn techz.vn
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
tecumsehathletics.com tecumsehathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
telemundoindy.com telemundoindy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
telemundowi.com telemundowi.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 116 days
telva.com telva.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 205 days
telecinco.es telecinco.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
templetonlife.com templetonlife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Nov 2019 Mar 2020 135 days
auxiliaryconstable.com auxiliaryconstable.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 16 days
texags.com texags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Nov 2019 150 days
avilabeachlifenews.com avilabeachlifenews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jun 2019 One Off
tfln.co tfln.co
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Nov 2019 63 days
tfpdl.live tfpdl.live
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tfpdl.pw tfpdl.pw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tfpdl.to tfpdl.to
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tgqhj.com tgqhj.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thedieselgarage.com thedieselgarage.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
aynorbluejackets.net aynorbluejackets.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 57 days
theclemsoninsider.com theclemsoninsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
theclintonjournal.com theclintonjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Mar 2020 292 days
thecomplexii.com thecomplexii.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
azbasszone.com azbasszone.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thegoatspot.net thegoatspot.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
thefader.com thefader.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
thegalaxytabforum.com thegalaxytabforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thehealthsite.com thehealthsite.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
thehuddle.com thehuddle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
babesbikesrods.com babesbikesrods.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 106 days
babygaga.com babygaga.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
thepaw.com thepaw.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thepoliticalinsider.com thepoliticalinsider.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
therockofrochester.com therockofrochester.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thesaurus.net thesaurus.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
thescooterreview.com thescooterreview.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thesportster.com thesportster.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 14 days
thestokesnews.com thestokesnews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Nov 2019 65 days
theworldlink.com theworldlink.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Nov 2019 121 days
thethao247.vn thethao247.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
ballparksofbaseball.com ballparksofbaseball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
thsathletics.org thsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
bandamax.tv bandamax.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
tigardtigers.com tigardtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
tigerbait.com tigerbait.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 206 days
tips-and-tricks.co tips-and-tricks.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
tipsandtricks.ru tipsandtricks.ru
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
tiptonathletics.com tiptonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
timesherald.com timesherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
tintucbaomoi.net tintucbaomoi.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tlhannasports.com tlhannasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
bathcountyathletics.com bathcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
bayart.org bayart.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 50 days
baycitywesternathletics.com baycitywesternathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
topclassactions.com topclassactions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
total49ers.com total49ers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalbig12.com totalbig12.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 206 days
totalbulls.com totalbulls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 251 days
totaldallascowboys.com totaldallascowboys.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 256 days
totaldevils.com totaldevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalfightingirish.com totalfightingirish.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Mar 2020 68 days
totalhawks.com totalhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Nov 2019 64 days
totalmavericks.com totalmavericks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
totalmonarchs.com totalmonarchs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalnewswire.com totalnewswire.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
totalredsox.com totalredsox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalseahawks.com totalseahawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
totalsox.com totalsox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalutahjazz.com totalutahjazz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
torah.org torah.org
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
beatgogo.es beatgogo.es
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
beatgogo.se beatgogo.se
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
toyotanation.com toyotanation.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
beatingbroke.com beatingbroke.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
beedzp.com beedzp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
tribune.com.pk tribune.com.pk
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
trillmag.com trillmag.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 32 days
trojanpride.net trojanpride.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
trx450rforum.com trx450rforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
benzforum.com benzforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
benzinga.com benzinga.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 110 days
tsmdev1.com tsmdev1.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tsmdev3.com tsmdev3.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tsmguestwriters.com tsmguestwriters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
berkeleystagsathletics.com berkeleystagsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 66 days
bersapistolforum.com bersapistolforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
besthealthmag.ca besthealthmag.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tvhsgoldenbearathletics.com tvhsgoldenbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
tvmaze.com tvmaze.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 64 days
tvplayer.com tvplayer.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
twinfinite.net twinfinite.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
twolvesathletics.com twolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
tzr.io tzr.io
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
ucityathletics.com ucityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 54 days
bglancers.com bglancers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
uhstitansathletics.com uhstitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
uintacountyherald.com uintacountyherald.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jan 2020 186 days
ukulele-chords.com ukulele-chords.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
bhssports.com bhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
umtata.cn umtata.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ultimateaircooled.com ultimateaircooled.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ultimatemetallica.com ultimatemetallica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
uncached.com uncached.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Jan 2020 231 days
uni-watch.com uni-watch.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
bigfrog104.com bigfrog104.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
uniondailytimes.com uniondailytimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Nov 2019 169 days
bikeradar.com bikeradar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
billboard.com billboard.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
unpuzzlefinance.com unpuzzlefinance.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 96 days
billingsgazette.com billingsgazette.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
uprepathletics.net uprepathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
uptotheminutemen.com uptotheminutemen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 73 days
usaclaytargetforum.com usaclaytargetforum.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
usssalive.com usssalive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
bismarcktribune.com bismarcktribune.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
bizcritics.com bizcritics.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
bizfluent.com bizfluent.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Sep 2019 142 days
vandaliabutlerathletics.com vandaliabutlerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
vattistore.com vattistore.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
velosterturbo.org velosterturbo.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
veranotalk.com veranotalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
blic.rs blic.rs
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
vfathletics.com vfathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
vgchartz.com vgchartz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
vicksburgpost.com vicksburgpost.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 30 days
vidaprimo.com vidaprimo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
vikingforum.org vikingforum.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bmw-driver.net bmw-driver.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bmwlt.com bmwlt.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
volusiariders.com volusiariders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vrwolvesathletics.com vrwolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
vseries.net vseries.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
boilingwithbias.com boilingwithbias.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 13 days
vtxoa.com vtxoa.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vuighe.net vuighe.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 17 days
waggenerathletics.com waggenerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
gunboards.com gunboards.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
waldronathletics.com waldronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
bongda24h.vn bongda24h.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
wammnation.com wammnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wapahaniathletics.com wapahaniathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wasatchhighathletics.com wasatchhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
boredomtherapy.com boredomtherapy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
wbathletics.org wbathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
bossip.com bossip.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
boston.com boston.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
wcyy.com wcyy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wchram.com wchram.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wcsramsathletics.com wcsramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Nov 2019 65 days
wauseonsports.org wauseonsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
waynedaleathletics.com waynedaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
weaponsmedia.com weaponsmedia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 48 days
bouldercityathletics.com bouldercityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 131 days
weareauburndaleathletics.com weareauburndaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
weartesters.com weartesters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
wdhifm.com wdhifm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
boxer-dog.org boxer-dog.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bradybulldogs.com bradybulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 66 days
brainfall.com brainfall.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
weldcentralrebels.com weldcentralrebels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
brewersfriend.com brewersfriend.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
brewtonstandard.com brewtonstandard.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
bridgendanddistrictsfl.co.uk bridgendanddistrictsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 274 days
westashleyathletics.org westashleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
wghathletics.org wghathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
wexfordsoccer.ca wexfordsoccer.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
whodoyouthinkyouarelive.com whodoyouthinkyouarelive.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
winamacathletics.com winamacathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
winonadailynews.com winonadailynews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
wittyfeed.tv wittyfeed.tv
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
wittylady.com wittylady.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 63 days
wizardsandwhatnot.com wizardsandwhatnot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
wlathletics.com wlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
buggynews.com buggynews.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wll.pw wll.pw
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 196 days
wmcsports.org wmcsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wnbf.com wnbf.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wnhsathletics.com wnhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wokq.com wokq.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wolbbaltimore.com wolbbaltimore.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 28 days
bullnettlenews.com bullnettlenews.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bumblebeenation.com bumblebeenation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 123 days
woodburnbulldogs.com woodburnbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
woodhavenathletics.com woodhavenathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
burlingameathletics.com burlingameathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
burlington-record.com burlington-record.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
worldofsolitaire.com worldofsolitaire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
worldometers.info worldometers.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
wossmanwildcatsathletics.com wossmanwildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wowbiz.ro wowbiz.ro
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
wowinterface.com wowinterface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
wranglerjlforum.com wranglerjlforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wranglerpickupforum.com wranglerpickupforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wtbdfm.com wtbdfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
wuhanshengqiao.com wuhanshengqiao.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Sep 2019 One Off
wtol.com wtol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 71 days
bvathletics.net bvathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
cacavaliers.com cacavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
wythemaroons.org wythemaroons.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
cadillacforums.com cadillacforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xaluan.net xaluan.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 16 days
caferacer.net caferacer.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cajathletics.com cajathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
xcyjb.com xcyjb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Mar 2020 47 days
calbassin.com calbassin.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xeniaathletics.com xeniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
calgaryroyalsaa.com calgaryroyalsaa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jun 2019 One Off
caliberforumz.com caliberforumz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gunnathletics.com gunnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
xsport.ua xsport.ua
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
xuegodmc.monster xuegodmc.monster
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 15 days
xxiuw.com xxiuw.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
canyonathletics.org canyonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
yamaha-forum.net yamaha-forum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ygoprodeck.com ygoprodeck.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jan 2020 233 days
youandyourwedding.co.uk youandyourwedding.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
yoursciontc.com yoursciontc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
catcountry1029.com catcountry1029.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
catfish1.com catfish1.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
ythrhome.com ythrhome.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
cbs8.com cbs8.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
cccsathletics.com cccsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
zasterr.com zasterr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
cedargroveathletics.com cedargroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
zeelandeastsports.com zeelandeastsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
centervilleelkathletics.com centervilleelkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
zhaobf.cn zhaobf.cn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
chbawings.org chbawings.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 146 days
am.com.mx am.com.mx
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
cherokeetalk.com cherokeetalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chevymalibuforum.com chevymalibuforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chine-nouvelle.com chine-nouvelle.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rt.com rt.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
chschieftains.com chschieftains.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
chscoyotes.org chscoyotes.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
chsreddevils.com chsreddevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
chswarriors.org chswarriors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
ciceroprepathletics.com ciceroprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
classical-music.com classical-music.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
club937.com club937.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
clubfrontier.org clubfrontier.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clubxterra.org clubxterra.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clumberpark.cc clumberpark.cc
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
coco7.online coco7.online
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
coloradodaily.com coloradodaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
coloradofisherman.com coloradofisherman.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
columbustelegram.com columbustelegram.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
computerworld.com computerworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
connectionstrings.com connectionstrings.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
convenientaf.com convenientaf.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
corvette-forum.com corvette-forum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
craftpaperscissors.com craftpaperscissors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
crash.net crash.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
creativeincomeblog.com creativeincomeblog.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
creativeplanetnetwork.com creativeplanetnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Jan 2020 130 days
crockathletics.com crockathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cross-stitching.com cross-stitching.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
crossingbroad.com crossingbroad.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
crownvic.net crownvic.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
crriverhawks.com crriverhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
culinarykitchenchicago.com culinarykitchenchicago.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 147 days
cumberlink.com cumberlink.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
customfighters.com customfighters.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cvathletics.org cvathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cwncathletics.org cwncathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cyclonesacademy.com cyclonesacademy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
cyka.cn cyka.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
dailycamera.com dailycamera.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dalevillesports.com dalevillesports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
darientimes.com darientimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
davesgarden.com davesgarden.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
dchawks.com dchawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
dctigersathletics.com dctigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
debate.com.mx debate.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Feb 2020 66 days
decades.com decades.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
deccanchronicle.com deccanchronicle.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
decibo.com decibo.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
deepika.com deepika.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
defendersource.com defendersource.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
deliciousmagazine.co.uk deliciousmagazine.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
democratherald.com democratherald.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
derbyathletics.com derbyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
designyourway.net designyourway.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
dewittathletics.com dewittathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Dec 2019 64 days
dewtour.com dewtour.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 51 days
dfa-ifleague.co.uk dfa-ifleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 280 days
dhswildcatnation.com dhswildcatnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
dieselramforum.com dieselramforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
digitalartsonline.co.uk digitalartsonline.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
dimensionsmagazine.com dimensionsmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Feb 2020 190 days
dippy.org dippy.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dmbha.com dmbha.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
dobberprospects.com dobberprospects.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 137 days
dogforums.com dogforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
doityourself.com doityourself.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
downersgroveathletics.com downersgroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 67 days
dpsdunbarathletics.com dpsdunbarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
ducatifighter.com ducatifighter.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dundeerugby.co.uk dundeerugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
dundurnminorhockey.ca dundurnminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 8 days
ebonybird.com ebonybird.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
ecetia.com ecetia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Feb 2020 67 days
ecvbraves.com ecvbraves.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
edgefanatics.com edgefanatics.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
edhspanthers.com edhspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 131 days
efunda.com efunda.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
ehhsathletics.com ehhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
eksiup.com eksiup.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 40 days
eldeber.pro eldeber.pro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
eldiariony.com eldiariony.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
electrek.co electrek.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 92 days
elginwildcatathletics.com elginwildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
ellisonathletics.com ellisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 67 days
eltoroathletics.com eltoroathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
eluniversal.com.co eluniversal.com.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
elyriaathletics.org elyriaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Dec 2019 64 days
emeraldathletics.com emeraldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
energytv.es energytv.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 221 days
entrepreneur.com entrepreneur.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
epunchng.com epunchng.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
esportsgags.com esportsgags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 131 days
etfchannel.com etfchannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Jan 2020 65 days
evansvilleharrisonathletics.com evansvilleharrisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
explorertalk.com explorertalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
explosm.net explosm.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
extracine.com extracine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
ezwatercalculator.com ezwatercalculator.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Mar 2020 228 days
fadeawayworld.com fadeawayworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Dec 2019 124 days
fanspeak.com fanspeak.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
fantasyrundown.com fantasyrundown.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
fascinately.com fascinately.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
fashionbeans.com fashionbeans.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
fashionista.com fashionista.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
favehealthyrecipes.com favehealthyrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
fayettevilleathletics.com fayettevilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
fcmustangs.com fcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 67 days
fearthestingihs.org fearthestingihs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
federaltimes.com federaltimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
fgrirish.com fgrirish.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
fhsindians.com fhsindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
fhswildcats.com fhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Dec 2019 64 days
fightingzebrasports.com fightingzebrasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 67 days
fitness-singles.com fitness-singles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 245 days
fjcruiserforums.com fjcruiserforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
flyfishingforum.com flyfishingforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
foleyathletics.com foleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 130 days
footballtransfertavern.com footballtransfertavern.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 222 days
fordfusionclub.com fordfusionclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
forumblueandgold.com forumblueandgold.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
fremonttribune.com fremonttribune.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Nov 2019 65 days
frpanthers.org frpanthers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fulltimefantasy.com fulltimefantasy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
funnelmojo.com funnelmojo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
futbolmundial.com futbolmundial.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
gainesvilleredelephantathletics.com gainesvilleredelephantathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gameranx.com gameranx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
ganeshagiantsathletics.com ganeshagiantsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gardenguides.com gardenguides.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
gardeningknowhow.com gardeningknowhow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
gatorforums.net gatorforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gavitathletics.com gavitathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gaylordathletics.com gaylordathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
gchsgreyhounds.com gchsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 130 days
gearbrain.com gearbrain.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 96 days
geauxbulldogs.com geauxbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
gechnas.ru gechnas.ru
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Dec 2019 Dec 2019 One Off
geeksmate.io geeksmate.io
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 58 days
geeky-gadgets.com geeky-gadgets.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 59 days
gemequityinc.com gemequityinc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
georgetakei.com georgetakei.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
mhs-mavericks.com mhs-mavericks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 127 days
ghathletics.org ghathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
ghibliforum.com ghibliforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ghsgladiators.com ghsgladiators.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
ghslancers.org ghslancers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
ghsvikings.com ghsvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gifcrib.com gifcrib.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
girardindians.org girardindians.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gjhssports.com gjhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 130 days
glasgowcollegesfa.co.uk glasgowcollegesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 286 days
glencoeathletics.com glencoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
glock.pro glock.pro
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
glynncountyathletics.com glynncountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
gmtoday.com gmtoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 215 days
goaustinhighathletics.com goaustinhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goballardbruins.com goballardbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocatsgo.org gocatsgo.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gocentennialathletics.com gocentennialathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocometsathletics.com gocometsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goeastmark.com goeastmark.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 124 days
goghsreddevils.com goghsreddevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gohebronathletics.com gohebronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goheightsbulldogs.com goheightsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gohutchathletics.com gohutchathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
golancerssports.com golancerssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goldenknightshockey.org goldenknightshockey.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Mar 2020 Mar 2020 One Off
goldenskate.com goldenskate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
gomantaktimes.com gomantaktimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 35 days
gomarshallredhawks.com gomarshallredhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gomeritknights.com gomeritknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gomilbybuffs.com gomilbybuffs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gondolierathletics.com gondolierathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gonmbchiefs.com gonmbchiefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gonwtigers.com gonwtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
mhsbluedevilnation.com mhsbluedevilnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Dec 2019 64 days
goosehuntingchat.com goosehuntingchat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gopatriotpride.com gopatriotpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gophhsathletics.com gophhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goramsathletics.com goramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gorangerathletics.com gorangerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gorocketsathletics.com gorocketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
goschscougars.com goschscougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goscorpionsports.com goscorpionsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gosheneagles.com gosheneagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
goshermanbearcats.com goshermanbearcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gotechtigers.com gotechtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gouctigers.com gouctigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
govtyojanas.com govtyojanas.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
gowildcatsports.com gowildcatsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
grcathletics.com grcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
greatheartsmontevistaathletics.org greatheartsmontevistaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
greenvilleadvocate.com greenvilleadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
greenwichtime.com greenwichtime.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
guernseygazette.com guernseygazette.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Dec 2019 Feb 2020 65 days
guiaturista.com.ar guiaturista.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
guitarscanada.com guitarscanada.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gujaratimidday.com gujaratimidday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 190 days
guyerwildcats.com guyerwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
halewoodsummerleague2019.co.uk halewoodsummerleague2019.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 110 days
hamiltonminorhockey.com hamiltonminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jun 2019 48 days
handgunforum.net handgunforum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
handlebay.com handlebay.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
hardawayathletics.com hardawayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 64 days
hawkathletics.net hawkathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hdbeachcams.com hdbeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
hdkoora.com hdkoora.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Aug 2019 One Off
headcramp.com headcramp.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 239 days
helloalton.com helloalton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloanniston.com helloanniston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobangor.com hellobangor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobelton.com hellobelton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloburton.com helloburton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellocenterville.com hellocenterville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloclarksdale.com helloclarksdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocollinsville.com hellocollinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocompton.com hellocompton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellodesplaines.com hellodesplaines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelcajon.com helloelcajon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelcentro.com helloelcentro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelmira.com helloelmira.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloevans.com helloevans.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellofridley.com hellofridley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogarner.com hellogarner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellografton.com hellografton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellograndville.com hellograndville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellogranite.com hellogranite.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogreer.com hellogreer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogulfport.com hellogulfport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohazelwood.com hellohazelwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellohazleton.com hellohazleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohendersonville.com hellohendersonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellojackson.com hellojackson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellojonesboro.com hellojonesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokaysville.com hellokaysville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokearney.com hellokearney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolakecharles.com hellolakecharles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolexington.com hellolexington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomadison.com hellomadison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomcalester.com hellomcalester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomokena.com hellomokena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomustang.com hellomustang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthadams.com hellonorthadams.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthlauderdale.com hellonorthlauderdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakparkvillage.com hellooakparkvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopasorobles.com hellopasorobles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopearland.com hellopearland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopendleton.com hellopendleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellopickerington.com hellopickerington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopleasanton.com hellopleasanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopoquoson.com hellopoquoson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloramsey.com helloramsey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorobbinsdale.com hellorobbinsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorockledge.com hellorockledge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloroselle.com helloroselle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosachse.com hellosachse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintbarts.com hellosaintbarts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosanger.com hellosanger.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaudiarabia.com hellosaudiarabia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloscranton.com helloscranton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosherwood.com hellosherwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellosnellville.com hellosnellville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosolon.com hellosolon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosouthholland.com hellosouthholland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostillwater.com hellostillwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosudbury.com hellosudbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotallmadge.com hellotallmadge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellothornton.com hellothornton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotifton.com hellotifton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotooele.com hellotooele.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloturkey.com helloturkey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellounitedarabemirates.com hellounitedarabemirates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovacaville.com hellovacaville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloventura.com helloventura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovineland.com hellovineland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellovirginislands.com hellovirginislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
