Log In · Signup for Free
EN  DE  FR  ES  IT  Pусский  한국어  日本語  简体中文  عربي

HELLOFUZHOU.COM

HELLOFUZHOU.COM
Shared Attributes
Domain
helloqingdao.com helloqingdao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 May 2019 Apr 2021 1 year, 335 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellozibo.com hellozibo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellofez.com hellofez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 May 2019 Jun 2019 48 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
NEX NEX-3391 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
helloluzern.com helloluzern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Mar 2020 1 year, 189 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Jun 2019 Dec 2019 175 days
GTM GTM-UA-118129358-1 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellombuji-mayi.com hellombuji-mayi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Jun 2019 Apr 2021 1 year, 287 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Jun 2019 Jul 2020 1 year, 19 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellolucern.com hellolucern.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Mar 2020 1 year, 189 days
GTM GTM-UA-118129358-1 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellosaintjohn.com hellosaintjohn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellococonutcreek.com hellococonutcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
UA UA-121239807 Feb 2020 Feb 2020 One Off
hellonanaimo.com hellonanaimo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 May 2019 Apr 2021 1 year, 335 days
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-121239807 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellonorwalk.com hellonorwalk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Jul 2020 1 year, 67 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
helloparamaribo.com helloparamaribo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
GTM GTM-UA-118129358-1 May 2019 Nov 2020 1 year, 182 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-121239807 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
hellosanluisobispo.com hellosanluisobispo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
hellosioux.com hellosioux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellomoroni.com hellomoroni.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellonovosibirsk.com hellonovosibirsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 May 2019 Dec 2019 223 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
UA UA-121239807 Oct 2019 Mar 2020 163 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Oct 2019 Feb 2020 128 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellostockholm.com hellostockholm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 48 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellotolyatti.com hellotolyatti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellogaza.com hellogaza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Aug 2019 Aug 2020 363 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 May 2019 Dec 2019 223 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
hellosalem.com hellosalem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellowoodburn.com hellowoodburn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
AOL AOL-6748 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellomississippi.com hellomississippi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
hellonatchez.com hellonatchez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Jun 2019 Aug 2019 50 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
helloneenah.com helloneenah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
helloorem.com helloorem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 92 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
hellomanagua.com hellomanagua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellooakcreek.com hellooakcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Apr 2021 2 years, 148 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 46 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-118163407-2 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloscottsbluff.com helloscottsbluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Feb 2020 239 days
DM DM-100974 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellodavao.com hellodavao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Jun 2019 Apr 2021 1 year, 287 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
helloguelph.com helloguelph.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Aug 2019 Aug 2020 362 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Oct 2019 Dec 2019 64 days
AOL AOL-6748 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
helloouagadougou.com helloouagadougou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Dec 2019 Apr 2021 1 year, 112 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellobethlehem.com hellobethlehem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Oct 2019 Feb 2020 128 days
AOL AOL-6748 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
hellococoa.com hellococoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellograz.com hellograz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
helloizhevsk.com helloizhevsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Oct 2019 Feb 2020 128 days
UA UA-121239807 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
hellonorfolk.com hellonorfolk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Jul 2020 1 year, 67 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloshanghai.com helloshanghai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
UA UA-121239807 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellotahlequah.com hellotahlequah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
helloyazoo.com helloyazoo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellogenoa.com hellogenoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 45 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellohalifax.com hellohalifax.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellomccomb.com hellomccomb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-265277 Jun 2019 Aug 2019 50 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellomenasha.com hellomenasha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
AOL AOL-6748 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloomaha.com helloomaha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloportsaid.com helloportsaid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Oct 2019 Apr 2021 1 year, 176 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellosandusky.com hellosandusky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
UA UA-121239807 Dec 2019 Aug 2020 237 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellothibodaux.com hellothibodaux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellowindhoek.com hellowindhoek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Jan 2021 1 year, 255 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 47 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloeastchicago.com helloeastchicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 May 2019 Jun 2019 48 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloidaho.com helloidaho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellopinebluff.com hellopinebluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 96 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellopoplarbluff.com hellopoplarbluff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
helloabuja.com helloabuja.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
UA UA-121239807 Dec 2019 Aug 2020 235 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
helloantwerp.com helloantwerp.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Apr 2021 1 year, 48 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
UA UA-121239807 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
NEX NEX-3391 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
helloaruba.com helloaruba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
helloelk.com helloelk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Jul 2020 1 year, 67 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6748 May 2019 Jun 2019 48 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellogalt.com hellogalt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellonewyorkcity.com hellonewyorkcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 308 days
AOL AOL-6748 Jun 2019 Mar 2020 293 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
SVRN SVRN-265277 Jun 2019 Feb 2020 258 days
DM DM-100974 Jun 2019 Feb 2020 258 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 210 days
DM DM-101492 Sep 2019 Mar 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 85 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloqueencreek.com helloqueencreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Apr 2021 2 years, 148 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellosouthlaketahoe.com hellosouthlaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
DM DM-101492 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellotaipei.com hellotaipei.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellotamarac.com hellotamarac.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellofortaleza.com hellofortaleza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellomacomb.com hellomacomb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
UA UA-121239807 Jun 2019 Feb 2020 239 days
DM DM-100974 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-6748 May 2019 Oct 2019 159 days
DM DM-101492 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellosanmateo.com hellosanmateo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-6748 May 2019 Oct 2019 159 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-11647 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellosouthsioux.com hellosouthsioux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellotaunggyi.com hellotaunggyi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 May 2019 Apr 2021 1 year, 335 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 May 2019 Dec 2019 223 days
DM DM-101492 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellobellevue.com hellobellevue.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
UA UA-121239807 Dec 2019 Aug 2020 236 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 May 2019 Dec 2019 223 days
DM DM-101492 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellobengaluru.com hellobengaluru.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 May 2019 Dec 2019 223 days
DM DM-101492 Aug 2019 Feb 2020 189 days
AOL AOL-6748 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
helloflagstaff.com helloflagstaff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellohochiminh.com hellohochiminh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Apr 2021 1 year, 48 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
hellomalabo.com hellomalabo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 Oct 2019 Aug 2020 300 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
helloquebec.com helloquebec.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 46 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
helloschertz.com helloschertz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 May 2019 Jun 2019 48 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
hellosuffolk.com hellosuffolk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 93 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellothimphu.com hellothimphu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 Oct 2019 Aug 2020 298 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 May 2019 Dec 2019 223 days
DM DM-100974 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Dec 2019 125 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
helloalexandriaegypt.com helloalexandriaegypt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 May 2019 Aug 2020 1 year, 93 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
GTM GTM-UA-118129358-1 Mar 2020 Jan 2021 298 days
DM DM-100974 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellonewulm.com hellonewulm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
AOL AOL-6748 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
UA UA-121239807 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellopiqua.com hellopiqua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
helloshantou.com helloshantou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Oct 2019 Apr 2021 1 year, 176 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
TELA TELA-457 Oct 2019 Mar 2020 163 days
AVVID AVVID-7802 Oct 2019 Mar 2020 163 days
CONN CONN-102738 Oct 2019 Mar 2020 163 days
SONO SONO-783272317B Oct 2019 Mar 2020 163 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Mar 2020 163 days
YUME YUME-4016333178 Oct 2019 Mar 2020 163 days
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
GUMG GUMG-13810 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
UA UA-121239807 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
helloshoreview.com helloshoreview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellovaduz.com hellovaduz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 Oct 2019 Mar 2020 163 days
DM DM-100974 Aug 2019 Dec 2019 125 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
helloantigua.com helloantigua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellochicopee.com hellochicopee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 163 days
DM DM-101492 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
hellolodi.com hellolodi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 May 2019 Dec 2019 223 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hellomogadishu.com hellomogadishu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
AOL AOL-6748 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellomoundsview.com hellomoundsview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
helloradcliff.com helloradcliff.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellosantiago.com hellosantiago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Dec 2019 Apr 2021 1 year, 112 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellotaraz.com hellotaraz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 44 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloutah.com helloutah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloadisabeba.com helloadisabeba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellomaseru.com hellomaseru.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloottawa.com helloottawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-100974 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-6748 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellotahiti.com hellotahiti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellochicago.com hellochicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
hellohuntsville.com hellohuntsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-6748 Jul 2019 Mar 2020 244 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Jul 2019 Feb 2020 209 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-101492 Nov 2019 Mar 2020 124 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 85 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
LIJI LIJI-261774 Sep 2019 Nov 2019 65 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 45 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellomalibu.com hellomalibu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
hellosaratov.com hellosaratov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Aug 2019 Dec 2019 125 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
hellostjohn.com hellostjohn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
DM DM-101492 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 35 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellounionnj.com hellounionnj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
hellowinston-salem.com hellowinston-salem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloalisoviejo.com helloalisoviejo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
LIJI LIJI-261774 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
helloalsip.com helloalsip.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Aug 2020 360 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
hellocolumbia.com hellocolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 209 days
SVRN SVRN-265277 Jul 2019 Feb 2020 209 days
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
UA UA-121239807 Jun 2019 Sep 2019 104 days
GTM GTM-UA-121239807-2 Oct 2019 Jan 2020 104 days
DM DM-101492 Aug 2019 Nov 2019 100 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 85 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
ORC ORC-963 Sep 2019 Nov 2019 65 days
AOL AOL-11647 Jan 2020 Mar 2020 59 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
LIJI LIJI-261774 Jun 2019 Jul 2019 49 days
SVRN SVRN-261774 Dec 2019 Jan 2020 40 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellohaiti.com hellohaiti.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 May 2019 Dec 2019 223 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellolodz.com hellolodz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
DM DM-100974 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
hellomadrid.com hellomadrid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Oct 2019 Apr 2021 1 year, 176 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
UA UA-121239807 Oct 2019 Mar 2020 163 days
AOL AOL-6748 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Aug 2019 Dec 2019 125 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
hellominneapolis.com hellominneapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 308 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
AOL AOL-6748 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
DM DM-100974 Jul 2019 Feb 2020 209 days
AOL AOL-11647 Sep 2019 Mar 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Sep 2019 Feb 2020 154 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellomountainview.com hellomountainview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
LIJI LIJI-261774 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-6748 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellonewlenox.com hellonewlenox.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Aug 2020 362 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-100974 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellooconomowoc.com hellooconomowoc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloquanzhou.com helloquanzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Oct 2019 Apr 2021 1 year, 176 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Oct 2019 Aug 2020 301 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
TELA TELA-457 Oct 2019 Mar 2020 163 days
AVVID AVVID-7802 Oct 2019 Mar 2020 163 days
CONN CONN-102738 Oct 2019 Mar 2020 163 days
SONO SONO-783272317B Oct 2019 Mar 2020 163 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Mar 2020 163 days
YUME YUME-4016333178 Oct 2019 Mar 2020 163 days
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
GUMG GUMG-13810 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
hellosavannah.com hellosavannah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
NEX NEX-3391 May 2019 Aug 2019 98 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellosiemreap.com hellosiemreap.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Oct 2019 Apr 2021 1 year, 176 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 47 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
DM DM-100974 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellosantaclara.com hellosantaclara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 93 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
AOL AOL-6748 Jun 2019 Mar 2020 293 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
SVRN SVRN-265277 Jun 2019 Feb 2020 258 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-970193 Nov 2019 Mar 2020 110 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellobattlecreek.com hellobattlecreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellocouncilbluffs.com hellocouncilbluffs.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 47 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellocrestview.com hellocrestview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 44 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
hellocuracao.com hellocuracao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-402 May 2019 May 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
hellodc.com hellodc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-6748 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellodekalb.com hellodekalb.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6748 May 2019 Jun 2019 48 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellograndview.com hellograndview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellomukilteo.com hellomukilteo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellosamoa.com hellosamoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellotelaviv.com hellotelaviv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
AOL AOL-11647 Aug 2019 Dec 2019 125 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
TREM TREM-J54V6-5C8FF Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellowalnutcreek.com hellowalnutcreek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Apr 2021 1 year, 335 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellowaterloo.com hellowaterloo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-6748 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
helloajax.com helloajax.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 44 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
AOL AOL-6748 May 2019 Oct 2019 159 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Jun 2019 Jun 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellochickasha.com hellochickasha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-762769 May 2019 May 2019 One Off
LIJI LIJI-261774 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
helloconnecticut.com helloconnecticut.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
ORC ORC-402 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
helloglenview.com helloglenview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
UA UA-121239807 Jun 2019 Feb 2020 239 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellojacksonville.com hellojacksonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