hellowaterbury.com hellowaterbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowestspringfield.com hellowestspringfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowilmington.com hellowilmington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowoodbury.com hellowoodbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloworthington.com helloworthington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
heraldathletics.com heraldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hfathletics.com hfathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hhspatriots.org hhspatriots.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hiepsiduongpho.net hiepsiduongpho.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
highdefdigest.com highdefdigest.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
hillsboroathletics.org hillsboroathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hindime.net hindime.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
hiphopwired.com hiphopwired.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
historyanswers.co.uk historyanswers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Jan 2020 131 days
historynet.com historynet.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
hitchcockbulldogs.org hitchcockbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hitched.ca hitched.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
hobbytalk.com hobbytalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hockeydb.com hockeydb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Nov 2019 150 days
hollywoodreporter.com hollywoodreporter.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
hondaatvforums.net hondaatvforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hondacrf.com hondacrf.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hondaownersclubs.com hondaownersclubs.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
hormonejungle.com hormonejungle.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jrhsathletics.com jrhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
hot1047.com hot1047.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
htcradarforum.net htcradarforum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
huachos.com huachos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
hudsonexplorersathletics.com hudsonexplorersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hurontigerathletics.com hurontigerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hustlinhawks.com hustlinhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 64 days
hvlathletics.com hvlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hypable.com hypable.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
hyundai-forums.com hyundai-forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
iblcardinals.com iblcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
ibsgroup.org ibsgroup.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ibtimes.com ibtimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
icecreamconvos.com icecreamconvos.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
idotaketwo.com idotaketwo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
ihcubcadet.com ihcubcadet.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 124 days
imagenescool.com imagenescool.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 64 days
independencebluedevils.com independencebluedevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
infinitiqx50.org infinitiqx50.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
inflationdata.com inflationdata.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 124 days
intelliquiz.com intelliquiz.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 122 days
islanderathletics.com islanderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
isrageo.com isrageo.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
itproportal.com itproportal.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
itsfoss.com itsfoss.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
jackrabbitathletics.com jackrabbitathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
jasperathletics.com jasperathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
jcdeagles.com jcdeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 63 days
jeffersonbluejays.com jeffersonbluejays.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 127 days
jenisonathletics.com jenisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
jewishworldreview.com jewishworldreview.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Dec 2019 One Off
jewvelt.com jewvelt.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 59 days
jimpix.co.uk jimpix.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
jiujiure69.com jiujiure69.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
johnmarshallathletics.com johnmarshallathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
joneshighathletics.com joneshighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
joshreads.com joshreads.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 245 days
jourdantonathletics.com jourdantonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
journal-advocate.com journal-advocate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
journalstar.com journalstar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
jplay.com.au jplay.com.au
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Mar 2020 317 days
jsfhbxg.cn jsfhbxg.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jspuzzles.com jspuzzles.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
jszpwmh.com jszpwmh.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
juksy.me juksy.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 61 days
junebugweddings.com junebugweddings.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
justarsenal.com justarsenal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 93 days
jvhsjaguars.com jvhsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kacsathletics.com kacsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 125 days
kalamazoocountry.com kalamazoocountry.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kalamtimes.com kalamtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 122 days
kawasakiversys.com kawasakiversys.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kawasakiz125.org kawasakiz125.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kcbsnewsradio.com kcbsnewsradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
kearnykomets.com kearnykomets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
keyw.com keyw.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kfmx.com kfmx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
kgab.com kgab.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
kgw.com kgw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 92 days
khmoradio.com khmoradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kikn.com kikn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
killthecablebill.com killthecablebill.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
kipptexas-sanantonioathletics.com kipptexas-sanantonioathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kiss4d.com kiss4d.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
kissfm.cat kissfm.cat
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 92 days
kissfm.es kissfm.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 156 days
kltigersrfc.com kltigersrfc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
kmmountaineers.com kmmountaineers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 126 days
kneehillminorhockey.ca kneehillminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
knighthawksathletics.com knighthawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
knightsathletics.net knightsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
knowledgedish.com knowledgedish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
kongregate.com kongregate.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 124 days
kookfans.nl kookfans.nl
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
kqvt.com kqvt.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
krem.com krem.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 133 days
kroc.com kroc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
ksjcathletics.com ksjcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
ktn123.com ktn123.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kvhsathletics.com kvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 124 days
kvue.com kvue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 69 days
lagaceta.com.ar lagaceta.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 124 days
lagrandeindy.com lagrandeindy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
laisureste.com laisureste.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 168 days
lamusica.com lamusica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 45 days
lanacion.com.ar lanacion.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 43 days
laopinion.com.co laopinion.com.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 91 days
lasalleprepathletics.org lasalleprepathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
lbpolyathletics.com lbpolyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lcctbirdsports.com lcctbirdsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 125 days
lebanon-express.com lebanon-express.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
leedavisathletics.com leedavisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
leegeneralsathletics.com leegeneralsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lehiathletics.com lehiathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
leopardsathletics.org leopardsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
letrasweb.com.br letrasweb.com.br
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jun 2019 Mar 2020 267 days
lghsathletics.com lghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
librarium-online.com librarium-online.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
lincolnprepathletics.com lincolnprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
liteonline.com liteonline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
liuhezaixiantouzhu789.net liuhezaixiantouzhu789.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
livability.com livability.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
lll6699.com lll6699.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
lobservateur.com lobservateur.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
logiastarata.gr logiastarata.gr
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Feb 2020 124 days
logopond.com logopond.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
lompocrecord.com lompocrecord.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
losaltosathletics.org losaltosathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
losaltossports.com losaltossports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
lotrointerface.com lotrointerface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
lovepatchworkandquilting.com lovepatchworkandquilting.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
lrathletics.org lrathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lrgarden.cn lrgarden.cn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 29 days
luathletics.org luathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
macworld.co.uk macworld.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
madamenoire.com madamenoire.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jun 2019 46 days
madeformums.com madeformums.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
madison.com madison.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
majic945.com majic945.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
maraudersathletics.com maraudersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
marinij.com marinij.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
marlinmag.com marlinmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
matadorathletics.org matadorathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
matchendirect.fr matchendirect.fr
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 277 days
maynardjacksonathletics.com maynardjacksonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
mbbuccaneers.com mbbuccaneers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mbuk.com mbuk.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
mcaathletics.com mcaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mcamustangsathletics.org mcamustangsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mccallumknightsnation.com mccallumknightsnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 123 days
mckinleyathletics.org mckinleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
meadowbrookathletics.com meadowbrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
medinaathletics.com medinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
memorialhsathletics.com memorialhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mercurycougar.net mercurycougar.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mercurynews.com mercurynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
mericotomotivumraniye.com mericotomotivumraniye.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
metalguitarist.org metalguitarist.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mfqrot.icu mfqrot.icu
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
michigansthumb.com michigansthumb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
mikw.cn mikw.cn
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
mingjunlengfengku.com mingjunlengfengku.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
missouriwhitetails.com missouriwhitetails.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 14 days
mitsubishi-forums.com mitsubishi-forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mix949.com mix949.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
mixedarticle.com mixedarticle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 51 days
mixonline.com mixonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Jan 2020 One Off
mjsportszone.com mjsportszone.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mmajunkie.com mmajunkie.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
mmatorch.com mmatorch.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
mmhl.ca mmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 212 days
mmhsgoldeneagles.com mmhsgoldeneagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
modeliiiforum.com modeliiiforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
modeltrainforum.com modeltrainforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mogs.online mogs.online
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 51 days
molliemakes.com molliemakes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
mom365.com mom365.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
monctonminorbaseball.ca monctonminorbaseball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
mopar-nation.com mopar-nation.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
motorcycle.com motorcycle.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mountainhouseathletics.com mountainhouseathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
movie-moron.com movie-moron.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
mqtathletics.com mqtathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mtgsideboard.com mtgsideboard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 39 days
mtxvh.cn mtxvh.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
muscatinejournal.com muscatinejournal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 51 days
musketeersathletics.com musketeersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
mustangevolution.com mustangevolution.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mvagusta.net mvagusta.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mvjaguars.com mvjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 127 days
mwhswildcats.com mwhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
myb106.com myb106.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
mylargescale.com mylargescale.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mymmanews.com mymmanews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
naeagles.com naeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
national-preservation.com national-preservation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
nationalenquirer.com nationalenquirer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
nbc-2.com nbc-2.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
ncaagamesim.com ncaagamesim.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Oct 2019 125 days
nchsathletics.com nchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ncwhsathletics.com ncwhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ndhl.ca ndhl.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Oct 2019 Oct 2019 One Off
neredwings.com neredwings.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 210 days
new-educ.com new-educ.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 27 days
newbgame.com newbgame.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 57 days
newninja.com newninja.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
newschoolers.com newschoolers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
newsmax.com newsmax.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
ramsayramsathletics.com ramsayramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 119 days
nhseagleathletics.com nhseagleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
nhsknights.com nhsknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
nihl.net nihl.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
niketalk.com niketalk.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
ninja250sl.com ninja250sl.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
ninjabeat.com ninjabeat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Dec 2019 226 days
njbeachcams.com njbeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
njspathletics.com njspathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Dec 2019 65 days
nlaeagles.org nlaeagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
nnn102.top nnn102.top
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
nohsathletics.com nohsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
northbankrsl.com northbankrsl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 38 days
northfieldathletics.com northfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
northwestathletics.org northwestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
nphsathletics.org nphsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 122 days
nswings.net nswings.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Aug 2019 52 days
nuviewbridgeathletics.com nuviewbridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
nwitimes.com nwitimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
oaathletics.org oaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
oakmountainathletics.org oakmountainathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
oakridgeathletics.com oakridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
oddcup.com oddcup.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 48 days
oddee.com oddee.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Jan 2020 65 days
ohiosportsman.com ohiosportsman.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 186 days
ohslions.com ohslions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 120 days
ohztv.com ohztv.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
okanaganathletics.ca okanaganathletics.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 142 days
olaathletics.com olaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
rare.us rare.us
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 124 days
oldmillathletics.com oldmillathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
rarecountry.com rarecountry.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Feb 2020 119 days
olivemagazine.com olivemagazine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
online-knigi.com online-knigi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
ontarioballhockeyfederation.ca ontarioballhockeyfederation.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 209 days
ooltewahathletics.com ooltewahathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
opelgt.com opelgt.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
optbong.com optbong.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
oregoncityschoolsathletics.org oregoncityschoolsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
oremhighathletics.com oremhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
owlsathletics.org owlsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
oyt-tool.com oyt-tool.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
pacerathletics.org pacerathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
paddymcguinnessbingo.uk paddymcguinnessbingo.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Feb 2020 Feb 2020 One Off
painttalk.com painttalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
pasoroblespress.com pasoroblespress.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
patriotproud.net patriotproud.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
paw-talk.net paw-talk.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
readpl.com readpl.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readamericanfootball.com readamericanfootball.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readbundesliga.com readbundesliga.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readchelsea.com readchelsea.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
readfootball.co readfootball.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readgolf.com readgolf.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readhull.com readhull.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readshowbiz.co readshowbiz.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readstoke.com readstoke.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readtennis.co readtennis.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readtottenham.com readtottenham.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
paybud.com paybud.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 25 days
pbnation.com pbnation.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
pcgamer.com pcgamer.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
pcspacers.com pcspacers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 120 days
pensacolafishingforum.com pensacolafishingforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rebelstrue.com rebelstrue.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
perfdrive.com perfdrive.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
phhspatriotpride.com phhspatriotpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
phinphanatic.com phinphanatic.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
phnhuskies.com phnhuskies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
phoenixvillenews.com phoenixvillenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
phpatriots.net phpatriots.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
phswarriors.com phswarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
piedmontwildcatsathletics.com piedmontwildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pikesvilleathletics.com pikesvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
piperforum.com piperforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 120 days
piquaindiansathletics.org piquaindiansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
piratesnation.org piratesnation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pixlr.com pixlr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
pleasantgrovevikings.com pleasantgrovevikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pmhsfalcons.com pmhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pocketnow.com pocketnow.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
polarisatvforums.com polarisatvforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ponyfans.com ponyfans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
popcornews.com popcornews.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
popeathletics.com popeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
popxo.com popxo.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Jan 2020 65 days
porkandhops.com porkandhops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
pottsmerc.com pottsmerc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
praisehouston.com praisehouston.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
prosoundnetwork.com prosoundnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Mar 2020 45 days
prowrestling.com prowrestling.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
prowrestling.net prowrestling.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
puradsifm.com puradsifm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 43 days
puthiyathalaimurai.com puthiyathalaimurai.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 43 days
pvtimes.com pvtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
pwinsider.com pwinsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
qad7.com qad7.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
qchsathletics.com qchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
qingdaorilin.com qingdaorilin.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
quattroworld.com quattroworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
quiltingboard.com quiltingboard.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
radarticles.com radarticles.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
redbankathletics.com redbankathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
redlineutvforums.net redlineutvforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
redwoodtimes.com redwoodtimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
reeserocketsathletics.com reeserocketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
reptileforums.co.uk reptileforums.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
reviewjournal.com reviewjournal.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Nov 2019 150 days
rexputnamathletics.com rexputnamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 119 days
rickeysmileymorningshow.com rickeysmileymorningshow.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
ridgehockey.net ridgehockey.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ringgoldrams.org ringgoldrams.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
ritenourathletics.com ritenourathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
riverbluffathletics.com riverbluffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
aa7876ww.com aa7876ww.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
abilenecooperathletics.org abilenecooperathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
rochellenews-leader.com rochellenews-leader.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Mar 2020 293 days
rock1029.com rock1029.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
rocketshockey.net rocketshockey.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
readbournemouth.com readbournemouth.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
roguesportforum.com roguesportforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
romagladiatornation.com romagladiatornation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
readceltic.com readceltic.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readchampionship.com readchampionship.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
ac778.xyz ac778.xyz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 12 days
rrr113.top rrr113.top
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
rpp.pe rpp.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 149 days
rugby365.com rugby365.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 189 days
rugbyclub9.be rugbyclub9.be
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
rugbyforums.com rugbyforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rugbypass.com rugbypass.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Feb 2020 Feb 2020 One Off
rugerforum.net rugerforum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
areavibes.com areavibes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 189 days
russbk.com russbk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
rvblazerathletics.com rvblazerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
saddlebackathletics.com saddlebackathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
saablink.net saablink.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
saabscene.com saabscene.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
salinehornets.com salinehornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
adventuregamers.com adventuregamers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
savingadvice.com savingadvice.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
saxonathletics.com saxonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
afyfc.co.uk afyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 202 days
scacchoops.com scacchoops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
scbuffalostrong.com scbuffalostrong.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
science-a2z.com science-a2z.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
sciencefocus.com sciencefocus.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 78 days
scienceglory.com scienceglory.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
sdcavers.com sdcavers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
sddashiqi.com sddashiqi.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sdqxwc.com sdqxwc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sdxinbao.net sdxinbao.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
seagullsbaseballacademy.com seagullsbaseballacademy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 156 days
ahsathletics.com ahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
seamsandscissors.com seamsandscissors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
ahsindians.com ahsindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
ahsrocketsports.org ahsrocketsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
sectionvhockey.org sectionvhockey.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
seerahockey.ca seerahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jan 2020 Jan 2020 One Off
selmatimesjournal.com selmatimesjournal.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 23 days
sequoyahathletics.com sequoyahathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
seqsports.com seqsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
alt-codes.net alt-codes.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
armytimes.com armytimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
seventyfirstathletics.com seventyfirstathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
alohaathletics.org alohaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
sgcathletics.com sgcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
seymourathletics.com seymourathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
sfgate.com sfgate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
sfseagulls.com sfseagulls.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 103 days
aroyalpain.com aroyalpain.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
shediacminorhockey.com shediacminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 203 days
sheltonherald.com sheltonherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
allfreecasserolerecipes.com allfreecasserolerecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allfreediyweddings.com allfreediyweddings.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
allhiphop.com allhiphop.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
algonabulldogs.org algonabulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
shoresportsnetwork.com shoresportsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
shotgunforums.com shotgunforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
shs-falcons.com shs-falcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
shsnolesathletics.com shsnolesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 118 days
shswolfpack.com shswolfpack.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 129 days
shuyougep.com shuyougep.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
amhsraptors.com amhsraptors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
sigarms556.com sigarms556.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sigtalk.com sigtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sinembargo.mx sinembargo.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
sistematdcvip.com sistematdcvip.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 21 days
amcg.cn amcg.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
slcavaliers.com slcavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 180 days
anthemprepathletics.com anthemprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
anmosugoi.com anmosugoi.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
sneakhype.com sneakhype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
animesonehd.biz animesonehd.biz
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 18 days
snapguide.com snapguide.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
smpanthersports.com smpanthersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 182 days
sniperforums.com sniperforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
angelswin-forum.com angelswin-forum.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
snowblower.com snowblower.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
anitube.biz anitube.biz
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
socasteeathletics.com socasteeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 233 days
soddydaisyathletics.com soddydaisyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 233 days
sofeminine.co.uk sofeminine.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 189 days
antonym.com antonym.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
somethingturquoise.com somethingturquoise.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
sonataforums.com sonataforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
southceredigionjfl.co.uk southceredigionjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 230 days
southernchestercountyweeklies.com southernchestercountyweeklies.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
aptoslife.com aptoslife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Sep 2019 57 days
autorii.com autorii.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
aplusknightsathletics.com aplusknightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
spectorshockey.net spectorshockey.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
spiritofboise.com spiritofboise.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
spoonpullers.com spoonpullers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sportbikes.net sportbikes.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sportfishingmag.com sportfishingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
spsl.ca spsl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
srxforum.net srxforum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
arundelathletics.com arundelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
014358.com 014358.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
014490.com 014490.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
014546.com 014546.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Sep 2019 One Off
starbikeforums.com starbikeforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
stcathletics.com stcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
100percentfedup.com 100percentfedup.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
1079ishot.com 1079ishot.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
12newsnow.com 12newsnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
stockoptionschannel.com stockoptionschannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Mar 2020 59 days
stockinvest.us stockinvest.us
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 20 days
1470kyyw.com 1470kyyw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
readligue1.com readligue1.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
asianjournal.com asianjournal.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 58 days
aaqk.top aaqk.top
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
abc10.com abc10.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
abc57.com abc57.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
abovethelaw.com abovethelaw.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 124 days
subaruforester.org subaruforester.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
subiecalendar.com subiecalendar.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
acceptthisrose.com acceptthisrose.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
suffolknewsherald.com suffolknewsherald.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
advocate-news.com advocate-news.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
airforcetimes.com airforcetimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
surfline.com surfline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
albertleatribune.com albertleatribune.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
allfreeknitting.com allfreeknitting.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
suzukicentral.com suzukicentral.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sweetslyrics.com sweetslyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
svengoolie.com svengoolie.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
amherstfc.co.uk amherstfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 269 days
swantonathletics.org swantonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
swraidersathletics.com swraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
swtorui.com swtorui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 217 days
swwgl.co.uk swwgl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 182 days
sxfzhb.com sxfzhb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
swimmingforum.co.uk swimmingforum.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
animalgourmet.com animalgourmet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 172 days
szjg17.com szjg17.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tabascohoy.com tabascohoy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
tabcrawler.com tabcrawler.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
taiziyulecheng991.com taiziyulecheng991.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
talkmarkets.com talkmarkets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Mar 2020 45 days
taurusarmed.net taurusarmed.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tcchsrebels.com tcchsrebels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 116 days
tbrnews.com tbrnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
teachingyoutoblog.com teachingyoutoblog.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
tcrams.net tcrams.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
techlicious.com techlicious.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
atvtorture.com atvtorture.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
techbulldogs.com techbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
techconnect.com techconnect.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
techgenyz.com techgenyz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 69 days
audiforum.us audiforum.us
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
technorms.com technorms.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
audizine.com audizine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
techworld.com techworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
austinbassfishing.com austinbassfishing.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
austindailyherald.com austindailyherald.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
telugumirchi.com telugumirchi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
avidoutdoorsman.com avidoutdoorsman.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 117 days
avonworthathletics.com avonworthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
the-gadgeteer.com the-gadgeteer.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
theawesomer.com theawesomer.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
theblemish.com theblemish.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
ayrshireschoolsfa.co.uk ayrshireschoolsfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 206 days
theforce.net theforce.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Jan 2020 One Off
azdailysun.com azdailysun.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
thenewsherald.com thenewsherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
thepostgame.com thepostgame.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
thesixthaxis.com thesixthaxis.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
thetechgame.com thetechgame.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
thetelegraph.com thetelegraph.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
readwestbrom.com readwestbrom.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Aug 2019 52 days
thiscrush.com thiscrush.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
thomasdaleathletics.com thomasdaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
thibodauxtigers.org thibodauxtigers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 179 days
thsouthsports.com thsouthsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
thunderathletics.org thunderathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 179 days
ticehurstfc.co.uk ticehurstfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
timbercreekathletics.com timbercreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
timberland-tmall.com timberland-tmall.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tigerland.com tigerland.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
baratacademyathletics.org baratacademyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
tippecanoeathletics.com tippecanoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
timesnowhindi.com timesnowhindi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 19 days
tirereviewsandmore.com tirereviewsandmore.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
titansathletics.org titansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
tjpatriotathletics.com tjpatriotathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
basketball.com basketball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tmall-vans.com tmall-vans.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tohsathletics.org tohsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
tnxl.nl tnxl.nl
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Feb 2020 98 days
tonaletalk.com tonaletalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
toonclub-th.co toonclub-th.co
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tongyi763.cn tongyi763.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bchighbearcats.com bchighbearcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 122 days
bchsdolphins.com bchsdolphins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
bcsportbikes.com bcsportbikes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
totallyfrugal.com totallyfrugal.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
totalbengals.com totalbengals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 251 days
totalceltics.com totalceltics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalchiefs.com totalchiefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalcubs.com totalcubs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totaldenverbroncos.com totaldenverbroncos.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalduke.com totalduke.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalillini.com totalillini.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 206 days
totalindy.com totalindy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
topweddingquestions.com topweddingquestions.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
beargoggleson.com beargoggleson.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
beatgogo.it beatgogo.it
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
beatgogo.nl beatgogo.nl
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
beatgogo.ru beatgogo.ru
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
totalmiamiheat.com totalmiamiheat.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
beaumontenterprise.com beaumontenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
totalpac12.com totalpac12.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 206 days
trails.com trails.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
beechgrove-athletics.com beechgrove-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
travelingmom.com travelingmom.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Nov 2019 65 days
beldingathletics.com beldingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
tri-centraltrojans.com tri-centraltrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
tri-countyathletics.com tri-countyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
bemad.es bemad.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 44 days
troymessenger.com troymessenger.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
troyrecord.com troyrecord.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
trueself.com trueself.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
truestreetcars.com truestreetcars.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
trukx.com trukx.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
trueactivist.com trueactivist.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
tsxclub.com tsxclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tscougarssports.com tscougarssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
tundrasolutions.com tundrasolutions.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tuningcult.com tuningcult.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
tvline.com tvline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Nov 2019 166 days
twobillsdrive.com twobillsdrive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
uancx15.com uancx15.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
bexleyathletics.com bexleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
bghsathletics.com bghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
bgpurplessports.com bgpurplessports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 66 days
ukiahdailyjournal.com ukiahdailyjournal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
biabcalculator.com biabcalculator.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 237 days
bigbangnews.com bigbangnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
bigblueinteractive.com bigblueinteractive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
bikez.biz bikez.biz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
uovringette.ca uovringette.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Mar 2020 Mar 2020 One Off
urbanahawksathletics.com urbanahawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
uscreditcardguide.com uscreditcardguide.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 94 days
uscscoop.com uscscoop.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
utvblog.net utvblog.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
utvsl.co.uk utvsl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
bishopenglandathletics.com bishopenglandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
valleyviewtigers1.com valleyviewtigers1.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
vanvan200.com vanvan200.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bjpenn.com bjpenn.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
vasjvikings.com vasjvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
vauxhallownersnetwork.co.uk vauxhallownersnetwork.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
veintitantos.com veintitantos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
blacksportsonline.com blacksportsonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
bladenjournal.com bladenjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Sep 2019 104 days
vibe.com vibe.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 110 days
victoryforums.com victoryforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
viperalley.com viperalley.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
viralcuba.com viralcuba.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 207 days
vintagesleds.com vintagesleds.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bluefm.com.ar bluefm.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
vizslaforums.com vizslaforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
blythewoodbengals.com blythewoodbengals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
vmsa.ca vmsa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
boardmanathletics.org boardmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
bobjonesathletics.com bobjonesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
bobvila.com bobvila.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
volnation.com volnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
volvo-forums.com volvo-forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vtvgujarati.com vtvgujarati.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 159 days
vulture.com vulture.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
vweosclub.com vweosclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vwt4forum.co.uk vwt4forum.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wabashapaches.net wabashapaches.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
bongbo.ng bongbo.ng
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
bongino.com bongino.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
walkingstickforum.com walkingstickforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wapa.pe wapa.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 64 days
warhistoryonline.com warhistoryonline.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
bosseathletics.com bosseathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
wblm.com wblm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wbrz.com wbrz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jul 2019 One Off
wchseagles.com wchseagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 54 days
wchshl.com wchshl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 29 days
wcnc.com wcnc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
bowmanathletics.org bowmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
wearebeggs.com wearebeggs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wearenorco.org wearenorco.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wearesc.com wearesc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 231 days
boxelderathletics.com boxelderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 131 days
bradshawmountainathletics.com bradshawmountainathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 66 days
weddingchicks.com weddingchicks.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
weirditaly.com weirditaly.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
weselleldorado.com weselleldorado.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Nov 2019 65 days
wfmynews2.com wfmynews2.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
wfnt.com wfnt.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wforum.com wforum.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
whas11.com whas11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
broadneckathletics.org broadneckathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
brockeaglesathletics.com brockeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
whitecleatbeat.com whitecleatbeat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
whathifi.com whathifi.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
widefieldgladiators.org widefieldgladiators.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 119 days
wideopencountry.com wideopencountry.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 193 days
whoabella.com whoabella.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Sep 2019 56 days
whspanthers.com whspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
brvathletics.com brvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
wincalendar.com wincalendar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
btwathletics.com btwathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
wionews.com wionews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
buccaneerstrong.com buccaneerstrong.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
buckslocalnews.com buckslocalnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jul 2019 86 days
wkfr.com wkfr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wkmi.com wkmi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wlvfl.co.uk wlvfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 167 days
wopanthers.com wopanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
wonderwall.com wonderwall.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
businesscasestudies.co.uk businesscasestudies.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
wpst.com wpst.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
buttscountyathletics.com buttscountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 123 days
wrcbtv.com wrcbtv.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
wrfc.net wrfc.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
wristtwisters.com wristtwisters.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wtsp.com wtsp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
buzzadamsshow.com buzzadamsshow.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wwfoldschool.com wwfoldschool.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Nov 2019 65 days
bysi.ca bysi.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 12 days
wykewanderers.com wykewanderers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
wyrk.com wyrk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
cafepharma.com cafepharma.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 245 days
caffeineinformer.com caffeineinformer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
xcyl88888.cc xcyl88888.cc
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cajoncowboyathletics.com cajoncowboyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
xiehui.org xiehui.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
can-amforum.com can-amforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xsmxy.cn xsmxy.cn
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
yamahastarstryker.com yamahastarstryker.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yanksgoyard.com yanksgoyard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
yarisgrmn.com yarisgrmn.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cardmakingandpapercraft.com cardmakingandpapercraft.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
yetiownersclub.co.uk yetiownersclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
carolinashootersclub.com carolinashootersclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yoamoloszapatos.com yoamoloszapatos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
yourmusiciq.com yourmusiciq.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 195 days
catcountry1073.com catcountry1073.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
cavsathletics.com cavsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
cbs19.tv cbs19.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
cbsstor.com cbsstor.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
yukonbroomball.net yukonbroomball.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
ccsmsathletics.org ccsmsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 66 days
cekingathletics.com cekingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
celebbabylaundry.com celebbabylaundry.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
celebrityaccess.com celebrityaccess.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
zeelandwestsports.com zeelandwestsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
centralscotlandfa.co.uk centralscotlandfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 276 days
centralscottishafl.co.uk centralscottishafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 276 days
zhaocol.com zhaocol.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
cfcolts.com cfcolts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
zhujiangfz.com zhujiangfz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cgbulldogs.com cgbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
zksrilanka.com zksrilanka.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
zotyezone.com zotyezone.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
zoomtv.com zoomtv.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
cheapism.com cheapism.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
chflowersjaguars.com chflowersjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
chhuskies.com chhuskies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jul 2019 One Off
chicksonright.com chicksonright.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
chsfalconpride.com chsfalconpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
chsfalcons.com chsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
chslionsathletics.com chslionsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 130 days
cincinnatisteam.com cincinnatisteam.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 13 days
cincyontheprowl.com cincyontheprowl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
cinemablend.com cinemablend.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
cislns.ca cislns.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
citiblog.co.uk citiblog.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 49 days
claiborneprogress.net claiborneprogress.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
climbingtalshill.com climbingtalshill.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
clubrsx.com clubrsx.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cmaspartans.com cmaspartans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
cmh4444.com cmh4444.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
collegegridirons.com collegegridirons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
commanderforums.org commanderforums.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
computerworlduk.com computerworlduk.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
cordcuttersnews.com cordcuttersnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
coventryathletics.org coventryathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 190 days
covers.com covers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 260 days
covinahighathletics.com covinahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 190 days
craftster.org craftster.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
creadersnet.com creadersnet.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
crnorthampton.com crnorthampton.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
cronica.com.ar cronica.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Feb 2020 131 days
crookanddistrictleague.co.uk crookanddistrictleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 278 days
crooksandliars.com crooksandliars.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 45 days
csfbl.com csfbl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
csfda.co.uk csfda.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 49 days
csnbbs.com csnbbs.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
csoonline.com csoonline.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
cspasentinels.com cspasentinels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
csskodiaks.com csskodiaks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cucharasonica.com cucharasonica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 169 days
cumminsforum.com cumminsforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
customdakotas.com customdakotas.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
daculaathletics.com daculaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dadecountyathletics.com dadecountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Sep 2019 59 days
dailybreeze.com dailybreeze.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
dailydemocrat.com dailydemocrat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dailypuppy.com dailypuppy.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
daingerfieldathletics.com daingerfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 67 days
dairygoatinfo.com dairygoatinfo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dallasobserver.com dallasobserver.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
damienathletics.com damienathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
data2-worldcoinindex.com data2-worldcoinindex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 37 days
dbhssports.org dbhssports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
dbltap.com dbltap.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
ddotomen.co ddotomen.co
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
ddyfa.co.uk ddyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 279 days
dealbreaker.com dealbreaker.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 110 days
deerhuntersclub.com deerhuntersclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
democracyforums.com democracyforums.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
denmarkathletics.com denmarkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
depo.com.ar depo.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 104 days
destinationtips.com destinationtips.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
devid.info devid.info
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
dfl2009.co.uk dfl2009.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 90 days
dfwstangs.net dfwstangs.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dhsdragonsathletics.com dhsdragonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dhshsathletics.com dhshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
diabloathletics.com diabloathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
diffuser.fm diffuser.fm
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
dkn.tv dkn.tv
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dlrccricket.com dlrccricket.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
dmwolves.com dmwolves.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 59 days
dobberhockey.com dobberhockey.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 130 days
dobbersports.com dobbersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 59 days
dobiepride.com dobiepride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
dognameswoof.com dognameswoof.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dornob.com dornob.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
dosmiechu.com dosmiechu.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
dowathletics.com dowathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dpsbelmontathletics.com dpsbelmontathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dramamilk.com dramamilk.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Feb 2020 Feb 2020 6 days
drphillipshsathletics.com drphillipshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 67 days
drywalltalk.com drywalltalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
duramaxforum.com duramaxforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
duvalathletics.com duvalathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dvskyhawksathletics.com dvskyhawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
familyhandyman.com familyhandyman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
easleyathletics.com easleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
eastlansingathletics.com eastlansingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
eastviewathletics.com eastviewathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
eddiesathletics.com eddiesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
ehowenespanol.com ehowenespanol.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ehsathletics.org ehsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
ejeagleathletics.org ejeagleathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
elcaminocentral.com elcaminocentral.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
elfann.com elfann.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Feb 2020 71 days
elkhartblazersports.com elkhartblazersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
elmonteathletics.com elmonteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
elpilon.com.co elpilon.com.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
elpopular.pe elpopular.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 45 days
elsivar24.com elsivar24.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
enchantedforum.net enchantedforum.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Feb 2020 Feb 2020 4 days
endurocross.com endurocross.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
ennislions.org ennislions.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
eqinterface.com eqinterface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
erhsmustangathletics.com erhsmustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 124 days
escape-city.com escape-city.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
estrategia45.com estrategia45.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 102 days
etowahhighathletics.com etowahhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 131 days
everydaydiabeticrecipes.com everydaydiabeticrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
excelsior.com.mx excelsior.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
expressnews.com expressnews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
factaholics.com factaholics.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Sep 2019 55 days
fairbornathletics.com fairbornathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
fairfieldcitizenonline.com fairfieldcitizenonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
faktually.com faktually.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 59 days
fallbrook247.com fallbrook247.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
fanbuzz.com fanbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Mar 2020 165 days
fantasyhockeygeek.com fantasyhockeygeek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
fantasysharks.com fantasysharks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 186 days
favesouthernrecipes.com favesouthernrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
fcflashes.com fcflashes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 131 days
fftoday.com fftoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
fftodayforums.com fftodayforums.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
finance101.com finance101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 56 days
fireblades.org fireblades.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fliernation.org fliernation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
floridaconcealedcarry.com floridaconcealedcarry.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
flucoathletics.com flucoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 130 days
fmhsathletics.com fmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
focusfanatics.com focusfanatics.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
focusst.org focusst.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
footballfancast.com footballfancast.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
footballfoundation.org footballfoundation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
forresnairnwfa.co.uk forresnairnwfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 285 days
fortmorgantimes.com fortmorgantimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
fortnitedb.com fortnitedb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 68 days
fosterfalcons.com fosterfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
fourquartetshoa.com fourquartetshoa.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 219 days
foxcreekathletics.com foxcreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
fseriesfanatics.com fseriesfanatics.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
fullertonindiansathletics.com fullertonindiansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gahannalincolnathletics.com gahannalincolnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gahrgladiators.com gahrgladiators.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gbhsathletics.com gbhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gcaathletics.org gcaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gchsathletics.org gchsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 124 days
geekycamel.com geekycamel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
geoguessr.com geoguessr.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
ghsathletics.com ghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Dec 2019 65 days
giants365.com giants365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
gigemgazette.com gigemgazette.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
gilbertathletics.org gilbertathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
girlshockey.ca girlshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 2 days
givemeasecond.com givemeasecond.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
givemesport.com givemesport.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
gladewaterathletics.com gladewaterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
glam.com glam.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
glendoraathletics.com glendoraathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goaliepost.com goaliepost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
goanddomichigan.com goanddomichigan.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 49 days
gobluedevilsports.com gobluedevilsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocomets.net gocomets.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goconquerors.com goconquerors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
goconquistadors.com goconquistadors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gocrusadersathletics.com gocrusadersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
godwinheightsathletics.com godwinheightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
goeatoneagles.com goeatoneagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gofcswarriors.com gofcswarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gofreedombulldogs.com gofreedombulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gofugyourself.com gofugyourself.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
golargolions.com golargolions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
golfmagic.com golfmagic.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
golfweek.com golfweek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jan 2020 234 days
gon.com gon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Nov 2019 150 days
gonewalbany.com gonewalbany.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
gonwpanthers.com gonwpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gool24.net gool24.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 60 days
gopolarbears.com gopolarbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gorattlernation.com gorattlernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gorogersroyals.com gorogersroyals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
goskylineraiders.com goskylineraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gosparkplugs.com gosparkplugs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gotaftathletics.com gotaftathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gotfhsbruins.com gotfhsbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
govalleyvikings.com govalleyvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gowestviewathletics.com gowestviewathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gowilsonwildcats.com gowilsonwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gowoodbridge.org gowoodbridge.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
gowyattathletics.com gowyattathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gphswildcats.com gphswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
grabien.com grabien.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Nov 2019 65 days
grchristianeagles.com grchristianeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
greenbot.com greenbot.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
greenbulldogathletics.com greenbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
griffinbearsathletics.com griffinbearsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
groceryshopforfreeatthemart.com groceryshopforfreeatthemart.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Mar 2020 225 days
gthstitanathletics.com gthstitanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
guioteca.com guioteca.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 49 days
guitars101.com guitars101.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gujaratilexicon.com gujaratilexicon.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 14 days
gunforums.net gunforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hanfordsentinel.com hanfordsentinel.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
hauserathletics.com hauserathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 64 days
hcathletics.net hcathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
headphonereview.com headphonereview.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
helenair.com helenair.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
helloabbeville.com helloabbeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloammon.com helloammon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloangleton.com helloangleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloarlington.com helloarlington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobrooklyncenter.com hellobrooklyncenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocapecod.com hellocapecod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocarbondale.com hellocarbondale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocartersville.com hellocartersville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocentennial.com hellocentennial.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocicero.com hellocicero.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocolleyville.com hellocolleyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocranston.com hellocranston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocrestwood.com hellocrestwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellodenison.com hellodenison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellododge.com hellododge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeastlansing.com helloeastlansing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Jan 2021 One Off
helloedmond.com helloedmond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloedwardsville.com helloedwardsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelkriver.com helloelkriver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloemporia.com helloemporia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloengland.com helloengland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogadsden.com hellogadsden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogoldenvalley.com hellogoldenvalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2020 Jan 2021 162 days