CONN CONN-102738 Jul 2019 Mar 2020 245 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 245 days
LIJI LIJI-261774 Jul 2019 Mar 2020 231 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 210 days
DM DM-100974 Jul 2019 Feb 2020 210 days
SVRN SVRN-265277 Jul 2019 Feb 2020 210 days
AOL AOL-6748 Sep 2019 Mar 2020 189 days
DM DM-101492 Sep 2019 Mar 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
TREM TREM-J54V6-5C8FF Dec 2019 Jan 2020 40 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Sep 2019 Sep 2019 One Off
hellojamestown.com hellojamestown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
DM DM-100974 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hellootsego.com hellootsego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-6748 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Feb 2020 Mar 2020 35 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
helloperu.com helloperu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-6748 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloplainview.com helloplainview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 Feb 2020 Aug 2020 172 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellosantafa.com hellosantafa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Oct 2019 1 year, 26 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
CONN CONN-102738 May 2019 Dec 2019 223 days
SONO SONO-783272317B May 2019 Dec 2019 223 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Dec 2019 223 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
LIJI LIJI-261774 Jun 2019 Dec 2019 175 days
DM DM-100974 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
DM DM-101492 Aug 2019 Dec 2019 125 days
TEAD TEAD-16544 Aug 2019 Dec 2019 125 days
TELA TELA-457 Aug 2019 Dec 2019 125 days
AVVID AVVID-7802 Aug 2019 Dec 2019 125 days
YUME YUME-4016333178 Aug 2019 Dec 2019 125 days
PUBM PUBM-158017 Aug 2019 Dec 2019 125 days
GUMG GUMG-13810 Aug 2019 Dec 2019 125 days
PRIM PRIM-19139 Aug 2019 Dec 2019 125 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
hellosuisun.com hellosuisun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
UA UA-121239807 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
helloaddisababa.com helloaddisababa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
helloallouez.com helloallouez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
helloanaheim.com helloanaheim.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
DM DM-100974 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
hellobelleview.com hellobelleview.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 46 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellodearborn.com hellodearborn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellogurnee.com hellogurnee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 48 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
hellomaiduguri.com hellomaiduguri.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Oct 2019 Apr 2021 1 year, 176 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
UA UA-121239807 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
hellonagoya.com hellonagoya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Oct 2019 Apr 2021 1 year, 176 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Mar 2020 322 days
AOL AOL-6748 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
helloriorancho.com helloriorancho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 May 2019 Apr 2021 1 year, 335 days
UA UA-121239807 May 2019 Aug 2020 1 year, 95 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloroyaloak.com helloroyaloak.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Aug 2019 Dec 2019 125 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
DM DM-100974 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
hellozaporizhzhya.com hellozaporizhzhya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
AOL AOL-6748 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
hellocolumbus.com hellocolumbus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 66 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
SVRN SVRN-265277 Jun 2019 Feb 2020 258 days
DM DM-100974 Jun 2019 Feb 2020 258 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Sep 2019 Mar 2020 189 days
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Jan 2020 Mar 2020 59 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
hellofaribault.com hellofaribault.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
UA UA-121239807 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
AOL AOL-6748 Dec 2019 Feb 2020 64 days
DM DM-101492 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-402 May 2019 May 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellogaziantep.com hellogaziantep.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
FWHL FWHL-970193 Oct 2019 Dec 2019 64 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellolaketahoe.com hellolaketahoe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
DM DM-100974 May 2019 May 2019 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellolittleelm.com hellolittleelm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Jul 2020 334 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellonorthmiami.com hellonorthmiami.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
UA UA-121239807 Oct 2019 Mar 2020 163 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
hellosaintlouis.com hellosaintlouis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 64 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 278 days
SVRN SVRN-265277 Jun 2019 Feb 2020 257 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 210 days
DM DM-100974 Jul 2019 Feb 2020 209 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Nov 2019 Mar 2020 110 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 85 days
ORC ORC-963 Jan 2020 Mar 2020 58 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-49648 Jan 2020 Feb 2020 23 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
LIJI LIJI-261774 Mar 2020 Mar 2020 14 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellosanaa.com hellosanaa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Jun 2019 Jan 2021 1 year, 207 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
UA UA-121239807 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellosantacruz.com hellosantacruz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
UA UA-121239807 Dec 2019 Mar 2020 99 days
ORC ORC-963 Oct 2019 Dec 2019 64 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
hellochattanooga.com hellochattanooga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Mar 2020 274 days
AOL AOL-6748 Jun 2019 Mar 2020 274 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
hellohialeah.com hellohialeah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 35 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
hellokalamazoo.com hellokalamazoo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
AOL AOL-6748 Oct 2019 Feb 2020 128 days
FWHL FWHL-970193 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellooshawa.com hellooshawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
UA UA-121239807 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-963 Feb 2020 Feb 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
helloqueenstown.com helloqueenstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
helloraytown.com helloraytown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
DM DM-100974 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hellowinnipeg.com hellowinnipeg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 May 2019 Jan 2021 1 year, 255 days
UA UA-121239807 May 2019 Aug 2020 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
hellocorpuschristi.com hellocorpuschristi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
DM DM-101492 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hellodoylestown.com hellodoylestown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hellorowlett.com hellorowlett.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
SVRN SVRN-261774 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
hellocoalinga.com hellocoalinga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 45 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
MEDI MEDI-8CUZ310G2 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-6748 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
DM DM-101492 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
helloderby.com helloderby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
helloirmo.com helloirmo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Oct 2019 Dec 2019 64 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
helloistanbul.com helloistanbul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Aug 2019 Feb 2020 189 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
CONN CONN-102738 Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
MEDI MEDI-8CUZ310G2 Aug 2019 Dec 2019 125 days
AOL AOL-11647 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellooswego.com hellooswego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-6748 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Feb 2020 Mar 2020 35 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
helloblackfoot.com helloblackfoot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 96 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Feb 2020 128 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloenumclaw.com helloenumclaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Feb 2020 Feb 2020 One Off
hellogatineau.com hellogatineau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
UA UA-121239807 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
ORC ORC-963 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
hellomiami.com hellomiami.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
UA UA-121239807 May 2019 Jan 2020 263 days
DM DM-100974 Jun 2019 Feb 2020 258 days
GUMG GUMG-13810 Sep 2019 Mar 2020 189 days
YUME YUME-4016333178 Sep 2019 Mar 2020 189 days
TEAD TEAD-16544 Sep 2019 Mar 2020 189 days
PRIM PRIM-19139 Sep 2019 Mar 2020 189 days
TELA TELA-457 Sep 2019 Mar 2020 189 days
AVVID AVVID-7802 Sep 2019 Mar 2020 189 days
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
LIJI LIJI-261774 Sep 2019 Mar 2020 175 days
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 175 days
SVRN SVRN-265277 Jun 2019 Nov 2019 169 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
SVRN SVRN-261774 Jan 2020 Mar 2020 59 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-11647 Jan 2020 Mar 2020 45 days
FWHL FWHL-970193 Jan 2020 Mar 2020 45 days
GTM GTM-UA-118163407-2 Sep 2018 Oct 2018 30 days
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 14 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-963 Sep 2019 Sep 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellomuskego.com hellomuskego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
UA UA-121239807 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
hellosaintpetersburg.com hellosaintpetersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Apr 2020 342 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
AOL AOL-6748 Jun 2019 Mar 2020 279 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 231 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 210 days
FWHL FWHL-970193 Aug 2019 Jan 2020 165 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Nov 2019 Feb 2020 89 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
TREM TREM-J54V6-5C8FF Dec 2019 Jan 2020 40 days
AOL AOL-11647 Aug 2019 Sep 2019 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellosantabarbara.com hellosantabarbara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
AOL AOL-6748 Jul 2019 Mar 2020 244 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 209 days
UA UA-121239807 Jul 2019 Jan 2020 185 days
DM DM-101492 Aug 2019 Jan 2020 165 days
FWHL FWHL-970193 Aug 2019 Jan 2020 165 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Nov 2019 Feb 2020 89 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
helloarlingtontx.com helloarlingtontx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Mar 2020 1 year, 189 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
DM DM-101492 Aug 2019 Feb 2020 189 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-11647 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
NEX NEX-3391 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
hellobemidji.com hellobemidji.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 92 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
hellocharleston.com hellocharleston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Apr 2020 342 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 209 days
FWHL FWHL-970193 Sep 2019 Mar 2020 189 days
ORC ORC-963 Sep 2019 Mar 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-6748 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
LIJI LIJI-261774 Jul 2019 Nov 2019 120 days
AOL AOL-11647 Aug 2019 Nov 2019 100 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Sep 2019 Nov 2019 65 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
DM DM-101492 Jan 2020 Jan 2020 One Off
hellofortbragg.com hellofortbragg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Aug 2019 Feb 2020 189 days
AOL AOL-6748 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
ORC ORC-402 May 2019 May 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellogilberttown.com hellogilberttown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellohonolulu.com hellohonolulu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
DM DM-100974 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellomanitowoc.com hellomanitowoc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
SVRN SVRN-265277 May 2019 Dec 2019 223 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
DM DM-101492 Oct 2019 Feb 2020 128 days
AOL AOL-6748 Jun 2019 Oct 2019 111 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellomontgomery.com hellomontgomery.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
LIJI LIJI-261774 Jun 2019 Mar 2020 279 days
SVRN SVRN-265277 Jun 2019 Feb 2020 258 days
DM DM-101492 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 210 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 149 days
FWHL FWHL-970193 Nov 2019 Mar 2020 124 days
ORC ORC-963 Aug 2019 Nov 2019 100 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Oct 2018 30 days
UA UA-121239807 May 2019 Jun 2019 29 days
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 14 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellonicaragua.com hellonicaragua.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellononthaburi.com hellononthaburi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
UA UA-121239807 Feb 2020 Aug 2020 172 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Dec 2019 Feb 2020 64 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
SVRN SVRN-261774 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
hellosandiego.com hellosandiego.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
helloelko.com helloelko.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Dec 2019 125 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
helloiowa.com helloiowa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
CONN CONN-102738 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Aug 2019 Mar 2020 224 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellospokane.com hellospokane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jul 2019 Mar 2020 230 days
SONO SONO-783272317B Jul 2019 Mar 2020 230 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
CONN CONN-102738 Jul 2019 Mar 2020 230 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 230 days
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
TEAD TEAD-16544 Aug 2019 Mar 2020 210 days
DM DM-101492 Aug 2019 Mar 2020 210 days
TELA TELA-457 Aug 2019 Mar 2020 210 days
AVVID AVVID-7802 Aug 2019 Mar 2020 210 days
YUME YUME-4016333178 Aug 2019 Mar 2020 210 days
GUMG GUMG-13810 Aug 2019 Mar 2020 210 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
SVRN SVRN-265277 Jul 2019 Feb 2020 209 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 149 days
AOL AOL-11647 Sep 2019 Jan 2020 130 days
FWHL FWHL-970193 Sep 2019 Jan 2020 130 days
MEDI MEDI-8CUZ310G2 Sep 2019 Jan 2020 130 days
ORC ORC-963 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
TREM TREM-J54V6-5C8FF Dec 2019 Jan 2020 40 days
SVRN SVRN-261774 Dec 2019 Jan 2020 40 days
CA CA-PUB-5369125237996028 Sep 2018 Oct 2018 30 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
DM DM-100974 Jan 2020 Jan 2020 One Off
hellosyracuse.com hellosyracuse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 Jul 2019 Mar 2020 244 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Sep 2019 Mar 2020 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-11647 Nov 2019 Mar 2020 124 days
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Dec 2019 Jan 2020 40 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
hellocupertino.com hellocupertino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
UA UA-121239807 Dec 2019 Feb 2020 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellojuneau.com hellojuneau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Feb 2020 Mar 2020 35 days
DM DM-101492 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellomaranatown.com hellomaranatown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellosoutheuclid.com hellosoutheuclid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
AOL AOL-11647 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 163 days
TELA TELA-457 Oct 2019 Mar 2020 163 days
AVVID AVVID-7802 Oct 2019 Mar 2020 163 days
CONN CONN-102738 Oct 2019 Mar 2020 163 days
SONO SONO-783272317B Oct 2019 Mar 2020 163 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Mar 2020 163 days
YUME YUME-4016333178 Oct 2019 Mar 2020 163 days
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
GUMG GUMG-13810 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
DM DM-100974 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
hellotabriz.com hellotabriz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
UA UA-121239807 Feb 2020 Feb 2020 One Off
hellowashingtondc.com hellowashingtondc.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 93 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-6748 Jun 2019 Jan 2020 234 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Sep 2019 Mar 2020 189 days
LIJI LIJI-261774 Sep 2019 Mar 2020 189 days
SVRN SVRN-265277 Jun 2019 Nov 2019 169 days
GTM GTM-UA-121239807-2 Oct 2019 Jan 2020 104 days
ORC ORC-963 Aug 2019 Nov 2019 100 days
FWHL FWHL-970193 Aug 2019 Nov 2019 100 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 85 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-762737 Mar 2020 Mar 2020 14 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
hellobullhead.com hellobullhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Feb 2020 64 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
DM DM-101492 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
TREM TREM-J54V6-5C8FF Feb 2020 Feb 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
hellocanton.com hellocanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
UA UA-121239807 Jul 2019 Apr 2020 264 days
DM DM-100974 Jun 2019 Feb 2020 257 days
SVRN SVRN-265277 Jun 2019 Feb 2020 257 days
LIJI LIJI-261774 Jul 2019 Mar 2020 244 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Sep 2019 Mar 2020 189 days
ORC ORC-963 Aug 2019 Jan 2020 165 days
AOL AOL-11647 Aug 2019 Jan 2020 165 days
GTM GTM-UA-121239807-2 Nov 2019 Mar 2020 124 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 59 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
hellofonddulac.com hellofonddulac.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
hellogalveston.com hellogalveston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Apr 2020 343 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 210 days
SVRN SVRN-265277 Jul 2019 Jan 2020 186 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 186 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-100974 Sep 2019 Feb 2020 154 days
DM DM-101492 Aug 2019 Nov 2019 100 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-6748 Jan 2020 Mar 2020 58 days
TREM TREM-J54V6-5C8FF Jan 2020 Mar 2020 58 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Oct 2018 30 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
helloislamabad.com helloislamabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Dec 2019 Jan 2021 1 year, 32 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
UA UA-121239807 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
hellojohnstown.com hellojohnstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
hellomillbrae.com hellomillbrae.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Aug 2020 362 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-265277 Jun 2019 Aug 2019 50 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
hellonorristown.com hellonorristown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 48 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-100974 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hellooahu.com hellooahu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 64 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
SVRN SVRN-265277 Jun 2019 Feb 2020 257 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
DM DM-101492 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 209 days
AOL AOL-11647 Sep 2019 Mar 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Nov 2019 Mar 2020 124 days
ORC ORC-963 Aug 2019 Nov 2019 100 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 85 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Aug 2019 Sep 2019 35 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
hellookmulgee.com hellookmulgee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
TREM TREM-J54V6-5C8FF Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
hellotokyo.com hellotokyo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 274 days
LIJI LIJI-261774 Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
UA UA-121239807 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Feb 2020 189 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
ORC ORC-402 May 2019 May 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
helloaleppo.com helloaleppo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
UA UA-121239807 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hellobaytown.com hellobaytown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Aug 2020 360 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellobirmingham.com hellobirmingham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jul 2019 Aug 2020 1 year, 17 days
AOL AOL-6748 Jul 2019 Mar 2020 245 days
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
CONN CONN-102738 Jul 2019 Mar 2020 245 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 245 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Jul 2019 Feb 2020 210 days
DM DM-100974 Jul 2019 Feb 2020 210 days
ORC ORC-963 Aug 2019 Mar 2020 210 days
FWHL FWHL-970193 Aug 2019 Mar 2020 210 days
DM DM-101492 Aug 2019 Jan 2020 165 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
LIJI LIJI-261774 Jan 2020 Mar 2020 59 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Jan 2020 Mar 2020 45 days
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 14 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellofreetown.com hellofreetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
hellohawaii.com hellohawaii.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
DM DM-101492 Aug 2019 Feb 2020 189 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
UA UA-121239807 Jun 2019 Dec 2019 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
hellokentucky.com hellokentucky.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
UA UA-121239807 Aug 2019 Dec 2019 125 days
DM DM-101492 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
hellonouakchott.com hellonouakchott.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Mar 2020 Jan 2021 298 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Oct 2019 Mar 2020 163 days
TEAD TEAD-16544 Oct 2019 Mar 2020 163 days
ORC ORC-963 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 163 days
TELA TELA-457 Oct 2019 Mar 2020 163 days
AVVID AVVID-7802 Oct 2019 Mar 2020 163 days
CONN CONN-102738 Oct 2019 Mar 2020 163 days
SONO SONO-783272317B Oct 2019 Mar 2020 163 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Mar 2020 163 days
YUME YUME-4016333178 Oct 2019 Mar 2020 163 days
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
GUMG GUMG-13810 Oct 2019 Mar 2020 163 days
PRIM PRIM-19139 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Oct 2019 Feb 2020 128 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
UA UA-121239807 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellodavenport.com hellodavenport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Apr 2020 313 days
LIJI LIJI-261774 Jun 2019 Mar 2020 293 days
AOL AOL-6748 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
DM DM-101492 Aug 2019 Jan 2020 165 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Sep 2019 Feb 2020 154 days
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 120 days
FWHL FWHL-970193 Aug 2019 Nov 2019 100 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloencino.com helloencino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
UA UA-121239807 Dec 2019 Feb 2020 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellolibya.com hellolibya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
FWHL FWHL-762769 May 2019 May 2019 One Off
LIJI LIJI-261774 May 2019 May 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellolouisville.com hellolouisville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2019 Aug 2020 1 year, 64 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
DM DM-100974 Jun 2019 Feb 2020 257 days
SVRN SVRN-265277 Jun 2019 Feb 2020 257 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Jan 2020 166 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Nov 2019 Mar 2020 124 days
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
NEX NEX-3391 Jun 2019 Aug 2019 68 days
AOL AOL-6748 Jan 2020 Mar 2020 58 days
LIJI LIJI-261774 Jan 2020 Mar 2020 58 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellotoledo.com hellotoledo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 308 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 230 days
CONN CONN-102738 Jul 2019 Mar 2020 230 days
SONO SONO-783272317B Jul 2019 Mar 2020 230 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 230 days
TEAD TEAD-16544 Aug 2019 Mar 2020 210 days
AOL AOL-11647 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
TELA TELA-457 Aug 2019 Mar 2020 210 days
AVVID AVVID-7802 Aug 2019 Mar 2020 210 days
YUME YUME-4016333178 Aug 2019 Mar 2020 210 days
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
GUMG GUMG-13810 Aug 2019 Mar 2020 210 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
DM DM-100974 Jul 2019 Feb 2020 209 days
ORC ORC-963 Aug 2019 Jan 2020 165 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 149 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
DM DM-101492 Sep 2019 Nov 2019 65 days
AOL AOL-6748 Sep 2019 Nov 2019 65 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-970193 Jan 2020 Mar 2020 45 days
TREM TREM-J54V6-5C8FF Dec 2019 Jan 2020 40 days
AOL AOL-49648 Jan 2020 Feb 2020 24 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellomerced.com hellomerced.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
UA UA-121239807 May 2019 Jan 2020 263 days
DM DM-100974 Jun 2019 Feb 2020 258 days
SVRN SVRN-265277 Jun 2019 Feb 2020 258 days
LIJI LIJI-261774 Jul 2019 Mar 2020 245 days
AOL AOL-6748 Jun 2019 Jan 2020 234 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 210 days
ORC ORC-963 Sep 2019 Mar 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
TREM TREM-J54V6-5C8FF Dec 2019 Jan 2020 40 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Nov 2019 Nov 2019 One Off
hellomiddletown.com hellomiddletown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
DM DM-100974 May 2019 Oct 2019 159 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
AOL AOL-6748 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellomilwaukee.com hellomilwaukee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 209 days
ORC ORC-963 Sep 2019 Mar 2020 189 days
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 149 days
FWHL FWHL-970193 Sep 2019 Jan 2020 130 days
DM DM-101492 Sep 2019 Jan 2020 130 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Dec 2019 Jan 2020 40 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
UA UA-121239807 Nov 2019 Nov 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
helloperm.com helloperm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Feb 2020 Jan 2021 333 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
PUBM PUBM-158017 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
TEAD TEAD-16544 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Oct 2019 Feb 2020 128 days
TELA TELA-457 Oct 2019 Feb 2020 128 days
AVVID AVVID-7802 Oct 2019 Feb 2020 128 days
CONN CONN-102738 Oct 2019 Feb 2020 128 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Feb 2020 128 days
YUME YUME-4016333178 Oct 2019 Feb 2020 128 days
GUMG GUMG-13810 Oct 2019 Feb 2020 128 days
PRIM PRIM-19139 Oct 2019 Feb 2020 128 days
UA UA-121239807 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Oct 2019 Dec 2019 64 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
ORC ORC-963 Oct 2019 Dec 2019 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
FWHL FWHL-970193 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellosacramento.com hellosacramento.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 Jun 2019 Mar 2020 293 days
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 293 days
UA UA-121239807 May 2019 Jan 2020 263 days
LIJI LIJI-261774 Jul 2019 Mar 2020 244 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 189 days
AOL AOL-11647 Aug 2019 Jan 2020 165 days
DM DM-100974 Sep 2019 Feb 2020 154 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 149 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Nov 2019 Feb 2020 89 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Oct 2018 30 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Sep 2019 Sep 2019 One Off
hellobiloxi.com hellobiloxi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
AOL AOL-6748 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
UA UA-121239807 May 2019 Oct 2019 159 days
AOL AOL-11647 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Dec 2019 Feb 2020 64 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
FWHL FWHL-762769 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellojaffa.com hellojaffa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Jun 2019 Apr 2021 1 year, 287 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
DM DM-100974 May 2019 Dec 2019 223 days
SVRN SVRN-265277 May 2019 Dec 2019 223 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
CONN CONN-102738 May 2019 Dec 2019 223 days
SONO SONO-783272317B May 2019 Dec 2019 223 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Dec 2019 223 days
TEAD TEAD-16544 Aug 2019 Dec 2019 125 days
TELA TELA-457 Aug 2019 Dec 2019 125 days
AVVID AVVID-7802 Aug 2019 Dec 2019 125 days
YUME YUME-4016333178 Aug 2019 Dec 2019 125 days
PUBM PUBM-158017 Aug 2019 Dec 2019 125 days
GUMG GUMG-13810 Aug 2019 Dec 2019 125 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
PRIM PRIM-19139 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
hellokennesaw.com hellokennesaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
LIJI LIJI-261774 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
NEX NEX-3391 May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
helloyoungstown.com helloyoungstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 92 days
DM DM-100974 May 2019 Aug 2019 98 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloenid.com helloenid.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Aug 2020 359 days
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
DM DM-101492 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
helloallentown.com helloallentown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SVRN SVRN-265277 May 2019 Oct 2019 159 days
LIJI LIJI-261774 May 2019 Oct 2019 159 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
UA UA-121239807 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
hellodubuque.com hellodubuque.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Dec 2019 Apr 2021 1 year, 112 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Mar 2020 99 days
AOL AOL-6748 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
UA UA-121239807 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
TREM TREM-J54V6-5C8FF Feb 2020 Mar 2020 35 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellolatrobe.com hellolatrobe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
hellomuskogee.com hellomuskogee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
hellobronx.com hellobronx.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Mar 2020 322 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
LIJI LIJI-261774 May 2019 Dec 2019 223 days
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 223 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Nov 2018 Nov 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
hellomaui.com hellomaui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
CONN CONN-102738 Aug 2019 Feb 2020 189 days
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
LIJI LIJI-261774 Oct 2019 Feb 2020 128 days
DM DM-101492 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
ORC ORC-963 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Oct 2019 Dec 2019 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
UA UA-121239807 Feb 2020 Feb 2020 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
hellohamptonroads.com hellohamptonroads.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
SVRN SVRN-265277 Jun 2019 Feb 2020 257 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 210 days
AOL AOL-6748 Jun 2019 Nov 2019 168 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
AOL AOL-11647 Nov 2019 Mar 2020 124 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
TREM TREM-J54V6-5C8FF Jan 2020 Mar 2020 59 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
LIJI LIJI-261774 Mar 2020 Mar 2020 14 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
helloalbuquerque.com helloalbuquerque.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jul 2019 Apr 2020 265 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 210 days
FWHL FWHL-970193 Sep 2019 Mar 2020 189 days
LIJI LIJI-261774 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Aug 2019 Jan 2020 166 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 149 days
ORC ORC-963 Nov 2019 Mar 2020 110 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Nov 2019 Feb 2020 89 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
helloelreno.com helloelreno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
UA UA-121239807 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
LIJI LIJI-261774 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
ORC ORC-963 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
hellohelsinki.com hellohelsinki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Jun 2019 Apr 2021 1 year, 287 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
CONN CONN-102738 Jun 2019 Mar 2020 274 days
SONO SONO-783272317B Jun 2019 Mar 2020 274 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 274 days
DM DM-100974 Jun 2019 Feb 2020 239 days
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 239 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
ORC ORC-963 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
hellomanhattan.com hellomanhattan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 92 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 209 days
SVRN SVRN-265277 Jul 2019 Feb 2020 209 days
FWHL FWHL-762737 Sep 2019 Mar 2020 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
DM DM-101492 Sep 2019 Nov 2019 65 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Mar 2020 Mar 2020 14 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Sep 2019 Sep 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellopasadena.com hellopasadena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
LIJI LIJI-261774 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
AOL AOL-6748 Jun 2019 Mar 2020 278 days
UA UA-121239807 Jul 2019 Apr 2020 264 days
DM DM-100974 Jun 2019 Feb 2020 257 days
SVRN SVRN-265277 Jun 2019 Feb 2020 257 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 103 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
ORC ORC-963 Sep 2019 Nov 2019 65 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloraleigh.com helloraleigh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
DM DM-100974 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hellosaintpaul.com hellosaintpaul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
DM DM-101492 Aug 2019 Feb 2020 189 days
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
CONN CONN-102738 Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Aug 2019 Feb 2020 189 days
SVRN SVRN-265277 Aug 2019 Feb 2020 189 days
LIJI LIJI-261774 Aug 2019 Feb 2020 189 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
AOL AOL-6748 Aug 2019 Dec 2019 125 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
AOL AOL-11647 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
hellobountiful.com hellobountiful.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
DM DM-100974 Aug 2019 Feb 2020 189 days
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
CONN CONN-102738 Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
PRIM PRIM-19139 Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
LIJI LIJI-261774 Oct 2019 Feb 2020 128 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Oct 2019 Dec 2019 64 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
ORC ORC-963 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellophiladelphia.com hellophiladelphia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
SVRN SVRN-265277 Jun 2019 Feb 2020 257 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
AOL AOL-11647 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 210 days
DM DM-100974 Jul 2019 Feb 2020 209 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Aug 2019 Nov 2019 100 days
ORC ORC-963 Aug 2019 Nov 2019 100 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
UA UA-121239807 May 2019 Jul 2019 78 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
helloreno.com helloreno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 Jul 2019 Mar 2020 230 days
SONO SONO-783272317B Jul 2019 Mar 2020 230 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 230 days
TEAD TEAD-16544 Aug 2019 Mar 2020 210 days
TELA TELA-457 Aug 2019 Mar 2020 210 days
AVVID AVVID-7802 Aug 2019 Mar 2020 210 days
YUME YUME-4016333178 Aug 2019 Mar 2020 210 days
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
GUMG GUMG-13810 Aug 2019 Mar 2020 210 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
DM DM-100974 Jul 2019 Feb 2020 209 days
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
UA UA-121239807 Mar 2020 Aug 2020 153 days
SVRN SVRN-265277 Sep 2019 Jan 2020 130 days
GTM GTM-UA-121239807-2 Oct 2019 Jan 2020 104 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
TREM TREM-J54V6-5C8FF Dec 2019 Jan 2020 40 days
AOL AOL-11647 Aug 2019 Sep 2019 35 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
CA CA-PUB-5369125237996028 Oct 2018 Oct 2018 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
DM DM-101492 Sep 2019 Sep 2019 One Off
LIJI LIJI-261774 Jan 2020 Jan 2020 One Off
AOL AOL-49648 Jan 2020 Jan 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
helloleague.com helloleague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Feb 2020 Apr 2021 1 year, 48 days
GTM GTM-UA-121239807-2 Feb 2020 Mar 2020 35 days
DM DM-101492 Feb 2020 Mar 2020 35 days
TEAD TEAD-16544 Feb 2020 Mar 2020 35 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
AOL AOL-6748 Feb 2020 Mar 2020 35 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
FWHL FWHL-970193 Feb 2020 Mar 2020 35 days
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 35 days
TREM TREM-J54V6-5C8FF Feb 2020 Mar 2020 35 days
TELA TELA-457 Feb 2020 Mar 2020 35 days
AVVID AVVID-7802 Feb 2020 Mar 2020 35 days
CONN CONN-102738 Feb 2020 Mar 2020 35 days
SONO SONO-783272317B Feb 2020 Mar 2020 35 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Feb 2020 Mar 2020 35 days
YUME YUME-4016333178 Feb 2020 Mar 2020 35 days
PUBM PUBM-158017 Feb 2020 Mar 2020 35 days
GUMG GUMG-13810 Feb 2020 Mar 2020 35 days
PRIM PRIM-19139 Feb 2020 Mar 2020 35 days
UA UA-121239807 Feb 2020 Feb 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
hellosaltlakecity.com hellosaltlakecity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jul 2019 Apr 2020 264 days
AOL AOL-6748 Jul 2019 Mar 2020 244 days
CONN CONN-102738 Jul 2019 Mar 2020 244 days
SONO SONO-783272317B Jul 2019 Mar 2020 244 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 244 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-101492 Aug 2019 Mar 2020 210 days
SVRN SVRN-265277 Jul 2019 Feb 2020 209 days
ORC ORC-963 Sep 2019 Mar 2020 189 days
FWHL FWHL-970193 Sep 2019 Mar 2020 189 days
AOL AOL-11647 Sep 2019 Mar 2020 175 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Jan 2020 Mar 2020 59 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
DM DM-100974 Jan 2020 Feb 2020 24 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hellosarasota.com hellosarasota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
UA UA-121239807 May 2019 Jan 2020 264 days
SVRN SVRN-265277 Jun 2019 Feb 2020 257 days
DM DM-100974 Jun 2019 Feb 2020 257 days
ORC ORC-963 Aug 2019 Mar 2020 210 days
TEAD TEAD-16544 Sep 2019 Mar 2020 189 days
TELA TELA-457 Sep 2019 Mar 2020 189 days
AVVID AVVID-7802 Sep 2019 Mar 2020 189 days
YUME YUME-4016333178 Sep 2019 Mar 2020 189 days
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
GUMG GUMG-13810 Sep 2019 Mar 2020 189 days
PRIM PRIM-19139 Sep 2019 Mar 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
LIJI LIJI-261774 Sep 2019 Jan 2020 131 days
FWHL FWHL-762737 Sep 2019 Jan 2020 131 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 85 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Jan 2020 Mar 2020 44 days
NEX NEX-3391 Jun 2019 Jun 2019 One Off
DM DM-101492 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Jan 2020 Jan 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
hellobardstown.com hellobardstown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
SVRN SVRN-265277 Jun 2019 Oct 2019 111 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
DM DM-101492 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
AOL AOL-6748 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hellocabot.com hellocabot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
AOL AOL-6748 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
UA UA-121239807 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
hellohiltonhead.com hellohiltonhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Dec 2019 Aug 2020 236 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
helloburbank.com helloburbank.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
UA UA-121239807 Feb 2020 Feb 2020 One Off
DM DM-101492 Feb 2020 Feb 2020 One Off
ORC ORC-963 Feb 2020 Feb 2020 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
hellocarlsbad.com hellocarlsbad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Dec 2019 Mar 2020 99 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
ORC ORC-963 Feb 2020 Mar 2020 35 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
hellodelano.com hellodelano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Mar 2020 99 days
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
DM DM-101492 Dec 2019 Mar 2020 99 days
LIJI LIJI-261774 Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-265277 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Feb 2020 Mar 2020 35 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
hellosunnyvale.com hellosunnyvale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Apr 2020 343 days
LIJI LIJI-261774 Jun 2019 Mar 2020 292 days
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 209 days
DM DM-101492 Aug 2019 Jan 2020 166 days
AOL AOL-11647 Aug 2019 Jan 2020 166 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-265277 Sep 2019 Feb 2020 154 days
ORC ORC-963 Sep 2019 Jan 2020 131 days
AOL AOL-6748 Nov 2019 Mar 2020 124 days
FWHL FWHL-970193 Nov 2019 Mar 2020 124 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 99 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
SVRN SVRN-261774 Dec 2019 Jan 2020 41 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloboise.com helloboise.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
LIJI LIJI-261774 Jul 2019 Mar 2020 244 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
ORC ORC-963 Sep 2019 Mar 2020 175 days
DM DM-101492 Aug 2019 Jan 2020 166 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 120 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
SVRN SVRN-265277 Nov 2019 Feb 2020 89 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
TREM TREM-J54V6-5C8FF Dec 2019 Mar 2020 85 days
AOL AOL-6748 Jan 2020 Mar 2020 58 days