hellogoldsboro.com hellogoldsboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogreendale.com hellogreendale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohammond.com hellohammond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellohercules.com hellohercules.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohermiston.com hellohermiston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohiltonheadisland.com hellohiltonheadisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohollywood.com hellohollywood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohutchinson.com hellohutchinson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloinkster.com helloinkster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellojerseyshore.com hellojerseyshore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellokenner.com hellokenner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokingsville.com hellokingsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokinston.com hellokinston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellolahabra.com hellolahabra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolansing.com hellolansing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellolascruces.com hellolascruces.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloleawood.com helloleawood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolemoore.com hellolemoore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloleominster.com helloleominster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellolyon.com hellolyon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomacon.com hellomacon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellomaplevalley.com hellomaplevalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomaryville.com hellomaryville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomattoon.com hellomattoon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomiamilakes.com hellomiamilakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomorganton.com hellomorganton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonetherlands.com hellonetherlands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
hellonewlondon.com hellonewlondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellonogales.com hellonogales.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthampton.com hellonorthampton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthcanton.com hellonorthcanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakharbor.com hellooakharbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloowensboro.com helloowensboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopalmdale.com hellopalmdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloparkland.com helloparkland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloparmaheights.com helloparmaheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopaterson.com hellopaterson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopineville.com hellopineville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopinole.com hellopinole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Jan 2021 One Off
helloplantation.com helloplantation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportage.com helloportage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportchester.com helloportchester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportwashington.com helloportwashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloquincy.com helloquincy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 136 days
helloreunion.com helloreunion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorussellville.com hellorussellville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorussia.com hellorussia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintkitts.com hellosaintkitts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintlucia.com hellosaintlucia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosanclemente.com hellosanclemente.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloschererville.com helloschererville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosolomonislands.com hellosolomonislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostarkville.com hellostarkville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostatesboro.com hellostatesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosummerville.com hellosummerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotrotwood.com hellotrotwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotucson.com hellotucson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
helloupland.com helloupland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovadnaisheights.com hellovadnaisheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovisalia.com hellovisalia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowatsonville.com hellowatsonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowaynesboro.com hellowaynesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestcolumbia.com hellowestcolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestvalleycity.com hellowestvalleycity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowheaton.com hellowheaton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowhittier.com hellowhittier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowilliamsport.com hellowilliamsport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellozion.com hellozion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hepangda.com hepangda.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
heraldo.es heraldo.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
herzindagi.com herzindagi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
heyquiz.com heyquiz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 189 days
hhpboosterclub.com hhpboosterclub.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hhshoyasports.com hhshoyasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hidalgopirates.org hidalgopirates.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hindijeevansathi.in hindijeevansathi.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
historyextra.com historyextra.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
hitched.co.in hitched.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
hitched.co.za hitched.co.za
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
hlsdsports.us hlsdsports.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hmbhsathletics.com hmbhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hnsop.ca hnsop.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 222 days
hogeyesports.net hogeyesports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hokesbluffathletics.com hokesbluffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
homerefurbers.com homerefurbers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hondarebel3forum.com hondarebel3forum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
hornetforumz.com hornetforumz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
hot975fm.com hot975fm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
houstononthecheap.com houstononthecheap.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 20 days
hoverugby.club hoverugby.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
hrfc.ca hrfc.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 49 days
hrvforum.com hrvforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hunterr.site hunterr.site
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
huskiesathletics.org huskiesathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
hvcbl.com hvcbl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 173 days
hystersisters.com hystersisters.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hzeppfeed.com hzeppfeed.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 62 days
iangavet.com iangavet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Mar 2020 161 days
ibc24.in ibc24.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
ibtimes.com.au ibtimes.com.au
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
icehawkshockey.ca icehawkshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
idabelwarriors.com idabelwarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
ifagrassrootsabc.co.uk ifagrassrootsabc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 285 days
iheartdogs.com iheartdogs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ilwarriors.com ilwarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
immediate.co.uk immediate.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
impressiveinteriordesign.com impressiveinteriordesign.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
indy100.com indy100.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
infinitiqx60.org infinitiqx60.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
infoworld.com infoworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
inhabitat.com inhabitat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
inhalesports.com inhalesports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
ringsidenews.com ringsidenews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 154 days
insideweddings.com insideweddings.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
insomnia.net insomnia.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
intouchweekly.com intouchweekly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
ione3preprod.com ione3preprod.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
ioniaathletics.com ioniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
ironhorseathletics.net ironhorseathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
itnews.com itnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
jamesclemensathletics.com jamesclemensathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
jcpantherathletics.org jcpantherathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jdtechtalk.com jdtechtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jeepforum.com jeepforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jeepgarage.org jeepgarage.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jeeppatriot.com jeeppatriot.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jeffathletics.com jeffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jeffersonfalconathletics.com jeffersonfalconathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jetsathletics.org jetsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jetski.com jetski.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jetskinews.com jetskinews.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jimrome.com jimrome.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
jockeyjournal.com jockeyjournal.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
johnscreekathletics.org johnscreekathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 62 days
jomustangathletics.com jomustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
jonesborocardinals.com jonesborocardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
journalindia.com journalindia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 32 days
journaltimes.com journaltimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
joycolumbus.com joycolumbus.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
justlabradors.com justlabradors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
justmommies.com justmommies.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
kawasakiworld.com kawasakiworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kawasakiz650.com kawasakiz650.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kawieriders.com kawieriders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kayfabenews.com kayfabenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
kearnsathletics.com kearnsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
keguyyyc.com keguyyyc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kellathletics.org kellathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kempnerathletics.com kempnerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kentuckysportsradio.com kentuckysportsradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
kezj.com kezj.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kfilradio.com kfilradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kfox95.com kfox95.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
khaleejtimes.com khaleejtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 23 days
kissrichmond.com kissrichmond.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
klaw.com klaw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
kleincollinstigers.com kleincollinstigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 61 days
kmhlhockey.com kmhlhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
kmhsmustangathletics.net kmhsmustangathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
knightnationathletics.com knightnationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kogoldeneagles.com kogoldeneagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 61 days
kongjie91.com kongjie91.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
krod.com krod.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
ksmglobe.com ksmglobe.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
ktemnews.com ktemnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
kurdistanboards.com kurdistanboards.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 56 days
lackeyathletics.com lackeyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lafayettefightingirish.com lafayettefightingirish.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lagunahillsathletics.com lagunahillsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lakecityathletics.org lakecityathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lakeridgeathletics.com lakeridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 61 days
lakers365.com lakers365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 280 days
lancasterathletics.com lancasterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
laoutdoorexpo.com laoutdoorexpo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
laprensa.com.ni laprensa.com.ni
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
lavillacardinals.com lavillacardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
lavoz.com.ar lavoz.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
lawndaleathletics.com lawndaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lawofficer.com lawofficer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
lbhsbroncos.com lbhsbroncos.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
lecathletics.com lecathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 126 days
leefspiritueel.nu leefspiritueel.nu
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 55 days
letterboxd.com letterboxd.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
lewiscountyathletics.com lewiscountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lewisfalconsathletics.com lewisfalconsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lhathletics.com lhathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lhshornets.com lhshornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lhslancers.com lhslancers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lifetonik.com lifetonik.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
lighterthanheir.com lighterthanheir.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 55 days
linantalk.com linantalk.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 30 days
lincolnprepathletics.org lincolnprepathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
live959.com live959.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
livescience.com livescience.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
living101.com living101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 62 days
ljloboathletics.com ljloboathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
loogooteeathletics.com loogooteeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
losgatosathletics.com losgatosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
loudwire.com loudwire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
lowellvilleathletics.com lowellvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 123 days
lrgarden.net lrgarden.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 153 days
lutonrugby.com lutonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 51 days
lwwathletics.com lwwathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lynbrookathletics.com lynbrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lyricalduniya.com lyricalduniya.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 29 days
lyricsreg.com lyricsreg.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
mainlinemedianews.com mainlinemedianews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
majestyusa.com majestyusa.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
majicatl.com majicatl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
malaysiaindru.my malaysiaindru.my
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 53 days
manatelugu.to manatelugu.to
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
manchesterdutchmen.com manchesterdutchmen.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
marca.com marca.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
marinecorpstimes.com marinecorpstimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
masfl.co.uk masfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 277 days
mate1314.com mate1314.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mautofied.com mautofied.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mavpride.com mavpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mbcaathletics.org mbcaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
mbdragonathletics.com mbdragonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
mchiathletics.com mchiathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mcmustangs.com mcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mcseaglesohathletics.org mcseaglesohathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 58 days
mdl3etarekoreia.ir mdl3etarekoreia.ir
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
meadeathletics.com meadeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mega.tv mega.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 58 days
membresiavanguardia.com membresiavanguardia.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
mercedes-190.co.uk mercedes-190.co.uk
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Dec 2019 One Off
mercedesclaforum.com mercedesclaforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
merthyrtydfilafl.co.uk merthyrtydfilafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 276 days
metacarpolis.com metacarpolis.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 52 days
metsminors.net metsminors.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
mhseagles.com mhseagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
milfordyouthbaseball.com milfordyouthbaseball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Feb 2020 Mar 2020 28 days
mix108.com mix108.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mmhsathletics.com mmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mmmhl.ca mmmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
mmorpg.com mmorpg.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
mohawks4life.com mohawks4life.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
molson4on4.com molson4on4.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 52 days
montereyherald.com montereyherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
moodytrojans.com moodytrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mountainstatesman.com mountainstatesman.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Dec 2019 Mar 2020 86 days
mrfood.com mrfood.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
mrhsathletics.com mrhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mrhsgrizzlies.org mrhsgrizzlies.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mthfightingowls.com mthfightingowls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
mtmorrisathletics.com mtmorrisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 127 days
mujerde10.com mujerde10.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Feb 2020 122 days
munciecentralathletics.com munciecentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
munstermustangs.com munstermustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
muyinteresante.es muyinteresante.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 14 days
muymascotas.es muymascotas.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
mvhsathletics.com mvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 122 days
mybama.com mybama.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
myclassixatl.com myclassixatl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
mycolumbusmagic.com mycolumbusmagic.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
mysanantonio.com mysanantonio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
myturbodiesel.com myturbodiesel.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nacionrex.com nacionrex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 86 days
nagpurtoday.in nagpurtoday.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 27 days
nataliasports.net nataliasports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
natchezdemocrat.com natchezdemocrat.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
nationalgunforum.com nationalgunforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ncacrusaders.org ncacrusaders.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ndaeagles.org ndaeagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ndathletics.com ndathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ndnation.com ndnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Sep 2019 85 days
neptuneathletics.org neptuneathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 122 days
networkworld.com networkworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
newcougar.org newcougar.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
newsbytesapp.com newsbytesapp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 149 days
newstalk1280.com newstalk1280.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
newtonaycliffefc.co.uk newtonaycliffefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
next-video.ru next-video.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 27 days
nflanalysis.net nflanalysis.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 274 days
nghsbulldogs.com nghsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
nibfanational.co.uk nibfanational.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Dec 2019 179 days
nisoutherngirlsleague.co.uk nisoutherngirlsleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
nmhsathletics.com nmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
noisecreep.com noisecreep.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
nopzc.cn nopzc.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
northchiltonadvertiser.com northchiltonadvertiser.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 23 days
npaaathletics.com npaaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
npcmustangs.com npcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
npcougars.com npcougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
nswildcats.com nswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
numismaster.com numismaster.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Jul 2019 48 days
oberlinathletics.org oberlinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
oconnellathletics.com oconnellathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
oconnorathletics.com oconnorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
odyclub.com odyclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
odysseyownersclub.com odysseyownersclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
off-road.com off-road.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ohstigers.com ohstigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 121 days
oilerathletics.com oilerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
okotoksbasketball.ca okotoksbasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
ole.com.ar ole.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
olentangyberlinathletics.com olentangyberlinathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
red-mammoth.com red-mammoth.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Aug 2019 One Off
olsmj.com olsmj.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
ondu.ru ondu.ru
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
onthesesh.com onthesesh.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
redbluffdailynews.com redbluffdailynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
oronospartans.org oronospartans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Dec 2019 65 days
ourcatholicprayers.com ourcatholicprayers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
overclock.net overclock.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ovpatriots.com ovpatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
owhsbruins.com owhsbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ozlaverda.com ozlaverda.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 46 days
paddlemaven.com paddlemaven.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
paintballscene.com paintballscene.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
paladins.guru paladins.guru
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 173 days
redmarleyfc.co.uk redmarleyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
reelfishingchat.com reelfishingchat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
parentingisnteasy.co parentingisnteasy.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
pasadenastarnews.com pasadenastarnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
paypath.com paypath.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
pccsmsathletics.com pccsmsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
pceagles.com pceagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pcepactivities.com pcepactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pcrathletics.com pcrathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
pcworld.com pcworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 62 days
pembrokeminorhockey.com pembrokeminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 208 days
reignoftroy.com reignoftroy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
perfectmancave.com perfectmancave.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
perfectunion.com perfectunion.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
phhsbigreds.com phhsbigreds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
phsindians.info phsindians.info
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pikecountyathletics.com pikecountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
piloteers.org piloteers.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
pistolsmith.com pistolsmith.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
planetf1.com planetf1.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
poetic-study.co.uk poetic-study.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
poftut.com poftut.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
popaxiom.com popaxiom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
popdust.com popdust.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
postandcourier.com postandcourier.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
poststar.com poststar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
poultonprimaryleague.co.uk poultonprimaryleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
power959.com power959.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
predatortalk.com predatortalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
preferredstockchannel.com preferredstockchannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 110 days
prensalibre.com prensalibre.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
pressandguide.com pressandguide.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
presstelegram.com presstelegram.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
problitz.com problitz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 270 days
psdispatch.com psdispatch.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
psindians.com psindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
puntlandnews.net puntlandnews.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Jul 2019 One Off
purewow.com purewow.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Mar 2020 78 days
pvnews.com pvnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
pwtorchlivecast.com pwtorchlivecast.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 223 days
qashqaiforum.com qashqaiforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
qhubo.com qhubo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 81 days
qinuo8.com qinuo8.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
qiyuanfenpeiqi.net qiyuanfenpeiqi.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
qocougars.com qocougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
rabbitdogs.net rabbitdogs.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
ramonahighathletics.com ramonahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
ramrebelforum.com ramrebelforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
ramsathletics.org ramsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
rappler.com rappler.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Mar 2020 245 days
raptorforum.com raptorforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ravensathletics.com ravensathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
razzball.com razzball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 33 days
renegadeforum.com renegadeforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
reynoldsburgraiders.org reynoldsburgraiders.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Jan 2020 One Off
ridgelineownersclub.com ridgelineownersclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rikimusic.com rikimusic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
ringtv.com ringtv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 65 days
archeryaddix.com archeryaddix.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
buzznoble.com buzznoble.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
rncavaliers.com rncavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
abunawaf.com abunawaf.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
rock1041.com rock1041.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
roofingtalk.com roofingtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
roscoeathletics.com roscoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
royalathletics.net royalathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
roughriderathletics.net roughriderathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
roughridersports.net roughridersports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
routerforums.com routerforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
roverathletics.org roverathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
rowancountyvikings.com rowancountyvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
actitudfem.pro actitudfem.pro
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
cchsathletics.org cchsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 131 days
cchssports.com cchssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 131 days
rugbydump.com rugbydump.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Jan 2020 129 days
rughookingmagazine.com rughookingmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
ruta0.com ruta0.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 22 days
rvinsurance.net rvinsurance.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rzrforums.net rzrforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rzwjjc.com rzwjjc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
saeasports.org saeasports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
saabcentral.com saabcentral.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
adjfl.co.uk adjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 268 days
saposyprincesas.us saposyprincesas.us
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
saracensamateurrugby.com saracensamateurrugby.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
aecorteamer.club aecorteamer.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
satiride.com satiride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
sbepathletics.org sbepathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Feb 2020 52 days
sbisoccer.com sbisoccer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 162 days
sbsun.com sbsun.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
sccsathletics.cc sccsathletics.cc
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Feb 2020 52 days
scr950forum.com scr950forum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
scyl.org scyl.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 228 days
sdyfl.org sdyfl.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 163 days
seattletimes.com seattletimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
airlinepilotcentral.com airlinepilotcentral.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
sellitmt.com sellitmt.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
alhslynx.com alhslynx.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
sgmj8.com sgmj8.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
alternatifim.com alternatifim.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 190 days
sfbulldogathletics.com sfbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Nov 2019 63 days
sgvikings.com sgvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
allfreechristmascrafts.com allfreechristmascrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
shengxinjzjx.net shengxinjzjx.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
allfreejewelrymaking.com allfreejewelrymaking.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
alvarezeagles.com alvarezeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
shootersforum.com shootersforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
alfabb.com alfabb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
shsgreyhounds.com shsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
shsjaguars.com shsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
shskyhawksathletics.com shskyhawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 118 days
shpanthernation.com shpanthernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
amherstramblersalumni.ca amherstramblersalumni.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 20 days
amherststeelecomets.com amherststeelecomets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
amhsathletics.com amhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
sidelionreport.com sidelionreport.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
skiingforum.com skiingforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
smcathletics.us smcathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 233 days
animesgratisbr.net animesgratisbr.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
animesonlinebr.co animesonlinebr.co
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
smtitansathletics.org smtitansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 233 days
smyrnahighathletics.com smyrnahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 233 days
soaringdownsouth.com soaringdownsouth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
snowblowerforum.com snowblowerforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
snowplowforums.com snowplowforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
antonymswords.com antonymswords.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
someecards.com someecards.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
somoskudasai.com somoskudasai.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
songlyrics.com songlyrics.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
southernathletics.org southernathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
space.com space.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
spacecoastdaily.com spacecoastdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 260 days
apkjelly.com apkjelly.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jul 2019 One Off
spellweb.com spellweb.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
speckyboy.club speckyboy.club
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 29 days
spidermannews.com spidermannews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jun 2019 29 days
sportbikeworld.com sportbikeworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
splitcoaststampers.com splitcoaststampers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
sportsplays.com sportsplays.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 100 days
sportsecyclopedia.com sportsecyclopedia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
spydertalk.com spydertalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sswildcatactivities.com sswildcatactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 182 days
ashburnxtreme.org ashburnxtreme.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Mar 2020 Mar 2020 One Off
012763.com 012763.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
013249.com 013249.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
1023thebullfm.com 1023thebullfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1033uscountry.com 1033uscountry.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1035kissfmboise.com 1035kissfmboise.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1037theloon.com 1037theloon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
10best.com 10best.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
stereogum.com stereogum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Jan 2020 130 days
1199forums.com 1199forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
stingtut.com stingtut.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
12news.com 12news.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 36 days
1520theticket.com 1520theticket.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
15a20.com.mx 15a20.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 36 days
aaskylineathletics.com aaskylineathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
stxcharge.com stxcharge.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Sep 2019 One Off
subarubrzforum.com subarubrzforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
accorsd.site accorsd.site
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
achswolvesathletics.net achswolvesathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
sulphurbulldogs.org sulphurbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 116 days
sunset.com sunset.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
agdaily.com agdaily.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Nov 2019 65 days
allfreekidscrafts.com allfreekidscrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allfreepapercrafts.com allfreepapercrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