UA UA-121239807 Jul 2019 Sep 2019 55 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellocincinnati.com hellocincinnati.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
CONN CONN-102738 Jul 2019 Mar 2020 230 days
LIJI LIJI-261774 Jul 2019 Mar 2020 230 days
SONO SONO-783272317B Jul 2019 Mar 2020 230 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jul 2019 Mar 2020 230 days
TEAD TEAD-16544 Aug 2019 Mar 2020 210 days
GUMG GUMG-13810 Aug 2019 Mar 2020 210 days
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
TELA TELA-457 Aug 2019 Mar 2020 210 days
AVVID AVVID-7802 Aug 2019 Mar 2020 210 days
YUME YUME-4016333178 Aug 2019 Mar 2020 210 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
SVRN SVRN-265277 Sep 2019 Feb 2020 154 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 149 days
ORC ORC-963 Nov 2019 Mar 2020 110 days
FWHL FWHL-970193 Nov 2019 Mar 2020 110 days
DM DM-100974 Nov 2019 Feb 2020 89 days
AOL AOL-11647 Sep 2019 Nov 2019 65 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
DM DM-101492 Aug 2019 Sep 2019 35 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
hellonassau.com hellonassau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 Feb 2020 Aug 2020 172 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
DM DM-101492 Feb 2020 Mar 2020 35 days
TEAD TEAD-16544 Feb 2020 Mar 2020 35 days
SVRN SVRN-261774 Feb 2020 Mar 2020 35 days
AOL AOL-11647 Feb 2020 Mar 2020 35 days
FWHL FWHL-762737 Feb 2020 Mar 2020 35 days
TREM TREM-J54V6-5C8FF Feb 2020 Mar 2020 35 days
TELA TELA-457 Feb 2020 Mar 2020 35 days
AVVID AVVID-7802 Feb 2020 Mar 2020 35 days
CONN CONN-102738 Feb 2020 Mar 2020 35 days
SONO SONO-783272317B Feb 2020 Mar 2020 35 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Feb 2020 Mar 2020 35 days
YUME YUME-4016333178 Feb 2020 Mar 2020 35 days
PUBM PUBM-158017 Feb 2020 Mar 2020 35 days
GUMG GUMG-13810 Feb 2020 Mar 2020 35 days
PRIM PRIM-19139 Feb 2020 Mar 2020 35 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
SVRN SVRN-265277 Feb 2020 Feb 2020 One Off
LIJI LIJI-261774 Feb 2020 Feb 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
hellosoho.com hellosoho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Feb 2020 287 days
LIJI LIJI-261774 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
CONN CONN-102738 May 2019 Feb 2020 287 days
SONO SONO-783272317B May 2019 Feb 2020 287 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Feb 2020 287 days
DM DM-100974 Jun 2019 Feb 2020 239 days
SVRN SVRN-265277 Jun 2019 Feb 2020 239 days
DM DM-101492 Aug 2019 Feb 2020 189 days
TEAD TEAD-16544 Aug 2019 Feb 2020 189 days
ORC ORC-963 Aug 2019 Feb 2020 189 days
AOL AOL-11647 Aug 2019 Feb 2020 189 days
TELA TELA-457 Aug 2019 Feb 2020 189 days
AVVID AVVID-7802 Aug 2019 Feb 2020 189 days
YUME YUME-4016333178 Aug 2019 Feb 2020 189 days
PUBM PUBM-158017 Aug 2019 Feb 2020 189 days
GUMG GUMG-13810 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
ORC ORC-402 May 2019 May 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Feb 2020 Feb 2020 One Off
FWHL FWHL-970193 Feb 2020 Feb 2020 One Off
PRIM PRIM-19139 Feb 2020 Feb 2020 One Off
hellocuba.com hellocuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 May 2019 Jun 2019 48 days
SVRN SVRN-265277 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
DM DM-100974 May 2019 May 2019 One Off
NEX NEX-3391 May 2019 May 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellobuckeyetown.com hellobuckeyetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
UA UA-121239807 May 2019 May 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellolincoln.com hellolincoln.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 May 2019 Mar 2020 322 days
SONO SONO-783272317B May 2019 Mar 2020 322 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Mar 2020 322 days
UA UA-121239807 May 2019 Feb 2020 287 days
DM DM-100974 May 2019 Feb 2020 287 days
SVRN SVRN-265277 May 2019 Feb 2020 287 days
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Feb 2020 189 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
AOL AOL-6748 May 2019 Aug 2019 98 days
DM DM-101492 Dec 2019 Feb 2020 64 days
AOL AOL-49648 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
hellolenexa.com hellolenexa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 96 days
NEX NEX-3391 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
DM DM-100974 May 2019 Jun 2019 48 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellomoraga.com hellomoraga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Mar 2020 Aug 2020 137 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
helloplumborough.com helloplumborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellonewdelhi.com hellonewdelhi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
hellowestchicago.com hellowestchicago.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
helloakron.com helloakron.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jul 2019 Aug 2020 1 year, 16 days
CONN CONN-102738 Jun 2019 Mar 2020 278 days
SONO SONO-783272317B Jun 2019 Mar 2020 278 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 278 days
ORC ORC-963 Aug 2019 Mar 2020 210 days
YUME YUME-4016333178 Aug 2019 Mar 2020 210 days
TEAD TEAD-16544 Aug 2019 Mar 2020 210 days
AOL AOL-11647 Aug 2019 Mar 2020 210 days
TELA TELA-457 Aug 2019 Mar 2020 210 days
AVVID AVVID-7802 Aug 2019 Mar 2020 210 days
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
GUMG GUMG-13810 Aug 2019 Mar 2020 210 days
PRIM PRIM-19139 Aug 2019 Mar 2020 210 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 149 days
SVRN SVRN-265277 Jun 2019 Sep 2019 103 days
SVRN SVRN-261774 Dec 2019 Mar 2020 85 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
DM DM-101492 Aug 2019 Sep 2019 35 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
hellolilongwe.com hellolilongwe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118129358-1 Aug 2019 Apr 2021 1 year, 237 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
SONO SONO-783272317B May 2019 Oct 2019 159 days
CONN CONN-102738 May 2019 Oct 2019 159 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Oct 2019 159 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
DM DM-100974 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hellonixa.com hellonixa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2019 98 days
DM DM-100974 May 2019 Aug 2019 98 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
LIJI LIJI-261774 May 2019 Jun 2019 48 days
AOL AOL-6748 May 2019 Jun 2019 48 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
ORC ORC-402 May 2019 May 2019 One Off
FWHL FWHL-762769 May 2019 May 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloprospect.com helloprospect.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
FWHL FWHL-970193 Dec 2019 Mar 2020 99 days
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
TEAD TEAD-16544 Dec 2019 Mar 2020 99 days
SONO SONO-783272317B Dec 2019 Mar 2020 99 days
TELA TELA-457 Dec 2019 Mar 2020 99 days
AVVID AVVID-7802 Dec 2019 Mar 2020 99 days
CONN CONN-102738 Dec 2019 Mar 2020 99 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Mar 2020 99 days
YUME YUME-4016333178 Dec 2019 Mar 2020 99 days
GUMG GUMG-13810 Dec 2019 Mar 2020 99 days
PRIM PRIM-19139 Dec 2019 Mar 2020 99 days
AOL AOL-11647 Dec 2019 Feb 2020 64 days
DM DM-100974 Dec 2019 Feb 2020 64 days
SVRN SVRN-261774 Dec 2019 Feb 2020 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
LIJI LIJI-261774 Feb 2020 Mar 2020 35 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
hellotakhmau.com hellotakhmau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellopittsburgh.com hellopittsburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CONN CONN-102738 Jun 2019 Mar 2020 292 days
SONO SONO-783272317B Jun 2019 Mar 2020 292 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Mar 2020 292 days
UA UA-121239807 May 2019 Jan 2020 263 days
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
ORC ORC-963 Aug 2019 Mar 2020 224 days
TEAD TEAD-16544 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Aug 2019 Mar 2020 224 days
TELA TELA-457 Aug 2019 Mar 2020 224 days
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
YUME YUME-4016333178 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
GUMG GUMG-13810 Aug 2019 Mar 2020 224 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Feb 2020 209 days
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
GTM GTM-UA-121239807-2 Oct 2019 Mar 2020 163 days
SVRN SVRN-261774 Dec 2019 Mar 2020 99 days
AOL AOL-6748 Jun 2019 Jul 2019 48 days
DM DM-101492 Aug 2019 Sep 2019 35 days
NEX NEX-3391 Jul 2019 Aug 2019 20 days
SVRN SVRN-265277 Jun 2019 Jun 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloalaska.com helloalaska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
PUBM PUBM-158017 Aug 2019 Dec 2019 125 days
FWHL FWHL-970193 Aug 2019 Dec 2019 125 days
TEAD TEAD-16544 Aug 2019 Dec 2019 125 days
SONO SONO-783272317B Aug 2019 Dec 2019 125 days
DM DM-100974 Aug 2019 Dec 2019 125 days
SVRN SVRN-265277 Aug 2019 Dec 2019 125 days
LIJI LIJI-261774 Aug 2019 Dec 2019 125 days
ORC ORC-963 Aug 2019 Dec 2019 125 days
TELA TELA-457 Aug 2019 Dec 2019 125 days
AVVID AVVID-7802 Aug 2019 Dec 2019 125 days
CONN CONN-102738 Aug 2019 Dec 2019 125 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Dec 2019 125 days
YUME YUME-4016333178 Aug 2019 Dec 2019 125 days
GUMG GUMG-13810 Aug 2019 Dec 2019 125 days
PRIM PRIM-19139 Aug 2019 Dec 2019 125 days
GTM GTM-UA-121239807-2 Oct 2019 Dec 2019 64 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
DM DM-101492 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
hellovoronezh.com hellovoronezh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
SVRN SVRN-265277 May 2019 Aug 2019 98 days
LIJI LIJI-261774 May 2019 Aug 2019 98 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
CONN CONN-102738 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 Aug 2019 98 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 May 2019 May 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloeureka.com helloeureka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
DM DM-101492 Dec 2019 Dec 2019 One Off
TEAD TEAD-16544 Dec 2019 Dec 2019 One Off
SVRN SVRN-265277 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
ORC ORC-963 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
AOL AOL-11647 Dec 2019 Dec 2019 One Off
FWHL FWHL-970193 Dec 2019 Dec 2019 One Off
TREM TREM-J54V6-5C8FF Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
TELA TELA-457 Dec 2019 Dec 2019 One Off
AVVID AVVID-7802 Dec 2019 Dec 2019 One Off
CONN CONN-102738 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Dec 2019 One Off
YUME YUME-4016333178 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
GUMG GUMG-13810 Dec 2019 Dec 2019 One Off
PRIM PRIM-19139 Dec 2019 Dec 2019 One Off
hellopeterborough.com hellopeterborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Aug 2019 Jan 2021 1 year, 157 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloprovo.com helloprovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
hellomartinique.com hellomartinique.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Mar 2020 Jan 2021 298 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellosarajevo.com hellosarajevo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2019 Jan 2021 1 year, 96 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
hellonewburgh.com hellonewburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloantananarivo.com helloantananarivo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
DM DM-101492 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopharr.com hellopharr.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Oct 2019 Aug 2020 300 days
TEAD TEAD-16544 Oct 2019 Feb 2020 128 days
SVRN SVRN-265277 Oct 2019 Feb 2020 128 days
LIJI LIJI-261774 Oct 2019 Feb 2020 128 days
ORC ORC-963 Oct 2019 Feb 2020 128 days
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 128 days
TELA TELA-457 Oct 2019 Feb 2020 128 days
AVVID AVVID-7802 Oct 2019 Feb 2020 128 days
CONN CONN-102738 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Oct 2019 Feb 2020 128 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Feb 2020 128 days
YUME YUME-4016333178 Oct 2019 Feb 2020 128 days
PUBM PUBM-158017 Oct 2019 Feb 2020 128 days
GUMG GUMG-13810 Oct 2019 Feb 2020 128 days
PRIM PRIM-19139 Oct 2019 Feb 2020 128 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
DM DM-101492 Oct 2019 Oct 2019 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Feb 2020 Feb 2020 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
AOL AOL-11647 Feb 2020 Feb 2020 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
helloberwyn.com helloberwyn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Aug 2020 361 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
GTM GTM-AW-804755169 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellolehi.com hellolehi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Oct 2019 Aug 2020 298 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
NEX NEX-3391 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
DM DM-101492 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Oct 2019 Oct 2019 One Off
hellonairobi.com hellonairobi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
DM DM-101492 Aug 2019 Oct 2019 61 days
SVRN SVRN-265277 Aug 2019 Oct 2019 61 days
LIJI LIJI-261774 Aug 2019 Oct 2019 61 days
ORC ORC-963 Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomcdonough.com hellomcdonough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-11647 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellonewportnews.com hellonewportnews.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SVRN SVRN-261774 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellosaintbarthelemy.com hellosaintbarthelemy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
AOL AOL-11647 Oct 2019 Oct 2019 One Off
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
FWHL FWHL-970193 Oct 2019 Oct 2019 One Off
TEAD TEAD-16544 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
SVRN SVRN-265277 Oct 2019 Oct 2019 One Off
ORC ORC-963 Oct 2019 Oct 2019 One Off
TELA TELA-457 Oct 2019 Oct 2019 One Off
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
CONN CONN-102738 Oct 2019 Oct 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Oct 2019 Oct 2019 One Off
YUME YUME-4016333178 Oct 2019 Oct 2019 One Off
GUMG GUMG-13810 Oct 2019 Oct 2019 One Off
PRIM PRIM-19139 Oct 2019 Oct 2019 One Off
hellocrevecoeur.com hellocrevecoeur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Mar 2020 Mar 2020 One Off
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
helloglenellyn.com helloglenellyn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2019 Oct 2019 61 days
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
FWHL FWHL-970193 Aug 2019 Oct 2019 61 days
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 61 days
TEAD TEAD-16544 Aug 2019 Oct 2019 61 days
SONO SONO-783272317B Aug 2019 Oct 2019 61 days
TELA TELA-457 Aug 2019 Oct 2019 61 days
AVVID AVVID-7802 Aug 2019 Oct 2019 61 days
CONN CONN-102738 Aug 2019 Oct 2019 61 days
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Oct 2019 61 days
YUME YUME-4016333178 Aug 2019 Oct 2019 61 days
GUMG GUMG-13810 Aug 2019 Oct 2019 61 days
PRIM PRIM-19139 Aug 2019 Oct 2019 61 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
SVRN SVRN-265277 Aug 2019 Aug 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
LIJI LIJI-261774 Oct 2019 Oct 2019 One Off
hellomarlborough.com hellomarlborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-970193 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
helloanoka.com helloanoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
DM DM-101492 Dec 2019 Dec 2019 One Off
TEAD TEAD-16544 Dec 2019 Dec 2019 One Off
SVRN SVRN-261774 Dec 2019 Dec 2019 One Off
LIJI LIJI-261774 Dec 2019 Dec 2019 One Off
ORC ORC-963 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
TELA TELA-457 Dec 2019 Dec 2019 One Off
AVVID AVVID-7802 Dec 2019 Dec 2019 One Off
CONN CONN-102738 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Dec 2019 Dec 2019 One Off
YUME YUME-4016333178 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
GUMG GUMG-13810 Dec 2019 Dec 2019 One Off
PRIM PRIM-19139 Dec 2019 Dec 2019 One Off
hellodecatur.com hellodecatur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Mar 2020 Apr 2021 1 year, 13 days
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
DM DM-101492 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellochambersburgborough.com hellochambersburgborough.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
DM DM-101492 Aug 2019 Aug 2019 One Off
TEAD TEAD-16544 Aug 2019 Aug 2019 One Off
LIJI LIJI-261774 Aug 2019 Aug 2019 One Off
ORC ORC-963 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
TELA TELA-457 Aug 2019 Aug 2019 One Off
AVVID AVVID-7802 Aug 2019 Aug 2019 One Off
CONN CONN-102738 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Aug 2019 Aug 2019 One Off
YUME YUME-4016333178 Aug 2019 Aug 2019 One Off
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
GUMG GUMG-13810 Aug 2019 Aug 2019 One Off
PRIM PRIM-19139 Aug 2019 Aug 2019 One Off
hellomoorhead.com hellomoorhead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
LIJI LIJI-261774 Mar 2020 Mar 2020 One Off
FWHL FWHL-970193 Mar 2020 Mar 2020 One Off
TREM TREM-J54V6-5C8FF Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
helloamerica.com helloamerica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Mar 2020 Mar 2020 One Off
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
AOL AOL-11647 Mar 2020 Mar 2020 One Off
TEAD TEAD-16544 Mar 2020 Mar 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
ORC ORC-963 Mar 2020 Mar 2020 One Off
TELA TELA-457 Mar 2020 Mar 2020 One Off
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
CONN CONN-102738 Mar 2020 Mar 2020 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Mar 2020 Mar 2020 One Off
YUME YUME-4016333178 Mar 2020 Mar 2020 One Off
GUMG GUMG-13810 Mar 2020 Mar 2020 One Off
PRIM PRIM-19139 Mar 2020 Mar 2020 One Off
hellodinuba.com hellodinuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jun 2019 Jun 2019 One Off
DM DM-100974 Jun 2019 Jun 2019 One Off
NEX NEX-3391 Jun 2019 Jun 2019 One Off
SVRN SVRN-265277 Jun 2019 Jun 2019 One Off
LIJI LIJI-261774 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
CONN CONN-102738 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E Jun 2019 Jun 2019 One Off
hellogeneva.com hellogeneva.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
DM DM-100974 May 2019 May 2019 One Off
NEX NEX-3391 May 2019 May 2019 One Off
LIJI LIJI-261774 May 2019 May 2019 One Off
AOL AOL-6748 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
CONN CONN-102738 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E May 2019 May 2019 One Off
helloaligarh.com helloaligarh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobari.com hellobari.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Oct 2019 Aug 2020 300 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellodonetsk.com hellodonetsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellokaraj.com hellokaraj.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Dec 2019 Aug 2020 236 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellolinz.com hellolinz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Dec 2019 Dec 2019 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellobilbao.com hellobilbao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobrno.com hellobrno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellochelyabinsk.com hellochelyabinsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellorugao.com hellorugao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloulyanovsk.com helloulyanovsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
hellovitebsk.com hellovitebsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloyichun.com helloyichun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloblagoveshchensk.com helloblagoveshchensk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellokiev.com hellokiev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-121239807 Dec 2019 Aug 2020 234 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
GTM GTM-UA-121239807-2 Dec 2019 Dec 2019 One Off
hellokryvyirih.com hellokryvyirih.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellorizhao.com hellorizhao.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellobishkek.com hellobishkek.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-121239807 Aug 2019 Aug 2020 362 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokhabarovsk.com hellokhabarovsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellokoln.com hellokoln.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloliuzhou.com helloliuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
hellolugansk.com hellolugansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellorybinsk.com hellorybinsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellotomsk.com hellotomsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloquito.com helloquito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobordeaux.com hellobordeaux.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellochangsha.com hellochangsha.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-121239807 Aug 2019 Feb 2020 189 days
GTM GTM-UA-118129358-1 Sep 2020 Apr 2021 189 days
GTM GTM-UA-121239807-2 Oct 2019 Feb 2020 128 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellosuzhouanhui.com hellosuzhouanhui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Feb 2020 Feb 2020 One Off
GTM GTM-UA-121239807-2 Feb 2020 Feb 2020 One Off
hellobryansk.com hellobryansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloirkutsk.com helloirkutsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
helloportharcourt.com helloportharcourt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellozhengzhou.com hellozhengzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobangui.com hellobangui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Feb 2020 Feb 2020 One Off
GTM GTM-UA-121239807-2 Feb 2020 Feb 2020 One Off
hellohezhou.com hellohezhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
hellokrasnoyarsk.com hellokrasnoyarsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellolipetsk.com hellolipetsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellomagnitogorsk.com hellomagnitogorsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
hellomurmansk.com hellomurmansk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Oct 2019 Oct 2019 One Off
GTM GTM-UA-121239807-2 Oct 2019 Oct 2019 One Off
hellooslo.com hellooslo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohonduras.com hellohonduras.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloashgabat.com helloashgabat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobamako.com hellobamako.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellobaotou.com hellobaotou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobarquisimeto.com hellobarquisimeto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobelem.com hellobelem.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellobudapest.com hellobudapest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobursa.com hellobursa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochangzhou.com hellochangzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogaozhou.com hellogaozhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogomel.com hellogomel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokabul.com hellokabul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellokaragandy.com hellokaragandy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokinshasa.com hellokinshasa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellokirov.com hellokirov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloluzhou.com helloluzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Sep 2020 Apr 2021 189 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomagdeburg.com hellomagdeburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomalmo.com hellomalmo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomedicinehat.com hellomedicinehat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Oct 2020 2 years, 20 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomosul.com hellomosul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonovaiguacu.com hellonovaiguacu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellonuremberg.com hellonuremberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloorenburg.com helloorenburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellorabat.com hellorabat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloreykjavik.com helloreykjavik.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellotengzhou.com hellotengzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotripoli.com hellotripoli.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jul 2020 Apr 2021 268 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowoodbuffalo.com hellowoodbuffalo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloxintai.com helloxintai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloalmaty.com helloalmaty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobards.com hellobards.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 92 days
UA UA-118129358 Jun 2021 Jan 2022 187 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobrantford.com hellobrantford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocampinas.com hellocampinas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellochangchun.com hellochangchun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellochristchurch.com hellochristchurch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 4 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellociudadguayana.com hellociudadguayana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocoquitlam.com hellocoquitlam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohamburg.com hellohamburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohuzhou.com hellohuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojoaopessoa.com hellojoaopessoa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellokyoto.com hellokyoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolusaka.com hellolusaka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomainz.com hellomainz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellomogilev.com hellomogilev.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellomuscat.com hellomuscat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellonezahualcoyotl.com hellonezahualcoyotl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopalermo.com hellopalermo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorotherham.com hellorotherham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotaizhou.com hellotaizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellowakefield.com hellowakefield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloyekaterinburg.com helloyekaterinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellozhangjiakou.com hellozhangjiakou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobogra.com hellobogra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloberlin.com helloberlin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobozhou.com hellobozhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
hellochennai.com hellochennai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellociudadjuarez.com hellociudadjuarez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocixi.com hellocixi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocotonou.com hellocotonou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodavaocity.com hellodavaocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodongtai.com hellodongtai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloedinburg.com helloedinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloerdenet.com helloerdenet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloguangzhou.com helloguangzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
UA UA-121239807 Jun 2019 Jun 2019 One Off
hellojakarta.com hellojakarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojixi.com hellojixi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomaputo.com hellomaputo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloxuzhou.com helloxuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosaguenay.com hellosaguenay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobenghazi.com hellobenghazi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobissau.com hellobissau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobrasov.com hellobrasov.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocantho.com hellocantho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 97 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellochisinau.com hellochisinau.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohamamatsu.com hellohamamatsu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
helloheidelberg.com helloheidelberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohuazhou.com hellohuazhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojinzhou.com hellojinzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokumamoto.com hellokumamoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolaizhou.com hellolaizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellomirat.com hellomirat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloriffa.com helloriffa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosaanich.com hellosaanich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanpaulo.com hellosanpaulo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellostpetersburg.com hellostpetersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotongzhou.com hellotongzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellozurich.com hellozurich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomanama.com hellomanama.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojoliet.com hellojoliet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanangelo.com hellosanangelo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomanaus.com hellomanaus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
gotceleb.com gotceleb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 189 days
DM DM-100974 Sep 2019 Feb 2020 154 days
PUBM PUBM-158017 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellobrossard.com hellobrossard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocebucity.com hellocebucity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloclujnapoca.com helloclujnapoca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloconakry.com helloconakry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocorinth.com hellocorinth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocuritiba.com hellocuritiba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodammam.com hellodammam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodeerfieldbeach.com hellodeerfieldbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloeastmoline.com helloeastmoline.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloezhou.com helloezhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellogreatersudbury.com hellogreatersudbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloharbin.com helloharbin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloilorin.com helloilorin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloinnsbruck.com helloinnsbruck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokaduna.com hellokaduna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokaliningrad.com hellokaliningrad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokatowice.com hellokatowice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokitakyushu.com hellokitakyushu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellokitwe.com hellokitwe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokobe.com hellokobe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolaplata.com hellolaplata.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloluanda.com helloluanda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolubumbashi.com hellolubumbashi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomanila.com hellomanila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomuharraq.com hellomuharraq.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloopelousas.com helloopelousas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopalikir.com hellopalikir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloplovdiv.com helloplovdiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellopuertovallarta.com hellopuertovallarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorawalpindi.com hellorawalpindi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
helloskopelos.com helloskopelos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellotegucigalpa.com hellotegucigalpa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellothunderbay.com hellothunderbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Nov 2021 Sep 2022 294 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotoronto.com hellotoronto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellovalletta.com hellovalletta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellovirginiabeach.com hellovirginiabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellovisakhapatnam.com hellovisakhapatnam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodownersgrove.com hellodownersgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowestpalmbeach.com hellowestpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobaghdad.com hellobaghdad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobeiliu.com hellobeiliu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellobelarus.com hellobelarus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobogota.com hellobogota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobraila.com hellobraila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobrisbane.com hellobrisbane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobucaramanga.com hellobucaramanga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocairo.com hellocairo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochemnitz.com hellochemnitz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloduquedecaxias.com helloduquedecaxias.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofreeport.com hellofreeport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofuxin.com hellofuxin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogaborone.com hellogaborone.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogwangju.com hellogwangju.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohubli.com hellohubli.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloimperialbeach.com helloimperialbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellokanazawa.com hellokanazawa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokano.com hellokano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokaunas.com hellokaunas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokolwezi.com hellokolwezi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolamatanza.com hellolamatanza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloleipzig.com helloleipzig.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellonewmarket.com hellonewmarket.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloniigata.com helloniigata.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellookayama.com hellookayama.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloosaka.com helloosaka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopittsburg.com hellopittsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloportelizabeth.com helloportelizabeth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellorajkot.com hellorajkot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorosario.com hellorosario.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosalford.com hellosalford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosendai.com hellosendai.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloshishi.com helloshishi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloshizuoka.com helloshizuoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosuizhou.com hellosuizhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogreenfield.com hellogreenfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloadelanto.com helloadelanto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloagra.com helloagra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloahwaz.com helloahwaz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2018 Jan 2021 2 years, 68 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Nov 2018 Nov 2018 One Off
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
helloaqaba.com helloaqaba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
helloarequipa.com helloarequipa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobangkok.com hellobangkok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobanjul.com hellobanjul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobasra.com hellobasra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloburnaby.com helloburnaby.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobydgoszcz.com hellobydgoszcz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellocapetown.com hellocapetown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochangshu.com hellochangshu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocheyenne.com hellocheyenne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellochiba.com hellochiba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellodaye.com hellodaye.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodouala.com hellodouala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodusseldorf.com hellodusseldorf.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogent.com hellogent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloguarulhos.com helloguarulhos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohamadtown.com hellohamadtown.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohavana.com hellohavana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokaluga.com hellokaluga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokermanshah.com hellokermanshah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokiel.com hellokiel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloklamathfalls.com helloklamathfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellokursk.com hellokursk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellolapaz.com hellolapaz.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellolaspalmas.com hellolaspalmas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolimerick.com hellolimerick.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolubeck.com hellolubeck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopingdu.com hellopingdu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
helloqiqihar.com helloqiqihar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorostock.com hellorostock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloroyalpalmbeach.com helloroyalpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosalzburg.com hellosalzburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosochi.com hellosochi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosouthfield.com hellosouthfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosurakarta.com hellosurakarta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotoluca.com hellotoluca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotula.com hellotula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovladimir.com hellovladimir.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloyaroslavl.com helloyaroslavl.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
helloyuzhou.com helloyuzhou.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
sizzlepixs.com sizzlepixs.com
Attribute Value First Detected Last Detected Overlap Duration
CONN CONN-102738 May 2019 Mar 2020 301 days
PRIM PRIM-19139 Aug 2019 Mar 2020 224 days
FWHL FWHL-970193 Sep 2019 Feb 2020 181 days
TELA TELA-457 Aug 2019 Nov 2019 86 days
TREM TREM-J54V6-5C8FF Dec 2019 Feb 2020 78 days
hellorio.com hellorio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloallahabad.com helloallahabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloanqiu.com helloanqiu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellobarnaul.com hellobarnaul.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobasrah.com hellobasrah.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellobijie.com hellobijie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobochum.com hellobochum.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobucharest.com hellobucharest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocancun.com hellocancun.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellocheboksary.com hellocheboksary.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocochabamba.com hellocochabamba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellocologne.com hellocologne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocordoba.com hellocordoba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
helloegypt.com helloegypt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
helloflorence.com helloflorence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofrankfurt.com hellofrankfurt.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogothenburg.com hellogothenburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohamm.com hellohamm.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellohermosillo.com hellohermosillo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloheze.com helloheze.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellohiroshima.com hellohiroshima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohohhot.com hellohohhot.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojuarez.com hellojuarez.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokawasaki.com hellokawasaki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellokharkiv.com hellokharkiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellokrasnodar.com hellokrasnodar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolaiwu.com hellolaiwu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolemongrove.com hellolemongrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolongueuil.com hellolongueuil.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomexicali.com hellomexicali.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomontecarlo.com hellomontecarlo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomykolaiv.com hellomykolaiv.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellonakhonratchasima.com hellonakhonratchasima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Jul 2022 315 days
GTM GTM-UA-118129358-1 Sep 2020 Apr 2021 189 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloorsk.com helloorsk.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
GTM GTM-UA-118163407-2 Nov 2018 Nov 2018 One Off
hellopalmbeach.com hellopalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloperth.com helloperth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloseongnam.com helloseongnam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloshangqiu.com helloshangqiu.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Nov 2018 Nov 2018 One Off
hellovilnius.com hellovilnius.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellovladivostok.com hellovladivostok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogallatin.com hellogallatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomamaroneck.com hellomamaroneck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellograndprairie.com hellograndprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloisfahan.com helloisfahan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellogardengrove.com hellogardengrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
atvrider.com atvrider.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Nov 2019 169 days
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
thebiglead.com thebiglead.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Nov 2019 169 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
helloniamey.com helloniamey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
thehindu.com thehindu.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 175 days
PUBM PUBM-158017 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
baseballessential.com baseballessential.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
DM DM-100974 Jun 2019 Jul 2019 48 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
hellokeywest.com hellokeywest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohavelock.com hellohavelock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosinteustatius.com hellosinteustatius.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowoodstock.com hellowoodstock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
decades.com decades.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ORC ORC-402 May 2019 May 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dexerto.es dexerto.es