alt1035.com alt1035.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
survivalistboards.com survivalistboards.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
swanseaseniorfootballleague.co.uk swanseaseniorfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 230 days
americustimesrecorder.com americustimesrecorder.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
svilleathletics.com svilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
swmavs.com swmavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
swordz.io swordz.io
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 50 days
swrandolphathletics.com swrandolphathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
ancafl.co.uk ancafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
apacheathletics.org apacheathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
tabs4acoustic.com tabs4acoustic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 131 days
talbotoc.com talbotoc.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
taiwanmianmo.com taiwanmianmo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
talkchelsea.net talkchelsea.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
talkparrotlets.com talkparrotlets.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
astuce-sympa.co astuce-sympa.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
atalakers.com atalakers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 131 days
tastyrecipes101.com tastyrecipes101.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
taxguide.co.uk taxguide.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 May 2019 23 days
taylorcantcometothephone.com taylorcantcometothephone.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 30 days
tcodesearch.com tcodesearch.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 19 days
atmoreadvance.com atmoreadvance.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
tcwestathletics.org tcwestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 180 days
techadvisor.co.uk techadvisor.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 70 days
techlearning.com techlearning.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
technabob.com technabob.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
atualizeja.com atualizeja.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 16 days
atvdragracers.com atvdragracers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
teamtalk.com teamtalk.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 100 days
auburnpub.com auburnpub.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
aula2pl.com aula2pl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 63 days
televisa.com televisa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
austinopiaterehab.com austinopiaterehab.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
tends0769.com tends0769.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tennis365.com tennis365.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
teradatabase.net teradatabase.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 100 days
tfp.is tfp.is
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
avnetwork.com avnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
thanthitv.com thanthitv.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 99 days
awesome923.com awesome923.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
awesome98.com awesome98.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thecombineforum.com thecombineforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
aydengriftonathletics.com aydengriftonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
ayersvillepilots.com ayersvillepilots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
thedeadbolt.com thedeadbolt.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
theboombox.com theboombox.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ayrshireafa.co.uk ayrshireafa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 271 days
thektog.org thektog.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
themorningsun.com themorningsun.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
thepostsearchlight.com thepostsearchlight.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 23 days
therecorddelta.com therecorddelta.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Nov 2019 169 days
badgerofhonor.com badgerofhonor.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
thesnaponline.com thesnaponline.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
bairdbearathletics.com bairdbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
thhsathletics.com thhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
thv11.com thv11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
festusathletics.com festusathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
thumbnailsave.com thumbnailsave.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 19 days
tippecanoevalleyathletics.com tippecanoevalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
tippsundtricks.co tippsundtricks.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
timesnowmarathi.com timesnowmarathi.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Sep 2019 Feb 2020 163 days
timesunion.com timesunion.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tisdaleminorhockey.com tisdaleminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 35 days
titanathleticshq.com titanathleticshq.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
barnsleyanddistrictjfl.co.uk barnsleyanddistrictjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
barnsleyfa.co.uk barnsleyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 272 days
tkunderground.com tkunderground.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tlxforums.com tlxforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tmhswildcatsathletics.com tmhswildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 117 days
tomsguide.com tomsguide.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
tomshardware.co.uk tomshardware.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bayathletics.org bayathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
toocool2betrue.com toocool2betrue.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
tooeleathletics.org tooeleathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 129 days
bbcgoodfood.com bbcgoodfood.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
bchstigers.com bchstigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 57 days
bcjaguarsathletics.com bcjaguarsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Jan 2020 66 days
bdltbxf.com bdltbxf.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
topweddingsites.com topweddingsites.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
bdyfl.co.uk bdyfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 206 days
tornadoathletics.org tornadoathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
tosawesttrojans.com tosawesttrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 129 days
totalmilwaukeebucks.com totalmilwaukeebucks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
totalsacramentokings.com totalsacramentokings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalufc.com totalufc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalvikings.com totalvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 133 days
totalwba.com totalwba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
beatgogo.de beatgogo.de
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
beatricedailysun.com beatricedailysun.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
tractorforum.com tractorforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
toyotachrforum.com toyotachrforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
trailvoy.com trailvoy.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
trapshooters.com trapshooters.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
beesource.com beesource.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
behsathletics.com behsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
beijixingyl.net beijixingyl.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
traverseforum.com traverseforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bellethemagazine.com bellethemagazine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
triumph675.net triumph675.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
triwestbruins.com triwestbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
trojansrugby.co.uk trojansrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
benelliforum.com benelliforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
trxforums.com trxforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bereanathletics.org bereanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
tsczs.cn tsczs.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tsminteractive.com tsminteractive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
ttforum.co.uk ttforum.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ttora.com ttora.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bessemerathletics.com bessemerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
tucson.com tucson.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
tvbeurope.com tvbeurope.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 183 days
twice.com twice.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
twinsdaily.com twinsdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
uasdathletics.com uasdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
tzmenboke.com tzmenboke.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bfbluejays.com bfbluejays.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
uchscenturions.com uchscenturions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Nov 2019 65 days
uglyeaglesathletics.com uglyeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
unfinishedman.com unfinishedman.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
bikely.com bikely.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 78 days
unofficialnetworks.com unofficialnetworks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
bikez.com bikez.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
upownersclub.co.uk upownersclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
billiesathletics.com billiesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
binghamathletics.com binghamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
usanew.biz usanew.biz
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Jul 2019 One Off
usatodayhss.com usatodayhss.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
birdathletics.com birdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
utahconcealedcarry.com utahconcealedcarry.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bishopcanevinathletics.com bishopcanevinathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
bishopmoorecatholicathletics.com bishopmoorecatholicathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
bishopnollathletics.org bishopnollathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
vage7.com vage7.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
vaingloriouscomic.com vaingloriouscomic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 95 days
vangdata.mx vangdata.mx
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 150 days
varinaathletics.com varinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
vectisrugby.co.uk vectisrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
vcscrusaderathletics.com vcscrusaderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
vestaviahillsmagazine.com vestaviahillsmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 30 days
villaparkathletics.com villaparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Jan 2020 64 days
viral-centre.com viral-centre.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Sep 2019 102 days
viraltea.com viraltea.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 197 days
blpanthers.com blpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
blscots.org blscots.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
visordown.com visordown.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Jan 2020 186 days
blueovalfanatics.com blueovalfanatics.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vms4030.com vms4030.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vnnplayground.com vnnplayground.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
vnplus.online vnplus.online
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
bnext.com.tw bnext.com.tw
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
boards2go.com boards2go.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
boazathletics.com boazathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
vredprospects.ca vredprospects.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
vtcafe.com vtcafe.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
waconiaathletics.com waconiaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
walleyecentral.com walleyecentral.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
waploaded.com waploaded.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
boredpanda.com boredpanda.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
waylandunionwildcats.com waylandunionwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
bostonglobe.com bostonglobe.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
wbkr.com wbkr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wblk.com wblk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wcfcourier.com wcfcourier.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
wearebartlett.com wearebartlett.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wearemaranatha.com wearemaranatha.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wciu.com wciu.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
webdesignerdepot.com webdesignerdepot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
branchetoi.com branchetoi.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Feb 2020 Feb 2020 13 days
brcardinals.com brcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
weddingbee.com weddingbee.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
weide28.com weide28.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
wendelltrojansports.com wendelltrojansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wenonahdragonathletics.com wenonahdragonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wesleychapelathletics.com wesleychapelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
westbloomfieldathletics.com westbloomfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
westernpanthersports.com westernpanthersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
westfieldathletics.com westfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
wghawksactivities.com wghawksactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
whatinvestment.co.uk whatinvestment.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
whatismyipaddress.com whatismyipaddress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
broadwayworld.com broadwayworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
brockleycc.co.uk brockleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 86 days
wheelerbearcatsathletics.com wheelerbearcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
whhssports.com whhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
whsowls.com whsowls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wideopeneats.com wideopeneats.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 193 days
whittierdailynews.com whittierdailynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
whodatdish.com whodatdish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 165 days
bryanstationathletics.com bryanstationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
bswildcats.com bswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
winchesterfootballleague.co.uk winchesterfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 102 days
btw-athletics.com btw-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
buckeyebucks.org buckeyebucks.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 57 days
wiscnews.com wiscnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
buffzone.com buffzone.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
bulldogbreeds.com bulldogbreeds.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bunkersparadise.com bunkersparadise.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
woodworkingtalk.com woodworkingtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
burgmanusa.com burgmanusa.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
burlesonathletics.com burlesonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
worldboxingnews.net worldboxingnews.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
wowhead.com wowhead.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
wpspanthers.com wpspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wrenhurricanesathletics.com wrenhurricanesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wrhsfalcons.com wrhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wrxforums.com wrxforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wtug.com wtug.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
byroncentersports.com byroncentersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wzozfm.com wzozfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
cadetathletics.com cadetathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
wxwildcats.com wxwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
wycombesaintsfc.org.uk wycombesaintsfc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 103 days
wyomingwolvesathletics.com wyomingwolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
cagepages.com cagepages.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
xdtalk.com xdtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xclassforums.com xclassforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xcrforum.com xcrforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xfsportbrakeforum.com xfsportbrakeforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
camberleycc.co.uk camberleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 87 days
camdenfutsalleague.co.uk camdenfutsalleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 87 days
capiac.org capiac.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
yarn.co yarn.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
carpaymentcalculator.net carpaymentcalculator.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
yorktownathletics.com yorktownathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Nov 2019 65 days
casecoltingersoll.com casecoltingersoll.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
caspercowboy.com caspercowboy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
cbbtoday.com cbbtoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
ccvpioneers.com ccvpioneers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
celebritax.com celebritax.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
cfallsathletics.org cfallsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
cfcsblueflashes.com cfcsblueflashes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
cfhspanthers.com cfhspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
ziperto.com ziperto.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
zoioi.com zoioi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
chatib.us chatib.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
cheapeatsthriftycrafts.com cheapeatsthriftycrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
cheftalk.com cheftalk.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
chevroletcruze.net chevroletcruze.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chhsathletics.com chhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
christfirstforum.com christfirstforum.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 23 days
chrono14.com chrono14.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
chsathletics.net chsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 130 days
chscolts.org chscolts.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
chsgreyhounds.com chsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
hawkeyesathletics.com hawkeyesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cincinnatichristianathletics.org cincinnatichristianathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 66 days
cirangers.org cirangers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
clarencevilleathletics.com clarencevilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Nov 2019 65 days
clemsonsportstalk.com clemsonsportstalk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Nov 2019 162 days
clubtouareg.com clubtouareg.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
clyfa.co.uk clyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 277 days
cnwhc.co.uk cnwhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
coffmanathletics.net coffmanathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
collegefootballpoll.com collegefootballpoll.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
coloradohometownweekly.com coloradohometownweekly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
cometsgalaxy.com cometsgalaxy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
compacttractorreview.com compacttractorreview.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
coogs4life.net coogs4life.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
cookstr.com cookstr.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
coppellathletics.com coppellathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
coppercountrynews.com coppercountrynews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 316 days
cordeledispatch.com cordeledispatch.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
cosbytitansathletics.com cosbytitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
countryfile.com countryfile.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
covenantathletics.org covenantathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 190 days
craigmontathletics.com craigmontathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 67 days
creatework.com creatework.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
creativesports2.com creativesports2.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
cricket365.com cricket365.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
cricketforum.com cricketforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
cricketnmore.com cricketnmore.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
cruzetalk.com cruzetalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cryptoglobe.com cryptoglobe.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 123 days
crzforum.com crzforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
cupertinoathletics.com cupertinoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
customtacos.com customtacos.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cvaviators.com cvaviators.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cvilleathletics.com cvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cvjags.com cvjags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cwmods.com cwmods.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
cyclingnews.com cyclingnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 77 days
cyclingplus.com cyclingplus.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Aug 2019 89 days
cyclonefanatic.com cyclonefanatic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
dailyddt.com dailyddt.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
dailyentertainmentnews.com dailyentertainmentnews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
dailyfreeman.com dailyfreeman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
dailyhodl.com dailyhodl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 148 days
dailyjournalonline.com dailyjournalonline.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
dailytreat.net dailytreat.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
dailytribune.com dailytribune.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dawgpost.com dawgpost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 165 days
defensenews.com defensenews.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
deperedeacons.com deperedeacons.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Feb 2020 238 days
deportivo365.com deportivo365.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
dha.com.tr dha.com.tr
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
dhscats.com dhscats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dhsswarminhornets.com dhsswarminhornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dhsvikingsports.com dhsvikingsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 123 days
diabetesforum.com diabetesforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dieselplace.com dieselplace.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
digitalcameraworld.com digitalcameraworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
dividendchannel.com dividendchannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 124 days
dixonramsathletics.com dixonramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Sep 2019 59 days
dodge-nitro.com dodge-nitro.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dodgersnation.com dodgersnation.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
dokry.com dokry.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 5 days
domino.com domino.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
donfelixspm.com donfelixspm.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Feb 2020 Feb 2020 6 days
dovikingsathletics.com dovikingsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
downeyathletics.com downeyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dpsmarshallathletics.com dpsmarshallathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dpsmeadowdaleathletics.com dpsmeadowdaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dpsponitzathletics.com dpsponitzathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dreadnaughtathletics.com dreadnaughtathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dreamjob.ma dreamjob.ma
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 67 days
drriders.com drriders.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
dunlapeaglesathletics.com dunlapeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dunya.com.pk dunya.com.pk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Aug 2019 91 days
dwightmorrowraiders.com dwightmorrowraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
eaglevilleschoolathletics.com eaglevilleschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 67 days
eastathletics.org eastathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
eastlancsleague.com eastlancsleague.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 92 days
eastthunderhawks.com eastthunderhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
eauclaireathletics.org eauclaireathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
ecaathletics.org ecaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
edgewoodmustangsathletics.com edgewoodmustangsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
efthunderbirds.com efthunderbirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
ehcsathletics.com ehcsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 131 days
ehs-tigers.com ehs-tigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
elgrafico.com elgrafico.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
elmsathletics.org elmsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
elmundo.es elmundo.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
elmwoodparkathletics.com elmwoodparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
elsegundoathletics.com elsegundoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
eltiempolv.com eltiempolv.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Dec 2019 168 days
eltrecetv.com.ar eltrecetv.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
eluniversal.com.mx eluniversal.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
eprice.com.tw eprice.com.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
eptrail.com eptrail.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
equestriadaily.com equestriadaily.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
escapefanatics.com escapefanatics.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Mar 2020 102 days
esoui.com esoui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
espnrichmond.com espnrichmond.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
esportslatest.com esportslatest.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
eutawstreetreport.com eutawstreetreport.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
evansathletics.com evansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
evansvillenorthathletics.com evansvillenorthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
evilexposed.org evilexposed.org
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
ewrestlingnews.com ewrestlingnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
excelbasketball.ca excelbasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Mar 2020 Mar 2020 One Off
exchange4media.com exchange4media.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
excite.es excite.es
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
exmouthrugby.co.uk exmouthrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
fabwags.com fabwags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
fairfieldathletics.org fairfieldathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
farmflavor.com farmflavor.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
fbschedules.com fbschedules.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
fclionathletics.com fclionathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
femalefirstly.com femalefirstly.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Feb 2020 Feb 2020 One Off
hawtcelebs.com hawtcelebs.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 175 days
fhcrangers.com fhcrangers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
fhs-warriors.com fhs-warriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
fiat500owners.com fiat500owners.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fightbookmma.com fightbookmma.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
figures.com figures.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
findatopdoc.com findatopdoc.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 178 days
firsttoknow.com firsttoknow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 110 days
fisherstigersathletics.com fisherstigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
football365.com football365.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Sep 2019 104 days
fordmuscleforums.com fordmuscleforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fordstnation.com fordstnation.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fortune.com fortune.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
freelandfc.co.uk freelandfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 45 days
friendlyathletics.org friendlyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
frontieracademyathletics.com frontieracademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
frontierathletics.com frontierathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 130 days
frugalgardening.com frugalgardening.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
frugalvillage.com frugalvillage.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fsusathletics.com fsusathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
fun1043.com fun1043.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
fwoe.club fwoe.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 96 days
gaborone2014.com gaborone2014.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
gaithersburgathletics.com gaithersburgathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gamefishin.com gamefishin.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gazettetimes.com gazettetimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
gcak12athletics.org gcak12athletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gcaspartansports.com gcaspartansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gchscougars.com gchscougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gcmpatriots.com gcmpatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
geektyrant.com geektyrant.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
gestion.pe gestion.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
ghnorthernoaksathletics.org ghnorthernoaksathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
glendaleprepathletics.com glendaleprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
glennathletics.com glennathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
glenoakathletics.org glenoakathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gmdietworks.com gmdietworks.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
goaviatorsathletics.com goaviatorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gobearcats.org gobearcats.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gobgnsports.com gobgnsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gobigredathletics.com gobigredathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
gobluecats.com gobluecats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocabeacons.com gocabeacons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocaliforniaathletics.com gocaliforniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocanebayathletics.net gocanebayathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocentralindians.com gocentralindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goclarkathletics.com goclarkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gofobo.com gofobo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
gohalth.com gohalth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
gohermleigh.com gohermleigh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goherronathletics.com goherronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gohornetsathletics.com gohornetsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
gokanelandknights.com gokanelandknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goknightsathletics.com goknightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
golakeviewsports.com golakeviewsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
golamarmustangs.com golamarmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
golf365.com golf365.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
golfwrx.com golfwrx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
gomhswarhawks.com gomhswarhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gomightyarabs.com gomightyarabs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 124 days
gomustangathletics.com gomustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
goody25.com goody25.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Dec 2019 173 days
gopantherathletics.com gopantherathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gopaolirams.com gopaolirams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gophoenixathletics.com gophoenixathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goportageindians.com goportageindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
gorangernation.com gorangernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gordonleeathletics.com gordonleeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goredknightathletics.org goredknightathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gorocketpride.com gorocketpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
goroyalsgo.net goroyalsgo.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gosachristian.org gosachristian.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goslicers.com goslicers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gotjpatsathletics.com gotjpatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gotouchi-i.jp gotouchi-i.jp
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Dec 2019 Dec 2019 One Off
govalhalla.org govalhalla.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
govikingathletics.com govikingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gowestfieldathletics.com gowestfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
goyellowjacketsathletics.com goyellowjacketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gridironexperts.com gridironexperts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
gridironnow.net gridironnow.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 50 days
gromforum.com gromforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
gstitans.com gstitans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
guiaturista.es guiaturista.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
gundameclipse.net gundameclipse.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
gvgatorathletics.com gvgatorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hancockcountyathletics.com hancockcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
haraiders.com haraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
haslemererugby.co.uk haslemererugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
hauntforum.com hauntforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hboilersports.com hboilersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
hcbeavers.org hcbeavers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hchshornets.com hchshornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hddmag.com hddmag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
hdmatches.com hdmatches.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
hdyfl.co.uk hdyfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
headcoachranking.com headcoachranking.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