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 108 days
SONO SONO-783272317B Jun 2019 Sep 2019 108 days
FWHL FWHL-762769 May 2019 May 2019 One Off
DM DM-100974 Jun 2019 Jun 2019 One Off
dexerto.fr dexerto.fr
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 149 days
DM DM-100974 Jun 2019 Aug 2019 49 days
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
FWHL FWHL-762769 May 2019 May 2019 One Off
elections.in elections.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
fieldandstreamexpo.com fieldandstreamexpo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Dec 2019 218 days
DM DM-100974 Aug 2019 Dec 2019 123 days
FWHL FWHL-762769 May 2019 May 2019 One Off
AOL AOL-49648 Dec 2019 Dec 2019 One Off
fstoppers.com fstoppers.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
haccricket.org haccricket.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jun 2019 48 days
ORC ORC-402 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
helloalgiers.com helloalgiers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
UA UA-121239807 Jun 2020 Jun 2020 One Off
hellobarcelona.com hellobarcelona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobarranquilla.com hellobarranquilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobrussels.com hellobrussels.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobuckscounty.com hellobuckscounty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellocerritos.com hellocerritos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocharleroi.com hellocharleroi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellochatham-kent.com hellochatham-kent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocolorado.com hellocolorado.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocostarica.com hellocostarica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodublin.com hellodublin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloduluth.com helloduluth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloecatepec.com helloecatepec.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofargo.com hellofargo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogreatfalls.com hellogreatfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogrodno.com hellogrodno.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojalandhar.com hellojalandhar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokhartoum.com hellokhartoum.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolynchburg.com hellolynchburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomaceio.com hellomaceio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonewport.com hellonewport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonorthfield.com hellonorthfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopleasantgrove.com hellopleasantgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopompanobeach.com hellopompanobeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopostfalls.com hellopostfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorochesterhills.com hellorochesterhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosanbernardino.com hellosanbernardino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosarnia.com hellosarnia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosolanabeach.com hellosolanabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellostrasbourg.com hellostrasbourg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotientsin.com hellotientsin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellotogo.com hellotogo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotukwila.com hellotukwila.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowaltham.com hellowaltham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowoodlandhills.com hellowoodlandhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
becauseofthemwecan.com becauseofthemwecan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
hellohayward.com hellohayward.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
workingmother.com workingmother.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
DM DM-100974 Nov 2019 Nov 2019 One Off
hellotallinn.com hellotallinn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloindiantrail.com helloindiantrail.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
dexerto.com dexerto.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 90 days
FWHL FWHL-762769 May 2019 May 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dinamani.com dinamani.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 175 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
floridatravellife.com floridatravellife.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
DM DM-100974 Jun 2019 Sep 2019 104 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
helloabidjan.com helloabidjan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Apr 2021 300 days
UA UA-121239807 Jun 2020 Jun 2020 One Off
helloaccra.com helloaccra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloamritsar.com helloamritsar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloarlingtonheights.com helloarlingtonheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloaustin.com helloaustin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobeijing.com hellobeijing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobielefeld.com hellobielefeld.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocamas.com hellocamas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 3 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocedarrapids.com hellocedarrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellochesterfield.com hellochesterfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloclevelandheights.com helloclevelandheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocozumel.com hellocozumel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloedina.com helloedina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofortwaltonbeach.com hellofortwaltonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofoshan.com hellofoshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellogateshead.com hellogateshead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloguadeloupe.com helloguadeloupe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloguatemala.com helloguatemala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloindiana.com helloindiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloirvine.com helloirvine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloleeds.com helloleeds.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolima.com hellolima.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomarseilles.com hellomarseilles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomelekeok.com hellomelekeok.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomikonos.com hellomikonos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomodesto.com hellomodesto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonorthlasvegas.com hellonorthlasvegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellooman.com hellooman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Jun 2020 Jan 2021 220 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopalmademallorca.com hellopalmademallorca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopalmettobay.com hellopalmettobay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopampa.com hellopampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopuebla.com hellopuebla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellorepentigny.com hellorepentigny.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118129358 Mar 2022 May 2022 74 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosiouxfalls.com hellosiouxfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotexasusa.com hellotexasusa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellothessaloniki.com hellothessaloniki.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellotianshui.com hellotianshui.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellozakynthos.com hellozakynthos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellozapopan.com hellozapopan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hindisahayta.in hindisahayta.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
matadornetwork.com matadornetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
PRIM PRIM-19139 Nov 2019 Mar 2020 110 days
hellomontserrat.com hellomontserrat.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloyorbalinda.com helloyorbalinda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
scubadiving.com scubadiving.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Nov 2019 121 days
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
hellolibreville.com hellolibreville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowichita.com hellowichita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
sportspyder.com sportspyder.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 231 days
PUBM PUBM-158017 Sep 2019 Jan 2020 130 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
streetchopperweb.com streetchopperweb.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Nov 2019 169 days
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
tamilsuvai.com tamilsuvai.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 135 days
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 135 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
biggboss2.net biggboss2.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 273 days
PUBM PUBM-158017 Sep 2019 Feb 2020 131 days
FWHL FWHL-762737 Aug 2019 Nov 2019 109 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloaugusta.com helloaugusta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloeaglepass.com helloeaglepass.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
diversitybestpractices.com diversitybestpractices.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
hellooakforest.com hellooakforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloastana.com helloastana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloaustria.com helloaustria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellobahamas.com hellobahamas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobayonne.com hellobayonne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobelgrade.com hellobelgrade.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloberea.com helloberea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobujumbura.com hellobujumbura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocasablanca.com hellocasablanca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocorona.com hellocorona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodallas.com hellodallas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellodelraybeach.com hellodelraybeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodeltona.com hellodeltona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofortsmith.com hellofortsmith.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellofountainhills.com hellofountainhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogardena.com hellogardena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 2 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogibraltar.com hellogibraltar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellogujranwala.com hellogujranwala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokemerovo.com hellokemerovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokent.com hellokent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomilan.com hellomilan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Jun 2020 Jun 2020 One Off
hellomontegobay.com hellomontegobay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellomonticello.com hellomonticello.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonewburyport.com hellonewburyport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 2 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonewsmyrnabeach.com hellonewsmyrnabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonorthmyrtlebeach.com hellonorthmyrtlebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopacificbeach.com hellopacificbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopawtucket.com hellopawtucket.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloqom.com helloqom.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jan 2022 187 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloredondobeach.com helloredondobeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosanantonio.com hellosanantonio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosanbenito.com hellosanbenito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosanluispotosi.com hellosanluispotosi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellosanrafael.com hellosanrafael.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellotoulouse.com hellotoulouse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellotulsa.com hellotulsa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloutrecht.com helloutrecht.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellovaldosta.com hellovaldosta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellovenice.com hellovenice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellovernonhills.com hellovernonhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowarwick.com hellowarwick.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowichitafalls.com hellowichitafalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloyarmouth.com helloyarmouth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
puckermob.com puckermob.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jun 2019 Jan 2020 234 days
AOL AOL-6748 Jul 2019 Jan 2020 186 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
hellomelbourne.com hellomelbourne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
sportdiver.com sportdiver.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
DM DM-100974 Sep 2019 Nov 2019 65 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
hellobarbuda.com hellobarbuda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
deccanherald.com deccanherald.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 276 days
FWHL FWHL-762737 Aug 2019 Dec 2019 115 days
PUBM PUBM-158017 Dec 2019 Mar 2020 103 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
denofgeek.com denofgeek.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
dgreetings.com dgreetings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellowatauga.com hellowatauga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
goneoutdoors.com goneoutdoors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 100 days
SONO SONO-783272317B May 2019 Aug 2019 97 days
ORC ORC-402 May 2019 May 2019 One Off
DM DM-100974 Jun 2019 Jun 2019 One Off
gunandgame.com gunandgame.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ORC ORC-402 May 2019 May 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
helloagawam.com helloagawam.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocatania.com hellocatania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocarrboro.com hellocarrboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellodaytona.com hellodaytona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellodaytonabeach.com hellodaytonabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloduisburg.com helloduisburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellodurham.com hellodurham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Jun 2020 Jun 2020 One Off
helloedenprairie.com helloedenprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloelcerrito.com helloelcerrito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloeunice.com helloeunice.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellofairfield.com hellofairfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofife.com hellofife.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellofukuoka.com hellofukuoka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohaltonhills.com hellohaltonhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellohannover.com hellohannover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohermosabeach.com hellohermosabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloivanovo.com helloivanovo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellojenks.com hellojenks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellojessore.com hellojessore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellojohannesburg.com hellojohannesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellokanpur.com hellokanpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 4 days
hellokualalumpur.com hellokualalumpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolakezurich.com hellolakezurich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolasi.com hellolasi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellolindenhurst.com hellolindenhurst.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolomalinda.com hellolomalinda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomarietta.com hellomarietta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomedellin.com hellomedellin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 3 days
hellomiramar.com hellomiramar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomontanausa.com hellomontanausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomortongrove.com hellomortongrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomoscow.com hellomoscow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomunich.com hellomunich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonorthmankato.com hellonorthmankato.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonovato.com hellonovato.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloogbomosho.com helloogbomosho.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-121239807 May 2019 May 2019 One Off
hellooviedo.com hellooviedo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopaloalto.com hellopaloalto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopaloshills.com hellopaloshills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopenza.com hellopenza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellopittsfield.com hellopittsfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopodgorica.com hellopodgorica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloquebeccity.com helloquebeccity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jan 2022 Sep 2022 244 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloriodejaneiro.com helloriodejaneiro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloriverfalls.com helloriverfalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosalinas.com hellosalinas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosausalito.com hellosausalito.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloskiathos.com helloskiathos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosomerset.com hellosomerset.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellothecolony.com hellothecolony.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloturkscaicos.com helloturkscaicos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellovicksburg.com hellovicksburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovolgograd.com hellovolgograd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellowarrensburg.com hellowarrensburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellozaragoza.com hellozaragoza.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
indiantelevision.com indiantelevision.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hellorichmond.com hellorichmond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosulphur.com hellosulphur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
rugerpistolforums.com rugerpistolforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hellosunprairie.com hellosunprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
sanlian0898.com sanlian0898.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
redlineutvforums.net redlineutvforums.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
sbobrfc.co.uk sbobrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
ahoramismo.com ahoramismo.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 May 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
DM DM-100974 Sep 2019 Sep 2019 One Off
sefha.ca sefha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Feb 2020 117 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Nov 2019 Nov 2019 One Off
helloaspen.com helloaspen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
shebeigongsi.com shebeigongsi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
solsticeforum.com solsticeforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sonerai.net sonerai.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 137 days
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Jan 2020 Jan 2020 One Off
apnamudda.com apnamudda.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Nov 2019 65 days
PUBM PUBM-158017 Sep 2019 Nov 2019 65 days
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
sparktalk.com sparktalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
sufcacademy.com sufcacademy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
super9.org super9.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 24 days
AOL AOL-6748 Jan 2020 Jan 2020 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
suzukiatvforums.com suzukiatvforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
swellinfo.com swellinfo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
synonym.com synonym.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
szglhssy.com szglhssy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
taopjw.com taopjw.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
atvinsurance.com atvinsurance.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
techsupportforum.com techsupportforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
telemundowi.com telemundowi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Nov 2019 164 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Nov 2019 Mar 2020 116 days
tgqhj.com tgqhj.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thegoatspot.net thegoatspot.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
thefader.com thefader.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
thehuddle.com thehuddle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
thepaw.com thepaw.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
thesnhl.com thesnhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 299 days
FWHL FWHL-762737 Sep 2019 Jan 2020 129 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
theweek.com theweek.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Nov 2019 121 days
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
top5.com top5.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
toyotanation.com toyotanation.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
tpwhl.com tpwhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 250 days
FWHL FWHL-762737 Aug 2019 Mar 2020 206 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
trx450rforum.com trx450rforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
umtata.cn umtata.cn
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
billboard.com billboard.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
bizfluent.com bizfluent.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Sep 2019 142 days
ORC ORC-402 May 2019 May 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
vattistore.com vattistore.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
velosterturbo.org velosterturbo.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vidmax.com vidmax.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Mar 2020 189 days
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
helloanchorage.com helloanchorage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
bmwlt.com bmwlt.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
boatingmag.com boatingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
DM DM-100974 Jun 2019 Jul 2019 48 days
winsloecharlottetownfc.ca winsloecharlottetownfc.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
bullnettlenews.com bullnettlenews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cadillacforums.com cadillacforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
caferacer.net caferacer.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
catfish1.com catfish1.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
celebrityborn.com celebrityborn.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 170 days
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 170 days
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
hellomesquite.com hellomesquite.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
am.com.mx am.com.mx
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
hellovalparaiso.com hellovalparaiso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
cherokeetalk.com cherokeetalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
chevymalibuforum.com chevymalibuforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clubxterra.org clubxterra.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
corvette-forum.com corvette-forum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cuidatudinero.com cuidatudinero.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 49 days
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
customfighters.com customfighters.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dailydot.com dailydot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
defendersource.com defendersource.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
dimensionsmagazine.com dimensionsmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Feb 2020 190 days
DM DM-100974 Dec 2019 Feb 2020 67 days
AOL AOL-49648 Oct 2019 Dec 2019 54 days
dippy.org dippy.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dogforums.com dogforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
doityourself.com doityourself.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ebaumsworld.com ebaumsworld.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
edgefanatics.com edgefanatics.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Feb 2020 72 days
DM DM-100974 Feb 2020 Feb 2020 One Off
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
electrek.co electrek.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 92 days
SONO SONO-783272317B May 2019 Aug 2019 92 days
ORC ORC-402 May 2019 May 2019 One Off
eluniversal.com.co eluniversal.com.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
entertainmentforus.com entertainmentforus.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 283 days
FWHL FWHL-762737 Aug 2019 Mar 2020 221 days
FWHL FWHL-762769 May 2019 May 2019 One Off
fjcruiserforums.com fjcruiserforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
floor8.com floor8.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
DM DM-100974 May 2019 Jun 2019 45 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
helloyork.com helloyork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobatonrouge.com hellobatonrouge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
goosehuntingchat.com goosehuntingchat.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
guitarscanada.com guitarscanada.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
handitv.com handitv.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ORC ORC-402 May 2019 May 2019 One Off
helloaachen.com helloaachen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloalbertlea.com helloalbertlea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloalhambra.com helloalhambra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloaltoona.com helloaltoona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloamman.com helloamman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloarkansas.com helloarkansas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloatlanta.com helloatlanta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloauckland.com helloauckland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobattambang.com hellobattambang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobermuda.com hellobermuda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobethesda.com hellobethesda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloboyntonbeach.com helloboyntonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobrainerd.com hellobrainerd.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobrampton.com hellobrampton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobristol.com hellobristol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobroomfield.com hellobroomfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobucheon.com hellobucheon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocaledon.com hellocaledon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocentralpoint.com hellocentralpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochulavista.com hellochulavista.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocopenhagen.com hellocopenhagen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocostamesa.com hellocostamesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocraiova.com hellocraiova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocresthill.com hellocresthill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jul 2020 Jul 2020 One Off
helloculiacan.com helloculiacan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodaejeon.com hellodaejeon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodamascus.com hellodamascus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodanyang.com hellodanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodaqing.com hellodaqing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodecaturil.com hellodecaturil.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodortmund.com hellodortmund.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodresden.com hellodresden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodudley.com hellodudley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloeastpoint.com helloeastpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloeastridge.com helloeastridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloeugene.com helloeugene.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloflorida.com helloflorida.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Dec 2020 2 years, 95 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofortwayne.com hellofortwayne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofuqing.com hellofuqing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogilber.com hellogilber.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
helloglencove.com helloglencove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogloucester.com hellogloucester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 3 days
hellogoleta.com hellogoleta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogoodyear.com hellogoodyear.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohamhung.com hellohamhung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaverhill.com hellohaverhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohoover.com hellohoover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloindonesia.com helloindonesia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
helloisrael.com helloisrael.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojeffersonville.com hellojeffersonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 May 2019 Aug 2020 1 year, 94 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellokamloops.com hellokamloops.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokansas.com hellokansas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolacoruna.com hellolacoruna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolagunaniguel.com hellolagunaniguel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolamirada.com hellolamirada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolaval.com hellolaval.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellolefkada.com hellolefkada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolevis.com hellolevis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolianjiang.com hellolianjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolisbon.com hellolisbon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolockport.com hellolockport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolongmont.com hellolongmont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolosgatos.com hellolosgatos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolowell.com hellolowell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jul 2020 Jul 2020 One Off
hellolubbock.com hellolubbock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomadagascar.com hellomadagascar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomannheim.com hellomannheim.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellombabane.com hellombabane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomilford.com hellomilford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomineola.com hellomineola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomontebello.com hellomontebello.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomountjuliet.com hellomountjuliet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomudanjiang.com hellomudanjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomunster.com hellomunster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellomykonos.com hellomykonos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonanchang.com hellonanchang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonantes.com hellonantes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonebraska.com hellonebraska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonewbritain.com hellonewbritain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellonewportbeach.com hellonewportbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonorthvancouver.com hellonorthvancouver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellooakville.com hellooakville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloopelika.com helloopelika.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloparis.com helloparis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopascagoula.com hellopascagoula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellophilippines.com hellophilippines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopickering.com hellopickering.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Nov 2020 One Off
helloportoalegre.com helloportoalegre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Sep 2020 Apr 2021 189 days
helloprague.com helloprague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopraia.com hellopraia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellopusan.com hellopusan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloqidong.com helloqidong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloreggiocalabria.com helloreggiocalabria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
helloriverside.com helloriverside.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellorohnertpark.com hellorohnertpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloromulus.com helloromulus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorosemead.com hellorosemead.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellorostovondon.com hellorostovondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloroundrock.com helloroundrock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloruian.com helloruian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosansalvador.com hellosansalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Oct 2020 2 years, 20 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosaoluis.com hellosaoluis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloseville.com helloseville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloshouguang.com helloshouguang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosouthcarolina.com hellosouthcarolina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellostpeters.com hellostpeters.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2020 Aug 2020 60 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosuwon.com hellosuwon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotaiyuan.com hellotaiyuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloteheran.com helloteheran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloterrebonne.com helloterrebonne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
UA UA-118163407 Jan 2021 Apr 2021 80 days
hellotimisoara.com hellotimisoara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotonga.com hellotonga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotortola.com hellotortola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloturin.com helloturin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellotver.com hellotver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotwinsburg.com hellotwinsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloulaanbaatar.com helloulaanbaatar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellovail.com hellovail.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovarna.com hellovarna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellovientiane.com hellovientiane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellovillapark.com hellovillapark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellovirgingorda.com hellovirgingorda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloweinan.com helloweinan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowestlafayette.com hellowestlafayette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowiesbaden.com hellowiesbaden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloxinyang.com helloxinyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
highdefdigest.com highdefdigest.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
historyanswers.co.uk historyanswers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 209 days
SONO SONO-783272317B Sep 2019 Jan 2020 131 days
AOL AOL-49648 Jan 2020 Feb 2020 23 days
hollywoodreporter.com hollywoodreporter.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
hyundai-forums.com hyundai-forums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ibsgroup.org ibsgroup.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
ihcubcadet.com ihcubcadet.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 124 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
DM DM-100974 Nov 2019 Feb 2020 89 days
jagran.com jagran.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
jplay.com.au jplay.com.au
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Mar 2020 317 days
DM DM-100974 May 2019 Feb 2020 282 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
jsfhbxg.cn jsfhbxg.cn
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jszpwmh.com jszpwmh.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kawasakiversys.com kawasakiversys.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ktn123.com ktn123.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
liuhezaixiantouzhu789.net liuhezaixiantouzhu789.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
maindy.co.uk maindy.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
marlinmag.com marlinmag.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
metalguitarist.org metalguitarist.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mingjunlengfengku.com mingjunlengfengku.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
missouriwhitetails.com missouriwhitetails.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Mar 2020 Mar 2020 14 days
motorcycle.com motorcycle.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mtxvh.cn mtxvh.cn
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mvagusta.net mvagusta.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
ninja250sl.com ninja250sl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
ninjabeat.com ninjabeat.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Dec 2019 226 days
SONO SONO-783272317B May 2019 Dec 2019 226 days
AOL AOL-49648 Oct 2019 Oct 2019 15 days
oddee.com oddee.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
SONO SONO-783272317B Nov 2019 Jan 2020 65 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
ohiosportsman.com ohiosportsman.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 186 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jun 2019 Jul 2019 48 days
oyt-tool.com oyt-tool.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
painttalk.com painttalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
pcgamer.com pcgamer.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
piperforum.com piperforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jan 2020 186 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Jul 2019 Nov 2019 120 days
polarisatvforums.com polarisatvforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
qad7.com qad7.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
qingdaorilin.com qingdaorilin.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
quiltingboard.com quiltingboard.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jul 2019 Nov 2019 121 days
abc57.com abc57.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
hellobradenton.com hellobradenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolivermore.com hellolivermore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
achoylake.com achoylake.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 80 days
DM DM-100974 May 2019 Jun 2019 32 days
SONO SONO-783272317B May 2019 Jun 2019 32 days
rugby365.com rugby365.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 189 days
DM DM-100974 Sep 2019 Feb 2020 154 days
AOL AOL-49648 Jan 2020 Feb 2020 24 days
rugbyforums.com rugbyforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
rugerforum.net rugerforum.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ryanshay.ca ryanshay.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 204 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Jan 2020 Jan 2020 One Off
sacnilk.com sacnilk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 204 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 204 days
PUBM PUBM-158017 Feb 2020 Mar 2020 22 days
saveur.com saveur.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
sddashiqi.com sddashiqi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sdqxwc.com sdqxwc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sdxinbao.net sdxinbao.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
shnc.co.uk shnc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Sep 2019 100 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
DM DM-100974 May 2019 May 2019 One Off
shuyougep.com shuyougep.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sigarms556.com sigarms556.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sigtalk.com sigtalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sniperforums.com sniperforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sofeminine.co.uk sofeminine.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 189 days
DM DM-100974 Sep 2019 Feb 2020 154 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
starbikeforums.com starbikeforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
subaruforester.org subaruforester.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
svengoolie.com svengoolie.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Jan 2020 Feb 2020 24 days
sxfzhb.com sxfzhb.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
szjg17.com szjg17.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
taiziyulecheng991.com taiziyulecheng991.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
taurusarmed.net taurusarmed.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
audiforum.us audiforum.us
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
audizine.com audizine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
austinbassfishing.com austinbassfishing.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
theforce.net theforce.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Jan 2020 One Off
SONO SONO-783272317B Jan 2020 Jan 2020 One Off
DM DM-100974 Jan 2020 Jan 2020 One Off
baggersmag.com baggersmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
DM DM-100974 Jul 2019 Jul 2019 One Off
timberland-tmall.com timberland-tmall.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
tmall-vans.com tmall-vans.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tongyi763.cn tongyi763.cn
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
travelingmom.com travelingmom.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
SONO SONO-783272317B Sep 2019 Nov 2019 65 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
tundrasolutions.com tundrasolutions.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bhaskar.com bhaskar.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
biabcalculator.com biabcalculator.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 237 days
DM DM-100974 Sep 2019 Feb 2020 145 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