hellobarbados.com hellobarbados.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobellflower.com hellobellflower.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloblueisland.com helloblueisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobossier.com hellobossier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobrowndeer.com hellobrowndeer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobrownwood.com hellobrownwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloceres.com helloceres.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloclemmons.com helloclemmons.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocookeville.com hellocookeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocortland.com hellocortland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocorvallis.com hellocorvallis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloculpeper.com helloculpeper.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeastcleveland.com helloeastcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeaston.com helloeaston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellofarmington.com hellofarmington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloflowermound.com helloflowermound.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogallup.com hellogallup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogautier.com hellogautier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogreeley.com hellogreeley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogreenwood.com hellogreenwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloherndon.com helloherndon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohinesville.com hellohinesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohuntley.com hellohuntley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokefalonia.com hellokefalonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellokentwood.com hellokentwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokerrville.com hellokerrville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokiryasjoel.com hellokiryasjoel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolakejackson.com hellolakejackson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolawton.com hellolawton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellolayton.com hellolayton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolewiston.com hellolewiston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolibertyville.com hellolibertyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellolisle.com hellolisle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolittlechute.com hellolittlechute.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolovespark.com hellolovespark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomadisonville.com hellomadisonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomapleheights.com hellomapleheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellomartinsville.com hellomartinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomarylandheights.com hellomarylandheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomiddleton.com hellomiddleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellomissoula.com hellomissoula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomountclemens.com hellomountclemens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomountwashington.com hellomountwashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomurfreesboro.com hellomurfreesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorthcharleston.com hellonorthcharleston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakley.com hellooakley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloopryland.com helloopryland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooregon.com hellooregon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopapillion.com hellopapillion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopayson.com hellopayson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopicorivera.com hellopicorivera.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportlandme.com helloportlandme.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportlandor.com helloportlandor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportorange.com helloportorange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloranchomirage.com helloranchomirage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloreading.com helloreading.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorhodes.com hellorhodes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorichardson.com hellorichardson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloridgeland.com helloridgeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorockyriver.com hellorockyriver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloruston.com helloruston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellosaintcloud.com hellosaintcloud.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintmatin.com hellosaintmatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosantamaria.com hellosantamaria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloshakerheights.com helloshakerheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloshermanoaks.com helloshermanoaks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloskokievillage.com helloskokievillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellospokanevalley.com hellospokanevalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellospringboro.com hellospringboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
hellostaunton.com hellostaunton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostockton.com hellostockton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostoughton.com hellostoughton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosumter.com hellosumter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellothomasville.com hellothomasville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotitusville.com hellotitusville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowasco.com hellowasco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowentzville.com hellowentzville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestminster.com hellowestminster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowheatridge.com hellowheatridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowilkes-barre.com hellowilkes-barre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowillmar.com hellowillmar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
henryclayathletics.com henryclayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
heritagenews.com heritagenews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
hesperiaathletics.com hesperiaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hgfpl.co.uk hgfpl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
hhihsathletics.org hhihsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hiepsiduongpho.com hiepsiduongpho.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
hightownjfl.co.uk hightownjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
hillcrestathletics.org hillcrestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hillcrestknightsathletics.com hillcrestknightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hinkleyathletics.com hinkleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hipertextual.com hipertextual.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 34 days
hipfonts.com hipfonts.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
hipointfirearmsforums.com hipointfirearmsforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
histdata.com histdata.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Mar 2020 99 days
hitched.com.au hitched.com.au
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
hket.com hket.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 34 days
hollywoodhiccups.com hollywoodhiccups.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
homebrewtalk.com homebrewtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
hooverhighathletics.com hooverhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hopevalleyleague.co.uk hopevalleyleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 286 days
hotrodders.com hotrodders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
houlihansbirkenheadsundayleague.co.uk houlihansbirkenheadsundayleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
houstonchronicle.com houstonchronicle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
howtoadult.com howtoadult.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 98 days
hrmladiesfastball.ca hrmladiesfastball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 321 days
hrvathletics.com hrvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
htvnativeadsolutions.com htvnativeadsolutions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Jun 2019 48 days
hudsonvilleathletics.com hudsonvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
huffmanhighschoolathletics.com huffmanhighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
huntingpa.com huntingpa.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hurricanesathletics.com hurricanesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
iccpathletics.org iccpathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
idcfl.co.uk idcfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 285 days
iknowthescore.co.uk iknowthescore.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
ilovejeangrey.com ilovejeangrey.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Dec 2019 Dec 2019 One Off
impalaforums.com impalaforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
independent.co.uk independent.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
information-age.com information-age.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
kboards.com kboards.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
iphonehacks.com iphonehacks.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
ipmsireland.com ipmsireland.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Dec 2019 One Off
iptvplayerguide.com iptvplayerguide.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 61 days
irabulldogs.org irabulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
irishsportsdaily.com irishsportsdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Nov 2019 150 days
irtv24.tv irtv24.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
jagathletics.us jagathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 126 days
jaguarcountry.org jaguarcountry.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 126 days
jdvolsathletics.com jdvolsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jeepcommander.com jeepcommander.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jetswhiteout.com jetswhiteout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 192 days
jettajunkie.com jettajunkie.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jewishlinkbwc.com jewishlinkbwc.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Dec 2019 One Off
jgathletics.org jgathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jichsathletics.com jichsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jpecfalcons.com jpecfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 125 days
jukeforums.com jukeforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
justinalba.com justinalba.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
jwnorthathletics.org jwnorthathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kalkaskaathletics.com kalkaskaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kashmereathletics.com kashmereathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kayakfishingforum.com kayakfishingforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kearsleyhornets.org kearsleyhornets.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
keyj.com keyj.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kffl.com kffl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Nov 2019 169 days
khak.com khak.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kiatrailsterforum.com kiatrailsterforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kicksologists.com kicksologists.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
kimbertalk.com kimbertalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kmmsam.com kmmsam.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
knue.com knue.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kooooak.site kooooak.site
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 92 days
kpel965.com kpel965.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ksenam.com ksenam.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ksisradio.com ksisradio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
kwknights.com kwknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lacrossepei.ca lacrossepei.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 216 days
lagrangenews.com lagrangenews.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
lahstoppers.com lahstoppers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lakegenevanews.net lakegenevanews.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
lakenonaathletics.org lakenonaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lamarcountyathletics.com lamarcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lamarvikings.net lamarvikings.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 125 days
laplataathletics.org laplataathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
laramielive.com laramielive.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
lavandos.pro lavandos.pro
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jun 2019 Mar 2020 267 days
lccathletics.com lccathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
learnodo-newtonic.com learnodo-newtonic.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Nov 2019 Nov 2019 One Off
lebanonathletics.com lebanonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
lebanonathletics.org lebanonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 61 days
lebanonwarriorathletics.com lebanonwarriorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
legacygt.org legacygt.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
leoaffairs.com leoaffairs.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 145 days
leopardathletics.org leopardathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lfcdata.co.uk lfcdata.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 98 days
lfhyhg.net lfhyhg.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
lhhighlanderathletics.com lhhighlanderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lhs-trojans.com lhs-trojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
libertyproject.com libertyproject.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 51 days
lickingvalleyathletics.com lickingvalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
lidarradar.com lidarradar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
limaspartannation.org limaspartannation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
lisburnjuniorfootballleague.co.uk lisburnjuniorfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 279 days
listegaleri.com listegaleri.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
livestrong.com livestrong.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
ljhuskyathletics.com ljhuskyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lmhaonline.com lmhaonline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
lmtonline.com lmtonline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
lolakers.com lolakers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 124 days
londonjuniormustangs.com londonjuniormustangs.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
lorainathletics.org lorainathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
loretteminorhockey.com loretteminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
lorettoacademyathletics.com lorettoacademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
lowellsun.com lowellsun.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
lphsathletics.net lphsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lshsactivities.com lshsactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 126 days
ltr450hq.com ltr450hq.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ludlowathletics.org ludlowathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lumpkincoathletics.com lumpkincoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
luxury4play.com luxury4play.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
lvhswildcatathletics.com lvhswildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 124 days
lyricscraze.com lyricscraze.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Mar 2020 215 days
macdonaldhockey.ca macdonaldhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 116 days
magicvalley.com magicvalley.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
malaysiakini.com malaysiakini.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
managertoday.com.tw managertoday.com.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
mannshouji.com mannshouji.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
manoramaonline.com manoramaonline.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
marauderathletics.com marauderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
marauderathletics.org marauderathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
matadorsportsproperties.com matadorsportsproperties.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
matichon.co.th matichon.co.th
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
mazda3revolution.com mazda3revolution.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mazda6club.com mazda6club.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mazdaworld.org mazdaworld.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mchsathletics.com mchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mckayathletics.com mckayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mcmichaelathletics.com mcmichaelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mcs-athletics.com mcs-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 123 days
mcseagles.org mcseagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
medicaldaily.com medicaldaily.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Nov 2019 121 days
medyafaresi.com medyafaresi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 58 days
melfortminorhockey.ca melfortminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 185 days
memphisathletics.com memphisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
menaulsports.com menaulsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mesquiteathletics.com mesquiteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
messletters.com messletters.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
metasrc.com metasrc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 276 days
mgsforums.com mgsforums.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
mhspioneers.com mhspioneers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 127 days
miamisburgathletics.com miamisburgathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
michigan-sportsman.com michigan-sportsman.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
micromaxinfo.com micromaxinfo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 209 days
mid-carolinaathletics.com mid-carolinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
middletownathletics.com middletownathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 59 days
middletownpress.com middletownpress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
migweb.co.uk migweb.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
milacawolves.com milacawolves.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
milanathletics.com milanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
milfordmavs.com milfordmavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
militarytimes.com militarytimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
mix1043fm.com mix1043fm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
mksdrivers.com mksdrivers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mlspartanathletics.org mlspartanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 127 days
mmmarauders.com mmmarauders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mmoui.com mmoui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
monashoressports.com monashoressports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
moodspike.com moodspike.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
moovimex.com moovimex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
motorcycleforums.net motorcycleforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mountainbuzz.com mountainbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mpanthers.com mpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mqtblazers.com mqtblazers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 122 days
mrhssentinels.org mrhssentinels.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 128 days
msbbulldogs.com msbbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
mtcssports.com mtcssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
mulberryathletics.com mulberryathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
murrayhsathletics.com murrayhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
musicstack.com musicstack.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 124 days
muyhistoria.es muyhistoria.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 150 days
muynegociosyeconomia.es muynegociosyeconomia.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
mvcmustangs.com mvcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
mwwire.com mwwire.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 275 days
myjeepcompass.com myjeepcompass.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mymbonline.com mymbonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
myplainview.com myplainview.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
myrtlebeachseahawkathletics.com myrtlebeachseahawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
mzbulldogs.com mzbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 63 days
napavalleyregister.com napavalleyregister.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
nbskolvikings.com nbskolvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 122 days
nerds.co nerds.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 49 days
nesn.com nesn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
nevadapreps.com nevadapreps.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jul 2019 29 days
new-life-skin.com new-life-skin.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
newarena.com newarena.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 114 days
newberryobserver.com newberryobserver.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Nov 2019 Nov 2019 One Off
newsd.co newsd.co
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jun 2019 Dec 2019 190 days
nfraidersathletics.com nfraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
nhs-cougars.com nhs-cougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
nhsgladiatorsathletics.com nhsgladiatorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
nilesathletics.com nilesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
nissanversaforums.com nissanversaforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
njblackhawks.com njblackhawks.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Oct 2019 Oct 2019 One Off
nmk.world nmk.world
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
nnn88.net nnn88.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
nodakoutdoors.com nodakoutdoors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
northwesterntrojans.org northwesterntrojans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
npftv.com npftv.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 236 days
nudaforums.com nudaforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
nuklearpower.com nuklearpower.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
nwmounties.com nwmounties.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
oakridgeathletics.org oakridgeathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ochsathletics.com ochsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
oclancerathletics.com oclancerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
oghspatriots.com oghspatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ohsathletics.org ohsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ohscardinals.com ohscardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ohswolverines.com ohswolverines.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 121 days
olentangybravesathletics.com olentangybravesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
olentangyorangeathletics.com olentangyorangeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
olmstedfallsathletics.net olmstedfallsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
omahabryanbears.com omahabryanbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
onebarb.com onebarb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
ontarioathletics.org ontarioathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
oola.com oola.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
opelikaathletics.com opelikaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 128 days
opslens.com opslens.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 83 days
oxigeno.com.pe oxigeno.com.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 143 days
pacificwaverider.com pacificwaverider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
paintbranchathletics.org paintbranchathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
palaciosathletics.com palaciosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Jan 2020 66 days
panews.com panews.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
pantagraph.com pantagraph.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
paolahighschoolathletics.com paolahighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
papercraftinspirationsmagazine.co.uk papercraftinspirationsmagazine.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
patsfans.com patsfans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
pawofthetiger.com pawofthetiger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
rhylanddistrictsundayleague.co.uk rhylanddistrictsundayleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 163 days
rhsfalcons.com rhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
pcactivities.com pcactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pcahsathletics.com pcahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 120 days
pcpatriotsports.com pcpatriotsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pdhsaztecs.com pdhsaztecs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pdslstoke.co.uk pdslstoke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
pelhamhighathletics.com pelhamhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pendletonathletics.com pendletonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pentastars.com pentastars.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
riftui.com riftui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 269 days
rimathleticsactivities.com rimathleticsactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
ripewithdecay.com ripewithdecay.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
personalwatercraft.com personalwatercraft.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
petguide.com petguide.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
phlniagara.com phlniagara.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Oct 2019 Mar 2020 145 days
phsterrors.org phsterrors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
physicsandmathstutor.com physicsandmathstutor.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Feb 2020 110 days
pikstagram.com pikstagram.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Jul 2019 One Off
pioneerforums.com pioneerforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
piranha-fury.com piranha-fury.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
pjfrfc.co.uk pjfrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
planetisuzoo.com planetisuzoo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
plhsfightingpointers.com plhsfightingpointers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
plymouthchristianeagles.com plymouthchristianeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pnwriders.com pnwriders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Feb 2020 282 days
pocketpence.co.uk pocketpence.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
podcastrecap.com podcastrecap.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 45 days
poe.ninja poe.ninja
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 109 days
politifact.com politifact.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
pomonareddevilathletics.com pomonareddevilathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pottervilleathletics.com pottervilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
powerpyx.com powerpyx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 34 days
poynter.org poynter.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
practicalcaravan.com practicalcaravan.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 63 days
practicalmachinist.com practicalmachinist.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
praiseindy.com praiseindy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
prbucksports.com prbucksports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
riverforestathletics.com riverforestathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
riverhawkathletics.com riverhawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
rittmanathletics.org rittmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
preservationtalk.com preservationtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
psgtalk.com psgtalk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Feb 2020 119 days
ptpanthers.org ptpanthers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
ptwarriors.org ptwarriors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
punchngacc.com punchngacc.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
punjabijeevansathi.in punjabijeevansathi.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 115 days
puntomk2.co.uk puntomk2.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
qconline.com qconline.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Jul 2019 One Off
qctimes.com qctimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
quebec4x4.com quebec4x4.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
queenscountyminorhockey.com queenscountyminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Oct 2019 Mar 2020 143 days
rabbitathletics.com rabbitathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
radcliffefc.com radcliffefc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
radiotimes.com radiotimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
ramonaathletics.com ramonaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
rangeroversport.org rangeroversport.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rap-up.com rap-up.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
rawstory.com rawstory.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
readcricket.com readcricket.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readfulham.com readfulham.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readhuddersfield.com readhuddersfield.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readmanutd.com readmanutd.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readtv.co readtv.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readwsl.com readwsl.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
rebelrun.ca rebelrun.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 May 2019 One Off
recipepair.com recipepair.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
redarrowathletics.com redarrowathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
redtri.com redtri.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
reference.com reference.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Jan 2020 66 days
reichohnearbeit.com reichohnearbeit.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jul 2019 Jul 2019 One Off
reitzmemorialathletics.com reitzmemorialathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Feb 2020 53 days
renaultcapturforum.com renaultcapturforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
armfilm.co armfilm.co
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
rnbcincy.com rnbcincy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
rnbphilly.com rnbphilly.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Nov 2019 63 days
rnhl.ca rnhl.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Aug 2019 Feb 2020 181 days
roeperathletics.org roeperathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
rogerbaconspartans.org rogerbaconspartans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 181 days
rollsroyceforums.com rollsroyceforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ronaldo7.net ronaldo7.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Jul 2019 One Off
abxzone.com abxzone.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
ronproject.com ronproject.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
roughingafterthewhistle.com roughingafterthewhistle.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 40 days
roughmaps.com roughmaps.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 115 days
rsdiva.com rsdiva.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 40 days
rubidouxathletics.com rubidouxathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
bostonterrierforums.com bostonterrierforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
russellstreetreport.com russellstreetreport.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
rvitch.com rvitch.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sabreathletics.org sabreathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
saguaroathletics.com saguaroathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 118 days
aahuronathletics.com aahuronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 121 days
adrenalease.ca adrenalease.ca
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
saratogian.com saratogian.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
saturnspot.com saturnspot.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
savagehumans.com savagehumans.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
addatoday.com addatoday.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 12 days
addisonathletics.com addisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
addtobuy.com addtobuy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
sciencealert2014.com sciencealert2014.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
scrigroup.com scrigroup.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
agreatertown.com agreatertown.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
searchtempest.com searchtempest.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jul 2019 29 days
ahlynews.com ahlynews.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
airlinepilotforums.com airlinepilotforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
ajhsprospectors.org ajhsprospectors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
akinseaglessports.com akinseaglessports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
sfhsdonsathletics.com sfhsdonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
alternativemissoula.com alternativemissoula.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
allacronyms.com allacronyms.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
altimaforums.net altimaforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
allaroundphilly.com allaroundphilly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
sherwoodathletics.org sherwoodathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
shjianzi.com shjianzi.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
showsnob.com showsnob.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
sicemdawgs.com sicemdawgs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
siliconvalley.com siliconvalley.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
silveradosierra.com silveradosierra.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sjajaguars.org sjajaguars.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
amandaclearcreekathletics.com amandaclearcreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
sjhsathletics.com sjhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
skidmore-tynanathletics.com skidmore-tynanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 181 days
skincaretalk.com skincaretalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
skyatnightmagazine.com skyatnightmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
skyscrapercity.com skyscrapercity.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sljzmf.com sljzmf.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
slkworld.com slkworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
slantmagazine.com slantmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
slsforums.com slsforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
smokinvette.com smokinvette.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
smhsathletics.com smhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 233 days
snathletics.com snathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 117 days
smtigers.com smtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 233 days
animanga.es animanga.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Jan 2020 171 days
socialanxietysupport.com socialanxietysupport.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
snowflakelobosathletics.com snowflakelobosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 180 days
animeshd.biz animeshd.biz
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
sodomojo.com sodomojo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
anitube.site anitube.site
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
sousvideguy.com sousvideguy.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
southchristiansports.com southchristiansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
southdearbornathletics.com southdearbornathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
android-x86.org android-x86.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
androidheadlines.com androidheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
spaceanswers.com spaceanswers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 175 days
spellcheck.net spellcheck.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
spjfl.co.uk spjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 230 days
sportscastr.com sportscastr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 266 days
apartmentratings.com apartmentratings.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
sprayberryathletics.com sprayberryathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
springbrookathletics.org springbrookathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
springfieldlocalathletics.com springfieldlocalathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
srtforums.com srtforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
srufc.com srufc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
sravnigama.com.ru sravnigama.com.ru
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
srfalcons.org srfalcons.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
ssrfanatic.com ssrfanatic.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
astrosafari.com astrosafari.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
astucessympa.com astucessympa.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
009854.com 009854.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
014105.com 014105.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
014191.com 014191.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
014837.com 014837.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
stclairgreengiants.com stclairgreengiants.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Mar 2020 Mar 2020 20 days
stevesnovasite.com stevesnovasite.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
1037thepeak.com 1037thepeak.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
1039thedoc.com 1039thedoc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
103gbfrocks.com 103gbfrocks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stitchandunwind.com stitchandunwind.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
1043wowcountry.com 1043wowcountry.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1049theedge.com 1049theedge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
1053rnb.com 1053rnb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1061evansville.com 1061evansville.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1075zoofm.com 1075zoofm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
107jamz.com 107jamz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
stltoday.com stltoday.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
stmaknights.com stmaknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
123telugu.com 123telugu.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 13 days
stourbridgefc.com stourbridgefc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
13wmaz.com 13wmaz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
1460espnyakima.com 1460espnyakima.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ststephensathletics.org ststephensathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
stthomasringette.ca stthomasringette.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
178pjw.com 178pjw.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 58 days
stupiddope.com stupiddope.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
suijurisforum.com suijurisforum.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
abc-7.com abc-7.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
summervilleathletics.com summervilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
abqjournal.com abqjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Nov 2019 Mar 2020 120 days
superstreetbike.com superstreetbike.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
supertalk1270.com supertalk1270.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
aegean-travel.com aegean-travel.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
ahscolts.net ahscolts.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
svconline.com svconline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 186 days
ajfl.org.uk ajfl.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 268 days
alagnathletics.com alagnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 122 days
swanseatigersathletics.com swanseatigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
albertonews.com albertonews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Jan 2020 66 days
sweepon.com sweepon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
svg.com svg.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
svha.ca svha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
allfordmustangs.com allfordmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
allfreecrochet.com allfreecrochet.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
amarujalatv.com amarujalatv.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 108 days
androidpit.com androidpit.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
szokco.cc szokco.cc
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
animesonlinebr.site animesonlinebr.site
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 46 days
annapolisathletics.com annapolisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
ansonrecord.com ansonrecord.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Sep 2019 One Off
tagup.net tagup.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 35 days
talkaboutmarriage.com talkaboutmarriage.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
arcadesushi.com arcadesushi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tascosarebels.org tascosarebels.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
tasteofhome.com tasteofhome.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
tbirdathletics.com tbirdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
tcnathletics.com tcnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 233 days
teamerstg.net teamerstg.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 100 days
arizonagunowners.com arizonagunowners.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tdn.com tdn.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
arkansashunting.net arkansashunting.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
techhive.com techhive.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
arlingtonlionsathletics.com arlingtonlionsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 187 days
telehit.com telehit.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Jan 2020 One Off
teleantillas.com.do teleantillas.com.do
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 205 days
tempostorm.com tempostorm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Sep 2019 One Off
tenisguru.com tenisguru.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 50 days
australiangeographic.com.au australiangeographic.com.au
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 244 days
terrificpets.com terrificpets.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
teslegends.pro teslegends.pro
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 34 days
auto123.com auto123.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
autoguide.com autoguide.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
autoproyecto.com autoproyecto.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
tfpdl.online tfpdl.online
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
autos101.com autos101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
theakforum.net theakforum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
avforums.com avforums.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
avhshawkathletics.com avhshawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
thebassbarn.com thebassbarn.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thebestdessertrecipes.com thebestdessertrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
theboot.com theboot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
thebullamarillo.com thebullamarillo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
thecouponingcouple.com thecouponingcouple.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
thefw.com thefw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
ayalasports.com ayalasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Jan 2020 65 days
baadultsoftball.com baadultsoftball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Jul 2019 84 days
thereporteronline.com thereporteronline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
therichest.com therichest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
thesixersense.com thesixersense.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
thesurfersview.com thesurfersview.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 257 days
thetandd.com thetandd.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
theteam980.com theteam980.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
thevog.net thevog.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thoughtcatalog.com thoughtcatalog.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
thscougarsathletics.com thscougarsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
tigernet.com tigernet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 231 days
timberlandathletics.com timberlandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 232 days
timesofsandiego.com timesofsandiego.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
timezoff.com timezoff.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Mar 2020 134 days
timvandevall.com timvandevall.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
tintero.com.ar tintero.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 75 days
tintucbaomoi.com tintucbaomoi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 19 days
tkathletics.com tkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
titannationathletics.com titannationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
titansized.com titansized.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
titantalk.com titantalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tivizor.ru tivizor.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tmba.ca tmba.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Nov 2019 One Off
barnorama.com barnorama.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
bartleby.com bartleby.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Jan 2020 65 days
baseballpress.com baseballpress.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 146 days
batesvilleathletics.com batesvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 188 days
top-law-schools.com top-law-schools.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-19139 Sep 2019 Jan 2020 130 days
topspeed.com topspeed.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
tosaeastathletics.com tosaeastathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 129 days
total76ers.com total76ers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalacc.com totalacc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 251 days
totalastros.com totalastros.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalbig10.com totalbig10.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalbrooklynnets.com totalbrooklynnets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Mar 2020 68 days
totalbuffalobills.com totalbuffalobills.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 251 days
totalcanucks.com totalcanucks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totaldiamondbacks.com totaldiamondbacks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalgeorgiasouthern.com totalgeorgiasouthern.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 250 days
totalknicks.com totalknicks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Nov 2019 One Off
totalnwa.com totalnwa.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 197 days
totaluconn.com totaluconn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
totalwhitesox.com totalwhitesox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 274 days
bcaquaria.com bcaquaria.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bcbay.com bcbay.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
tpathletics.org tpathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
bdpsports.com bdpsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 122 days
beartrapsummerfestival.com beartrapsummerfestival.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
beatgogo.com beatgogo.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
beatgogo.fr beatgogo.fr
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
beatgogo.pt beatgogo.pt
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
trib.com trib.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
trojannation.org trojannation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Jan 2020 One Off
trollebus.mx trollebus.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
truyencv.com truyencv.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
ttsreader.com ttsreader.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
tvilleathletics.com tvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 129 days
twincities.com twincities.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
twingoforum.co.uk twingoforum.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
twinpeakscharteracademyathletics.com twinpeakscharteracademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
bestcrosswords.com bestcrosswords.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 90 days
txlhhk.com txlhhk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
uber-facts.com uber-facts.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
ucclfootball.co.uk ucclfootball.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
uchsathletics.com uchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
bethcenterbulldogs.com bethcenterbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
uhnd.com uhnd.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 231 days
uhsathletics.org uhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
uhsutes.com uhsutes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
ukmlaforum.info ukmlaforum.info
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 31 days
ultimateclassicrock.com ultimateclassicrock.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
bhopalsamachar.com bhopalsamachar.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Nov 2019 65 days
bhpbears.com bhpbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
bhsathletics.org bhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
bhsbulldogs.com bhsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
biaobiao.xyz biaobiao.xyz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
upliftingtoday.com upliftingtoday.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
upperstclairathletics.com upperstclairathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 183 days
urbo.com urbo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
usaevent.com usaevent.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Jul 2019 One Off
usatoday.com usatoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
utdgilgeous.website utdgilgeous.website
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
uvskm.cn uvskm.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
uwatchfreetv.online uwatchfreetv.online
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
vahsathletics.com vahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
vchsathletics.com vchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
veloster.org veloster.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
black458.com black458.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Feb 2020 66 days
vermelhinhoba.com.br vermelhinhoba.com.br
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
blackhawkup.com blackhawkup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
blakeathletics.org blakeathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
bldaily.com bldaily.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bleepingcomputer.com bleepingcomputer.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
vietgiaitri.com vietgiaitri.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
viper5.com viper5.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vnnsportshub.net vnnsportshub.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 119 days
vmhsathletics.com vmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
vrsz.icu vrsz.icu
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
vwatlasforum.com vwatlasforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bobcatathletics.org bobcatathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
wainwrightminorball.ca wainwrightminorball.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
walesveteransfootball.co.uk walesveteransfootball.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 232 days
bogalusalumberjacks.org bogalusalumberjacks.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
wallaseyanddistrictsfl.co.uk wallaseyanddistrictsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 232 days
bogiceskating.com bogiceskating.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
boingboing.net boingboing.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 124 days
boisemusicfestival.com boisemusicfestival.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
waltherforums.com waltherforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bolde.com bolde.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Feb 2020 144 days
bollywoodlife.com bollywoodlife.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
bomurl.com bomurl.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
wareshoalsathletics.com wareshoalsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
bonnyvilleminorhockey.ca bonnyvilleminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 15 days
watch.bz watch.bz
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 261 days
wbktfm.com wbktfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wcbears.com wcbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wdathletics.com wdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Nov 2019 65 days
waukeshawarhawks.org waukeshawarhawks.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
waverlywarriorsathletics.com waverlywarriorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
boomsbeat.com boomsbeat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
wawaseeathletics.com wawaseeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wbckfm.com wbckfm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
wdwmagic.com wdwmagic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Nov 2019 65 days
wearecamdenhs.com wearecamdenhs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
weareccathletics.com weareccathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Jan 2020 65 days
weareul.org weareul.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Jan 2020 One Off
bostonherald.com bostonherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
bouldercityreview.com bouldercityreview.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Nov 2019 150 days
bowiebulldogathletics.com bowiebulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
webmd.com webmd.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Jan 2020 One Off
weboathletics.com weboathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
weddbook.com weddbook.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
bradleyathletics.org bradleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
brainjet.com brainjet.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
branchez-vous.com branchez-vous.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
westalbanybulldogs.com westalbanybulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wfhscoyoteathletics.com wfhscoyoteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
brhsjacketpride.com brhsjacketpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
wheatonknights.com wheatonknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wheelerwildcatathletics.com wheelerwildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
bridalmusings.com bridalmusings.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Nov 2019 Dec 2019 25 days
briha.org briha.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Nov 2019 110 days
whynews.com whynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
wicklowleague.com wicklowleague.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 232 days
wideopenpets.com wideopenpets.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 193 days
wideopenroads.com wideopenroads.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 193 days
wideopenspaces.com wideopenspaces.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 128 days
wiispace.com wiispace.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
wildaboutmovies.com wildaboutmovies.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
broomfieldenterprise.com broomfieldenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
wiree.live wiree.live
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bsfl.co.uk bsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 274 days
bssjaguars.com bssjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 122 days
wjathletics.org wjathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
wjon.com wjon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wmtornadoes.com wmtornadoes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 184 days
buckeyevalleyathletics.com buckeyevalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
buffalo.com buffalo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Mar 2020 189 days
buffalonews.com buffalonews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Mar 2020 124 days
wordlistresearch.com wordlistresearch.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 16 days
bulldogsathletics.com bulldogsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
worldsoccertalk.com worldsoccertalk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Mar 2020 175 days
writersbeat.com writersbeat.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 24 days
wrestletalk.com wrestletalk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 92 days
wrestlinginc.com wrestlinginc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
wrkr.com wrkr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
wrongfitmentcrew.com wrongfitmentcrew.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 27 days
wushengrui.xyz wushengrui.xyz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
wuzupnigeria.com wuzupnigeria.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 27 days
wxcowboys.com wxcowboys.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Jan 2020 130 days
bvbbuzz.com bvbbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
caaleague.org caaleague.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Feb 2020 Mar 2020 39 days
xsforums.com xsforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xsmn.me xsmn.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 61 days
xtdct.com xtdct.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
xtratime.org xtratime.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xtremerain.com xtremerain.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
yalalla.com yalalla.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 15 days
yamahaforum.com yamahaforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
canoncitydailyrecord.com canoncitydailyrecord.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
capacathletics.com capacathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
capecatfish.com capecatfish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
yhgj518.com yhgj518.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 15 days
henrycountyathletics.com henrycountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
carolinahuddle.com carolinahuddle.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
yojoe.com yojoe.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yorktonunitedfc.ca yorktonunitedfc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Sep 2019 Sep 2019 One Off
yourbump.com yourbump.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
yourdictionary.com yourdictionary.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
ypff.co.uk ypff.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
ypsigrizzlies.com ypsigrizzlies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
cavaliersnation.com cavaliersnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
cavemensports.com cavemensports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Nov 2019 Feb 2020 66 days
cavernaathletics.com cavernaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 188 days
zarlit.com zarlit.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 125 days
cbs58.com cbs58.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 175 days
zeebiz.com zeebiz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
ncraiders.com ncraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
cedarspringsathletics.com cedarspringsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
zgyijiaosuo.com zgyijiaosuo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ncregister.com ncregister.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
centralplainshockey.com centralplainshockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Feb 2020 Mar 2020 39 days
zone9lacrosse.ca zone9lacrosse.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
cfbstats.com cfbstats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 210 days
chargerforumz.com chargerforumz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
checkingcreditcard.com checkingcreditcard.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
chemics.net chemics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 120 days
chevelles.com chevelles.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chhshoops.com chhshoops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
my.is my.is
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chicagolandfishing.com chicagolandfishing.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chicoer.com chicoer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
chins-n-hedgies.com chins-n-hedgies.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 124 days
chippewa.com chippewa.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
chryslerminivan.net chryslerminivan.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chscougarathletics.com chscougarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Sep 2019 Feb 2020 130 days
churchillathletics.com churchillathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
cifras.com.br cifras.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jul 2019 Mar 2020 245 days
cincomas.com cincomas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 178 days
cinemakuruvi.com cinemakuruvi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
cio.com cio.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
civinfo.com civinfo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clackamasathletics.com clackamasathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
claireandjamie.com claireandjamie.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 48 days
clasificadospl.com clasificadospl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 59 days
clipd.com clipd.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
club4g.org club4g.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clubroadster.net clubroadster.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clubtread.com clubtread.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cmhornets.net cmhornets.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Dec 2019 123 days
coacht.com coacht.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
colourlovers.com colourlovers.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 146 days
company.directory company.directory
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8425488243879801 Jun 2019 Jun 2019 One Off
comstockparkathletics.com comstockparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
concordhsathletics.com concordhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 120 days
consumersearch.com consumersearch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Nov 2019 Nov 2019 One Off
contactmusic.com contactmusic.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
coolmaterial.com coolmaterial.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 245 days
copleyathletics.org copleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 189 days
corshamcc.co.uk corshamcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 39 days
cougarnation.us cougarnation.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 190 days
covathletics.org covathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 190 days
cowanathletics.com cowanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 190 days
cpgophers.com cpgophers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Feb 2020 190 days
cpmha.ca cpmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Dec 2019 76 days
crawleyrfc.com crawleyrfc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
creativebloq.com creativebloq.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
csgo-stats.com csgo-stats.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 Aug 2019 98 days
cssfl.org.uk cssfl.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 89 days
cucinare.tv cucinare.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 180 days
curioushistorian.com curioushistorian.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
cuyhtsathletics.com cuyhtsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cvhsgrizzlies.net cvhsgrizzlies.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cypresscreekathletics.com cypresscreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
cypruspiratesathletics.com cypruspiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
dailybulletin.com dailybulletin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
dailyholics.com dailyholics.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Aug 2019 Feb 2020 190 days
dcschoolathletics.org dcschoolathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
dealmaxx.net dealmaxx.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
deautos.com deautos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
delconewsnetwork.com delconewsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
dfwrestaurantweek.com dfwrestaurantweek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 149 days
diabetesjuntosxti.mx diabetesjuntosxti.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
nctsharknation.com nctsharknation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
dicksonathletics.com dicksonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dinsta.com dinsta.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
directhealthy.com directhealthy.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Feb 2020 Feb 2020 One Off
discoverwildlife.com discoverwildlife.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Jul 2019 78 days
diycentral.com diycentral.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
diychatroom.com diychatroom.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dmalouf.com dmalouf.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
dockathletics.org dockathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
dogspot.in dogspot.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Feb 2020 89 days
dovermercurysfl.co.uk dovermercurysfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 281 days
downersgrovesouthathletics.com downersgrovesouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dpsstiversathletics.com dpsstiversathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
draftsite.com draftsite.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
drhsjaguars.com drhsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
driffielddistrictafl.co.uk driffielddistrictafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 281 days
dronedj.com dronedj.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 91 days
dublinathletics.org dublinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dublinathletics.us dublinathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dukereport.com dukereport.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
dunkingwithwolves.com dunkingwithwolves.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
dutchtownathletics.com dutchtownathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
dzls56.com dzls56.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Dec 2019 Dec 2019 One Off
ecathletics.org ecathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
ectrojansathletics.com ectrojansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
edgewaterathletics.com edgewaterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
edgewoodcougarathletics.com edgewoodcougarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
edmidentity.com edmidentity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
eelsathletics.com eelsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 131 days
efstaging.com efstaging.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
egrfc.com egrfc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
egthunderbirds.com egthunderbirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
ehow.com.br ehow.com.br
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
einsteinathletics.org einsteinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
ekcowhitecapsfc.co.uk ekcowhitecapsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jun 2019 43 days
ekfalcons.com ekfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
elcaminoathletics.org elcaminoathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
elfinanciero.com.mx elfinanciero.com.mx
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 131 days
elnacional.com elnacional.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
elnashra.com elnashra.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 106 days
elranchodons.com elranchodons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
elrincondelmiedo.com elrincondelmiedo.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jun 2019 Aug 2019 50 days
eluniversal.com eluniversal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 59 days
eluniverso.com eluniverso.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
elwoodpanthers.net elwoodpanthers.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 131 days
epaperlokmat.in epaperlokmat.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
epochtimes.de epochtimes.de
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
eshsathletics.com eshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
esnacky.com esnacky.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
espn991.com espn991.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
estampas.com estampas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Mar 2020 59 days
evanneuh.design evanneuh.design
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Feb 2020 Feb 2020 3 days
evanstonathletics.com evanstonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
evoxforums.com evoxforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
expeditionportal.com expeditionportal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
extra.ec extra.ec
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 102 days
fadeawayworld.net fadeawayworld.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
fancycrave.com fancycrave.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
fancymicebreeders.com fancymicebreeders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
farmvilleherald.com farmvilleherald.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Feb 2020 23 days
favequilts.com favequilts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
fcgriffins.com fcgriffins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
fearandblood.com fearandblood.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 69 days
fentonathletics.org fentonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 191 days
fextralife.com fextralife.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 191 days
fiestast.net fiestast.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fightingeaglesports.org fightingeaglesports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
fikeathletics.com fikeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 123 days
filerathletics.com filerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
firearmstalk.com firearmstalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
fishersgateflyersfc.co.uk fishersgateflyersfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 95 days
fjcforums.com fjcforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
flywareagle.com flywareagle.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
fnforum.net fnforum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
folsomathletics.com folsomathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 130 days
footballoutsiders.com footballoutsiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
footballscoop.com footballscoop.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
fordforumsonline.com fordforumsonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
forumdaily.com forumdaily.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
fourfourcrew.com fourfourcrew.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 53 days
fourtitude.com fourtitude.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
frankenmuthathletics.com frankenmuthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
herald-review.com herald-review.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
friaryscouts.com friaryscouts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 60 days
fun107.com fun107.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
funbrk.com funbrk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 155 days
futboltotal.com.mx futboltotal.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 165 days
fvhsathletics.com fvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
gadsdencityathletics.com gadsdencityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gaffneyindiansathletics.com gaffneyindiansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gagadaily.com gagadaily.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Mar 2020 244 days
gamerescape.com gamerescape.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 66 days
gamespew.com gamespew.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Oct 2019 108 days
garawayathletics.com garawayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 190 days
gardencityathletics.com gardencityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 66 days
gardenersworld.com gardenersworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
gatesheadanddistrictsundayleague.co.uk gatesheadanddistrictsundayleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 286 days
gcshawks.com gcshawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
geardiary.com geardiary.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
georgiapacking.org georgiapacking.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 175 days
gifclub.net gifclub.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
gilberttigersathletics.com gilberttigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
gjhstigers.com gjhstigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
glaminati.com glaminati.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Aug 2019 One Off
globegazette.com globegazette.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
glockforum.com glockforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
goadamscentralathletics.com goadamscentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goaledobearcats.com goaledobearcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
gobeavertonbeavers.com gobeavertonbeavers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
gobigredknox.com gobigredknox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
goblackshirts.com goblackshirts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goc8.net goc8.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
gocardinalritter.org gocardinalritter.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocelts.com gocelts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gocentralsports.com gocentralsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goclementsfootball.com goclementsfootball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goclspartans.org goclspartans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
godinezathletics.com godinezathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 129 days
goeasterneagles.org goeasterneagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gofalconathletics.com gofalconathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gofalconsports.org gofalconsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goganders.com goganders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gogetaroomie.com gogetaroomie.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 24 days
gohammondathletics.com gohammondathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goheritage.org goheritage.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gohhshurricanes.com gohhshurricanes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gohowebulldogs.net gohowebulldogs.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gokennedycavs.com gokennedycavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gomaroonsathletics.com gomaroonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gonorthridgevikings.com gonorthridgevikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goplymouthathletics.com goplymouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gorajahs.com gorajahs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gorebelsathletics.com gorebelsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goriversideathletics.com goriversideathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gosabercatsgo.com gosabercatsgo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
goscarboroughspartans.com goscarboroughspartans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 60 days
govikingsathletics.com govikingsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gowbmillers.com gowbmillers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gowildcatactivities.com gowildcatactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
gowildcatsathletics.com gowildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 65 days
greatheartsirvingathletics.org greatheartsirvingathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
grocerycouponguide.com grocerycouponguide.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
groceryshopforfree.com groceryshopforfree.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 56 days
grubstreet.com grubstreet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 210 days
guacamoley.com guacamoley.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 157 days
guiadelnino.com guiadelnino.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
guiadelocio.com guiadelocio.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 321 days
guiamicasamiento.com guiamicasamiento.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
guiaturista.com.mx guiaturista.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
gunandgame.com gunandgame.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
gunnerforum.com gunnerforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
guyspeed.com guyspeed.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
gwcarversports.com gwcarversports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
haftrhawks.com haftrhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Oct 2019 One Off
hailvarsity.com hailvarsity.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Sep 2019 55 days
halloweenforum.com halloweenforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
handgunsandammunition.com handgunsandammunition.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hcaeaglessports.org hcaeaglessports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hcbeavers.net hcbeavers.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
healthprep.com healthprep.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jun 2019 One Off
helloalbertville.com helloalbertville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloames.com helloames.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloappleton.com helloappleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloashwaubenon.com helloashwaubenon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobarnstable.com hellobarnstable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobellgardens.com hellobellgardens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloberkeley.com helloberkeley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobigspring.com hellobigspring.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobrawley.com hellobrawley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloclifton.com helloclifton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloclinton.com helloclinton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocollegestation.com hellocollegestation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeasley.com helloeasley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloedgewater.com helloedgewater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelpasoderobles.com helloelpasoderobles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloelyria.com helloelyria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloeustis.com helloeustis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloevergreenpark.com helloevergreenpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloferguson.com helloferguson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloferndale.com helloferndale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellofountainvalley.com hellofountainvalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellogodfrey.com hellogodfrey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellograndjunction.com hellograndjunction.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellogrenadines.com hellogrenadines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohaines.com hellohaines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohibbing.com hellohibbing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellohuntington.com hellohuntington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellojefferson.com hellojefferson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellojurupavalley.com hellojurupavalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokernersville.com hellokernersville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellokettering.com hellokettering.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokirksville.com hellokirksville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokirkwood.com hellokirkwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolagrange.com hellolagrange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolakeville.com hellolakeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolanghorne.com hellolanghorne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
helloleaguecity.com helloleaguecity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloleander.com helloleander.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloloveland.com helloloveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomadera.com hellomadera.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomadisonheights.com hellomadisonheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomchenry.com hellomchenry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomercerisland.com hellomercerisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellomidvale.com hellomidvale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonapavalley.com hellonapavalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonationalcity.com hellonationalcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonewbrighton.com hellonewbrighton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonewzealand.com hellonewzealand.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2018 Jan 2021 2 years, 160 days
hellonoblesville.com hellonoblesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorris.com hellonorris.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonorwood.com hellonorwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellonortonshores.com hellonortonshores.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakdale.com hellooakdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooaklawnvillage.com hellooaklawnvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooakridge.com hellooakridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellooceanside.com hellooceanside.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloofallon.com helloofallon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloossining.com helloossining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellopatterson.com hellopatterson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportales.com helloportales.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportangeles.com helloportangeles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportsainttlucie.com helloportsainttlucie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloracine.com helloracine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloriverton.com helloriverton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorollingmeadows.com hellorollingmeadows.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosanleandro.com hellosanleandro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaukrapids.com hellosaukrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloseminole.com helloseminole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosikeston.com hellosikeston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosomerville.com hellosomerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellostrongsville.com hellostrongsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosusanville.com hellosusanville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosylvania.com hellosylvania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotaunton.com hellotaunton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotaylorsville.com hellotaylorsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotinleypark.com hellotinleypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellotumwater.com hellotumwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowashington.com hellowashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowestbend.com hellowestbend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowheeling.com hellowheeling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowhiteplains.com hellowhiteplains.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowoodbridge.com hellowoodbridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellowooster.com hellowooster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellowyoming.com hellowyoming.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hertsadvertisersundayfl.co.uk hertsadvertisersundayfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
hexus.net hexus.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
hhcardinals.com hhcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hhcomets.com hhcomets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Nov 2019 120 days
hhshawksnest.com hhshawksnest.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hhsmustangathletics.org hhsmustangathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hilandathletics.com hilandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hillgroveathletics.com hillgroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
historyrevealed.com historyrevealed.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
hitched.ie hitched.ie
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
hockeymineurst-isidore.com hockeymineurst-isidore.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 124 days
hondapioneerforum.com hondapioneerforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
hoopshype.com hoopshype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 238 days
hopkinsathletics.com hopkinsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
horizonprimarype.com horizonprimarype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
hot1041stl.com hot1041stl.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 64 days
hot1073jamz.com hot1073jamz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
houndnation1.com houndnation1.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
howemilitaryathletics.org howemilitaryathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hseroyalsathletics.com hseroyalsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hwhswildcats.com hwhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 189 days
hybridcars.com hybridcars.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hyundaiperformance.com hyundaiperformance.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hzxtjdz.com hzxtjdz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
icejam.ca icejam.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
idg.tv idg.tv
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
ihackmyi.com ihackmyi.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
iheartcats.com iheartcats.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ilateral.com ilateral.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Mar 2020 224 days
illianachristianvikings.com illianachristianvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 125 days
imgbin.com imgbin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 96 days
imp.center imp.center
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 128 days
impalassforum.com impalassforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
indiaprofile.com indiaprofile.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
infinitiq50.org infinitiq50.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
insidehoops.com insidehoops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
insightcentral.net insightcentral.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
inspirationfeed.com inspirationfeed.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
inspiremore.com inspiremore.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 186 days
investorshangout.com investorshangout.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Mar 2020 Mar 2020 One Off
irock935.com irock935.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
irtv24.co irtv24.co
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Feb 2020 125 days
irwatchtv.com irwatchtv.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Oct 2019 One Off
islandstarshockey.ca islandstarshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Dec 2019 61 days
islwynjuniorleague.co.uk islwynjuniorleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 61 days
itworld.com itworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Sep 2019 133 days
izismile.com izismile.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
jacketathletics.com jacketathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jamiiforums.com jamiiforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
javaworld.com javaworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Aug 2019 102 days
jcpatriotsathletics.com jcpatriotsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jeeptrackhawk.org jeeptrackhawk.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jellyz.live jellyz.live
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 May 2019 May 2019 One Off
jeromeathletics.net jeromeathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jewishlinknj.com jewishlinknj.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Dec 2019 One Off
jfoot1969.co.uk jfoot1969.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
jimtownathletics.org jimtownathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jjsoccer.ca jjsoccer.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
johnadamsathletics.com johnadamsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
johnmarshallathletics.org johnmarshallathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 188 days
jonescountygreyhounds.com jonescountygreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 62 days
joshuaathletics.com joshuaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
jrvikingssoftball.com jrvikingssoftball.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 218 days
juabwasps.com juabwasps.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
julesburgadvocate.com julesburgadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jun 2019 One Off
kalamazoonow.com kalamazoonow.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kaohoon.com kaohoon.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
kawasakimotorcycle.org kawasakimotorcycle.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kawasakininja1000.com kawasakininja1000.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kdat.com kdat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
keenanraiders.com keenanraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
kemptvillehockey.com kemptvillehockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 170 days
kentvalleyjfl.co.uk kentvalleyjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 281 days
kffirebirds.com kffirebirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
kia-forums.com kia-forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kicks1055.com kicks1055.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
killerfrogs.com killerfrogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Jan 2020 215 days
king-mag.com king-mag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
king5.com king5.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Dec 2019 132 days
kisscasper.com kisscasper.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kiwireport.com kiwireport.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Mar 2020 31 days
kmlchargers.com kmlchargers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
knightspride.com knightspride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
ndhsbulldogathletics.com ndhsbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ndhsrebels.com ndhsrebels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
koolam.com koolam.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
krfofm.com krfofm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kruupdate.com kruupdate.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 91 days
ktmatvhq.com ktmatvhq.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kushnercobras.com kushnercobras.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
kwongwah.com.my kwongwah.com.my
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
laacibnet.net laacibnet.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jun 2019 Dec 2019 177 days
lacrossetribune.com lacrossetribune.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
lancerregister.com lancerregister.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
lapelathletics.com lapelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
laprensafl.com laprensafl.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 49 days
lared.am lared.am
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 155 days
larnerfc.com larnerfc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
latestgossipwu.com latestgossipwu.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
lavilleathletics.com lavilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 187 days
lawfirmofdarrellkeith.net lawfirmofdarrellkeith.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
lchsfalcons.com lchsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 125 days
leaf.tv leaf.tv
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 98 days
leetemplates.com leetemplates.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 194 days
letras.com.br letras.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 124 days
lichngaytot.com lichngaytot.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 30 days
listenvid.com listenvid.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
livingmgz.com livingmgz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 194 days
ljcoyoteathletics.com ljcoyoteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Dec 2019 65 days
ljvikings.com ljvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lmshs-lions.com lmshs-lions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
loadoutroom.com loadoutroom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Sep 2019 One Off
lobonation.com lobonation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
logancountyathletics.com logancountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
logangrizzlies.org logangrizzlies.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
longislandfirearms.com longislandfirearms.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
looptt.com looptt.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Mar 2020 153 days
losandes.com.ar losandes.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 68 days
louisvuittonbag.net louisvuittonbag.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 62 days
lovejoyathletics.org lovejoyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 59 days
lovetoknow.com lovetoknow.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
lqathletics.com lqathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lsfa.co.uk lsfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 231 days
lumbertonpirates.org lumbertonpirates.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 59 days
lutheranathletics.org lutheranathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 186 days
lyhongshengfhb.com lyhongshengfhb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
lyrics.com lyrics.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Jan 2020 40 days
maariv.co.il maariv.co.il
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 313 days
maboref.ca maboref.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Dec 2019 167 days
manoramanews.com manoramanews.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jan 2020 Jan 2020 One Off
manutdtalk.com manutdtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
marriagecounselingblog.com marriagecounselingblog.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mashed.com mashed.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Aug 2019 Dec 2019 115 days
masonbulldogsports.com masonbulldogsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
mcdonoughathletics.com mcdonoughathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mcintoshathletics.com mcintoshathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 123 days
mcmurrayringette.com mcmurrayringette.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Oct 2019 One Off
mdchscrusaderathletics.com mdchscrusaderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mdxers.org mdxers.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
meadowcreekathletics.org meadowcreekathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
medcitynews.com medcitynews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Mar 2020 265 days
melanieredd.com melanieredd.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jun 2019 Feb 2020 236 days
memedroid.com memedroid.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
memphiscentralathletics.com memphiscentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Feb 2020 58 days
mens6.com mens6.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 58 days
mentertained.com mentertained.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jun 2019 Jul 2019 48 days
merchantselect.com merchantselect.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mhspolarbearathletics.com mhspolarbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 127 days
midcurrent.com midcurrent.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
necbl.com necbl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 75 days
milandawgs.com milandawgs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
mineralcountyminer.com mineralcountyminer.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
missoulian.com missoulian.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
mlbgamesim.com mlbgamesim.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mlbreports.tv mlbreports.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
moblivious.com moblivious.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Sep 2019 35 days
moddedraptor.com moddedraptor.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
moderncat.com moderncat.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Sep 2019 Sep 2019 One Off
modernmuzzleloader.com modernmuzzleloader.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Nov 2019 65 days
modularfords.com modularfords.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
momsrow.com momsrow.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 62 days
moonareaathletics.com moonareaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 185 days
moviemistakes.com moviemistakes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
moviestvnetwork.com moviestvnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 110 days
mshstrojanathletics.com mshstrojanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
mtairynews.com mtairynews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Nov 2019 Nov 2019 One Off
muathletics.com muathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 122 days
muscularmustangs.com muscularmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
musicradar.com musicradar.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
mvmavericks.com mvmavericks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
mvwildcats.com mvwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
mxnkey.com mxnkey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Dec 2019 One Off
mydallaspost.com mydallaspost.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
myfastgti.com myfastgti.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mytinschi.de mytinschi.de
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Oct 2019 75 days
nacion321.com nacion321.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 211 days
natureworldnews.com natureworldnews.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
navytimes.com navytimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
nbaanalysis.net nbaanalysis.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 274 days
nbabite.com nbabite.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 27 days
nbagamesim.com nbagamesim.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Oct 2019 62 days
nbareplayhd.com nbareplayhd.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Dec 2019 One Off
nelsoncountycardinals.com nelsoncountycardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 122 days
netknots.com netknots.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
new-delhi-hotels.com new-delhi-hotels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
newagegto.com newagegto.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
newcelica.org newcelica.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
news-herald.com news-herald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Jul 2019 48 days
newsarama.com newsarama.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
newstalk955.com newstalk955.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
nextstephockey.com nextstephockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ngshockey.com ngshockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Dec 2019 Mar 2020 83 days
nhra.com nhra.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
nhregister.com nhregister.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
nhswildcats.com nhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Feb 2020 Feb 2020 One Off
nissanclub.com nissanclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nmblacktornadosports.com nmblacktornadosports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
northviewsports.com northviewsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
novas.net novas.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nphswolfpackathletics.com nphswolfpackathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 122 days
nshahsathletics.com nshahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 127 days
nutleyathletics.org nutleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
nxownersclub.co.uk nxownersclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
nybass.com nybass.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nybeachcams.com nybeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 226 days
oabo.ca oabo.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jul 2019 One Off
ocoeeathletics.com ocoeeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
octaneforum.com octaneforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
odathletics.com odathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 121 days
odcsathletics.org odcsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
odemowlathletics.com odemowlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Dec 2019 128 days
odwha.ca odwha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Oct 2019 Oct 2019 One Off
oglecountylife.com oglecountylife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Oct 2019 161 days
ohiogamefishing.com ohiogamefishing.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 110 days
ohspiratesathletics.com ohspiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
okemosathletics.net okemosathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
olentangylibertyathletics.com olentangylibertyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
olneycharterathletics.com olneycharterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
olympiahighschoolathletics.com olympiahighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
omahanorthvikings.com omahanorthvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 121 days
omahanorthwesthuskies.com omahanorthwesthuskies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 121 days
oncewed.com oncewed.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
online-filmek.me online-filmek.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 26 days
onvideo.org onvideo.org
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Mar 2020 231 days
ooyyo.com ooyyo.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 63 days
opencritic.com opencritic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 111 days
orovillemr.com orovillemr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
osseo-orioles.com osseo-orioles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 186 days
otroligtbra.se otroligtbra.se
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Aug 2019 One Off
ourlads.com ourlads.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 258 days
outdoorhub.com outdoorhub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
ovidelsiesports.com ovidelsiesports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 184 days
ozsv.org ozsv.org
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Dec 2019 Feb 2020 46 days
paradisepost.com paradisepost.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
passaicvalleyathletics.com passaicvalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pavementsucks.com pavementsucks.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jan 2020 227 days
pchsathletics.com pchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pebblebrookathletics.com pebblebrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
peidoctordirectory.ca peidoctordirectory.ca
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
pembrokeshireleague.co.uk pembrokeshireleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
peninsuladailynews.com peninsuladailynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Mar 2020 Mar 2020 One Off
pflsports.net pflsports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
phimso1.us phimso1.us
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jun 2019 Aug 2019 66 days
phsbulldogsathletics.org phsbulldogsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pigeons.biz pigeons.biz
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
pikdo.online pikdo.online
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Oct 2019 Jan 2020 65 days
pikecentralathletics.com pikecentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pikeroadathletics.org pikeroadathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pinckneypiratesathletics.com pinckneypiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
pinedaleroundup.com pinedaleroundup.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 Mar 2020 306 days
pizzabottle.com pizzabottle.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jul 2019 Jan 2020 180 days
pkzcitl.com pkzcitl.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
planb.mx planb.mx
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Oct 2019 115 days
planetminis.com planetminis.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
planetrugby.com planetrugby.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Nov 2019 198 days
plattepirates.org plattepirates.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Jan 2020 185 days
playspades-online.com playspades-online.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Jul 2019 Dec 2019 145 days
pleasantonathletics.com pleasantonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
plo.vn plo.vn
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Jan 2020 One Off
plymouthathletics.com plymouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Oct 2019 Feb 2020 120 days
pmawarriorsathletics.com pmawarriorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
poe.trade poe.trade
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 271 days
poeapp.com poeapp.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 44 days
poetsathletics.com poetsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Jan 2020 128 days
polarisriders.com polarisriders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
popcarpet.com popcarpet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Oct 2019 Jan 2020 65 days
pottershousepumas.com pottershousepumas.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
powdersvillepatriotathletics.com powdersvillepatriotathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
prabhasakshi.com prabhasakshi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Jan 2020 Feb 2020 54 days
preparedsociety.com preparedsociety.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
prepbaseballreport.com prepbaseballreport.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
prepperforums.net prepperforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
prhslions.com prhslions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
priuschat.com priuschat.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Jul 2019 Mar 2020 231 days
prosportsdaily.com prosportsdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jul 2019 Mar 2020 231 days
prudentmedia.in prudentmedia.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Feb 2020 Feb 2020 One Off
psneurope.com psneurope.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
pucksofafeather.com pucksofafeather.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Aug 2019 21 days
pufferfish.net pufferfish.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
purcellmarianathletics.org purcellmarianathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
pvathletics.com pvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
pvhsathletics.com pvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Jan 2020 128 days
pwpodcasts.com pwpodcasts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 270 days
qihesk.net qihesk.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
qmusica.tv qmusica.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Aug 2019 Feb 2020 200 days
qreferat.com qreferat.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Jan 2020 Feb 2020 42 days
radio.com radio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
radioworld.com radioworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
rallyontheriverqc.com rallyontheriverqc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
randolphathletics.net randolphathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
rapidcityjournal.com rapidcityjournal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
ratforum.com ratforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
rattlernationathletics.com rattlernationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Aug 2019 One Off
rav4world.com rav4world.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ravallirepublic.com ravallirepublic.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
ravennaathletics.us ravennaathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
ravennabulldogsathletics.com ravennabulldogsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 183 days
rclchallengecup.ca rclchallengecup.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 May 2019 May 2019 One Off
readastonvilla.com readastonvilla.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
readbasketball.com readbasketball.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readburnley.com readburnley.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readcardiff.com readcardiff.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readfilm.co readfilm.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readlaliga.com readlaliga.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
readliverpoolfc.com readliverpoolfc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
readmiddlesbrough.com readmiddlesbrough.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
rebootplatform.info rebootplatform.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
rec-image.com rec-image.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
recipechatter.com recipechatter.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
record-bee.com record-bee.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
record.com.mx record.com.mx
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 May 2019 Dec 2019 223 days
redanhighathletics.com redanhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
redrants.com redrants.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 Sep 2019 Jan 2020 130 days
reeths-pufferathletics.com reeths-pufferathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
reitzathletics.com reitzathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Jan 2020 Feb 2020 53 days
rensongbj.com rensongbj.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6614 Jan 2020 Jan 2020 One Off
reporterherald.com reporterherald.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jul 2019 Jul 2019 One Off
retrogamer.net retrogamer.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Jan 2020 131 days
rhinoforums.net rhinoforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rhymejunkie.com rhymejunkie.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jun 2019 Aug 2019 69 days
riflehighschoolsports.com riflehighschoolsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Aug 2019 Feb 2020 182 days
rivergrandrapids.com rivergrandrapids.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
HELLOALEPPO.COM
Non IP Attributes
Attribute
UA UA-118163407
Aug 2018 - Jan 2021
UA UA-118129358
Jun 2021 - Sep 2022
GTM GTM-UA-118129358-1
Feb 2020 - Jan 2021
CA CA-PUB-5369125237996028
Sep 2018 - Aug 2019
DM DM-101492
May 2019 - Mar 2020
LIJI LIJI-261774
May 2019 - Mar 2020
ORC ORC-963
May 2019 - Mar 2020
AOL AOL-6614
May 2019 - Mar 2020
CONN CONN-102738
May 2019 - Mar 2020
SONO SONO-783272317B
May 2019 - Mar 2020
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E
May 2019 - Mar 2020
MEDI MEDI-8CUZ310G2
May 2019 - Feb 2020
TEAD TEAD-16544
Jun 2019 - Mar 2020
MEDI MEDI-8CU7QPX3O
Jun 2019 - Mar 2020
TELA TELA-457
Jun 2019 - Mar 2020
AVVID AVVID-7802
Jun 2019 - Mar 2020
YUME YUME-4016333178
Jun 2019 - Mar 2020
PUBM PUBM-158017
Jun 2019 - Mar 2020
GUMG GUMG-13810
Jun 2019 - Mar 2020
IEX IEX-189205
Jun 2019 - Feb 2020
FWHL FWHL-762769
Aug 2019 - Mar 2020
PRIM PRIM-19139
Aug 2019 - Mar 2020
UA UA-121239807
May 2019 - Dec 2019
GTM GTM-AW-804755169
May 2019 - Dec 2019
GTM GTM-UA-121239807-2
May 2019 - Dec 2019
CA CA-PUB-4449341246402301
May 2019 - Dec 2019
LIJI LIJI-265277
Aug 2019 - Feb 2020
TREM TREM-J54V6-5C8FF
Aug 2019 - Feb 2020
SVRN SVRN-265277
Dec 2019 - Mar 2020
SVRN SVRN-261774
May 2019 - Aug 2019
FWHL FWHL-762737
May 2019 - Aug 2019
GTM GTM-UA-118163407-2
Aug 2018 - Nov 2018
NEX NEX-3391
Dec 2019 - Feb 2020
AOL AOL-11647
Dec 2019 - Feb 2020
FWHL FWHL-970193
Dec 2019 - Feb 2020
CA CA-PUB-8425488243879801
Jun 2019 - Jun 2019
AOL AOL-6748
Aug 2019 - Aug 2019
HELLOALEPPO.COM
IP History

Click the IP addresses to see over domains using them.