vibe.com vibe.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 110 days
DM DM-100974 Nov 2019 Feb 2020 89 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
vinepair.com vinepair.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-19139 Aug 2019 Jan 2020 165 days
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bmgmediasolutions.com bmgmediasolutions.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Nov 2019 208 days
FWHL FWHL-762737 Aug 2019 Nov 2019 110 days
DM DM-100974 Jul 2019 Jul 2019 One Off
vweosclub.com vweosclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
walkingstickforum.com walkingstickforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
weselleldorado.com weselleldorado.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
SONO SONO-783272317B Sep 2019 Nov 2019 65 days
AOL AOL-49648 Oct 2019 Nov 2019 35 days
wristtwisters.com wristtwisters.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xcyl88888.cc xcyl88888.cc
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yamahastarstryker.com yamahastarstryker.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
carolinashootersclub.com carolinashootersclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
zhujiangfz.com zhujiangfz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hellooaklandpark.com hellooaklandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
commanderforums.org commanderforums.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dairygoatinfo.com dairygoatinfo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 131 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dfwstangs.net dfwstangs.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
divyabhaskar.co.in divyabhaskar.co.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
FWHL FWHL-762737 Jan 2020 Mar 2020 58 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
familyevents.com familyevents.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
DM DM-100974 Sep 2019 Nov 2019 65 days
dognameswoof.com dognameswoof.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
dornob.com dornob.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
duramaxforum.com duramaxforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
dwmhoa.com dwmhoa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 183 days
AOL AOL-6748 May 2019 Aug 2019 92 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
elcaminocentral.com elcaminocentral.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
escape-city.com escape-city.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
fanbuzz.com fanbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Mar 2020 165 days
AOL AOL-49648 Dec 2019 Feb 2020 67 days
DM DM-100974 Oct 2019 Oct 2019 One Off
fifthdomain.com fifthdomain.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 287 days
AOL AOL-49648 Oct 2019 Dec 2019 59 days
ORC ORC-402 May 2019 May 2019 One Off
focusfanatics.com focusfanatics.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
followfollow.com followfollow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
DM DM-100974 Sep 2019 Sep 2019 One Off
fseriesfanatics.com fseriesfanatics.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Feb 2020 66 days
DM DM-100974 Dec 2019 Feb 2020 66 days
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
givemesport.com givemesport.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
gofugyourself.com gofugyourself.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
helloaguascalientes.com helloaguascalientes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloalamogordo.com helloalamogordo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloalmadabad.com helloalmadabad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloamarillo.com helloamarillo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloanyang.com helloanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloasmara.com helloasmara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloasuncion.com helloasuncion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobandarlampung.com hellobandarlampung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellobangdung.com hellobangdung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobelize.com hellobelize.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellobismarck.com hellobismarck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobowie.com hellobowie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocaloocan.com hellocaloocan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellochamplin.com hellochamplin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellochangde.com hellochangde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellochillicothe.com hellochillicothe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloclarington.com helloclarington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellococoabeach.com hellococoabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodaniabeach.com hellodaniabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodatong.com hellodatong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodel.com hellodel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloeastbethel.com helloeastbethel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloeldorado.com helloeldorado.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloellensburg.com helloellensburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloelpaso.com helloelpaso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloencinitas.com helloencinitas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofarmersbranch.com hellofarmersbranch.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellofes.com hellofes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogalati.com hellogalati.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloglendale.com helloglendale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellogoiania.com hellogoiania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogoyang.com hellogoyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogretna.com hellogretna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloguadalajara.com helloguadalajara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloguangyuan.com helloguangyuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloguatemalacity.com helloguatemalacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloguiping.com helloguiping.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaiphong.com hellohaiphong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellohandan.com hellohandan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohannibal.com hellohannibal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohaora.com hellohaora.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohelena.com hellohelena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohengyang.com hellohengyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloherriman.com helloherriman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohuntingtonbeach.com hellohuntingtonbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloibadan.com helloibadan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Jun 2020 Jan 2021 220 days
helloindianola.com helloindianola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellojalgaon.com hellojalgaon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellojianyang.com hellojianyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojining.com hellojining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokhulna.com hellokhulna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokumasi.com hellokumasi.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloliege.com helloliege.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
GTM GTM-UA-118129358-1 Oct 2020 Mar 2021 154 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolincolnpark.com hellolincolnpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloliuyang.com helloliuyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolivonia.com hellolivonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellolongbeach.com hellolongbeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloluoyang.com helloluoyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomapleridge.com hellomapleridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Sep 2020 Apr 2021 189 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomcallen.com hellomcallen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomessina.com hellomessina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomianyang.com hellomianyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellominnetonka.com hellominnetonka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomontreal.com hellomontreal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonanan.com hellonanan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonanyang.com hellonanyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonewwestminster.com hellonewwestminster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonizhnynovgorod.com hellonizhnynovgorod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonorthdakota.com hellonorthdakota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonorthsaltlake.com hellonorthsaltlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloonalaska.com helloonalaska.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloorlando.com helloorlando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloostrava.com helloostrava.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloouterbanks.com helloouterbanks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopalmdesert.com hellopalmdesert.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloperrysburg.com helloperrysburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopetaluma.com hellopetaluma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloplano.com helloplano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopoway.com hellopoway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopoznan.com hellopoznan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopyongyang.com hellopyongyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloqianjiang.com helloqianjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloranchocucamonga.com helloranchocucamonga.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloreims.com helloreims.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellorennes.com hellorennes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloryazan.com helloryazan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosaintetienne.com hellosaintetienne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosamara.com hellosamara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosanfernando.com hellosanfernando.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosangabriel.com hellosangabriel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanjuancapistrano.com hellosanjuancapistrano.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanmarcos.com hellosanmarcos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosantaclarita.com hellosantaclarita.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosantafe.com hellosantafe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosantarosa.com hellosantarosa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosartell.com hellosartell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jul 2020 Jul 2020 One Off
hellosedalia.com hellosedalia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloshymkent.com helloshymkent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloslidell.com helloslidell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jul 2020 Jul 2020 One Off
hellosouthdakota.com hellosouthdakota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellospanishfork.com hellospanishfork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellospringhill.com hellospringhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jul 2020 Aug 2020 29 days
hellostuttgart.com hellostuttgart.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellosuining.com hellosuining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotaishan.com hellotaishan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotemecula.com hellotemecula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloteresina.com helloteresina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotianmen.com hellotianmen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotopeka.com hellotopeka.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellotshwane.com hellotshwane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotyumen.com hellotyumen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellounionca.com hellounionca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellovirginiausa.com hellovirginiausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloweifang.com helloweifang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowhitefishbay.com hellowhitefishbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowilmette.com hellowilmette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowroclaw.com hellowroclaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloxining.com helloxining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloyuba.com helloyuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellozhanjiang.com hellozhanjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
homerefurbers.com homerefurbers.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hystersisters.com hystersisters.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
inhabitat.com inhabitat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
jeepforum.com jeepforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
justlabradors.com justlabradors.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
kawasakiworld.com kawasakiworld.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
keguyyyc.com keguyyyc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kongjie91.com kongjie91.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
list25.com list25.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
livescience.com livescience.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
luusports.com luusports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 71 days
AOL AOL-6748 Jun 2019 Jun 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
mapsofworld.com mapsofworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
PUBM PUBM-158017 Aug 2019 Nov 2019 100 days
mate1314.com mate1314.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mautofied.com mautofied.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
metalinjection.net metalinjection.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
molson4on4.com molson4on4.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Dec 2019 65 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
myturbodiesel.com myturbodiesel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nopzc.cn nopzc.cn
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
odyclub.com odyclub.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
odysseyownersclub.com odysseyownersclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
opwhl.com opwhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 307 days
FWHL FWHL-762737 Aug 2019 Dec 2019 143 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
overclock.net overclock.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
reelfishingchat.com reelfishingchat.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
paypath.com paypath.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
NEX NEX-3391 May 2019 May 2019 One Off
peifootball.ca peifootball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Feb 2020 183 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
perfectunion.com perfectunion.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
piloteers.org piloteers.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
pistolsmith.com pistolsmith.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
pointstreak.com pointstreak.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Mar 2020 189 days
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
portageminorhockey.com portageminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 200 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
purewow.com purewow.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Mar 2020 78 days
DM DM-100974 Jan 2020 Feb 2020 43 days
AOL AOL-49648 Jan 2020 Feb 2020 43 days
qinuo8.com qinuo8.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
qiyuanfenpeiqi.net qiyuanfenpeiqi.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
rabbitdogs.net rabbitdogs.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 270 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
hellorome.com hellorome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloseymour.com helloseymour.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolaporte.com hellolaporte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
rugbydump.com rugbydump.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 169 days
SONO SONO-783272317B Aug 2019 Jan 2020 129 days
AOL AOL-49648 Oct 2019 Nov 2019 23 days
rwbhc.co.uk rwbhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
sailingworld.com sailingworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
DM DM-100974 Sep 2019 Sep 2019 One Off
saskballhockey.com saskballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 140 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
agdaily.com agdaily.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 150 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Sep 2019 Nov 2019 65 days
airlinepilotcentral.com airlinepilotcentral.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
sgmj8.com sgmj8.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
shengxinjzjx.net shengxinjzjx.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
alfabb.com alfabb.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
snowplowforums.com snowplowforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
space.com space.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
splitcoaststampers.com splitcoaststampers.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
12up.com 12up.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
taiwanmianmo.com taiwanmianmo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tends0769.com tends0769.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thektog.org thektog.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
DM DM-100974 Sep 2019 Feb 2020 154 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
theodysseyonline.com theodysseyonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
tkunderground.com tkunderground.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tomsguide.com tomsguide.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
bdltbxf.com bdltbxf.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Nov 2019 47 days
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
tractorforum.com tractorforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
trailvoy.com trailvoy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
trapshooters.com trapshooters.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
beesource.com beesource.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
triumph675.net triumph675.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
benelliforum.com benelliforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tsczs.cn tsczs.cn
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ttora.com ttora.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tvbeurope.com tvbeurope.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 183 days
DM DM-100974 Jul 2019 Nov 2019 118 days
AOL AOL-49648 Oct 2019 Nov 2019 31 days
tzmenboke.com tzmenboke.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hellochowchilla.com hellochowchilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellooceansprings.com hellooceansprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
vms4030.com vms4030.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bobshideout.com bobshideout.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 314 days
FWHL FWHL-762737 Sep 2019 Mar 2020 179 days
FWHL FWHL-762769 May 2019 May 2019 One Off
walterfootball.com walterfootball.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Jan 2020 165 days
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
wciu.com wciu.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
weddingbee.com weddingbee.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
broadwayworld.com broadwayworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
whshl.com whshl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 295 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
wideopeneats.com wideopeneats.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 193 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Nov 2019 Nov 2019 One Off
woodworkingtalk.com woodworkingtalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
burgmanusa.com burgmanusa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
hellowindsor.com hellowindsor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
wrxforums.com wrxforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xdtalk.com xdtalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
celebsugar.com celebsugar.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Nov 2019 210 days
AOL AOL-49648 Oct 2019 Nov 2019 51 days
ORC ORC-402 May 2019 May 2019 One Off
compacttractorreview.com compacttractorreview.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
customtacos.com customtacos.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
diabetesforum.com diabetesforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
digitalcameraworld.com digitalcameraworld.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
diyphotography.net diyphotography.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Sep 2019 104 days
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
femalefirst.co.uk femalefirst.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 154 days
SONO SONO-783272317B Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
figures.com figures.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
fishstock.com fishstock.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Nov 2019 169 days
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
fordmuscleforums.com fordmuscleforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fordstnation.com fordstnation.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
hellojohnsoncity.com hellojohnsoncity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hauntforum.com hauntforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
helloacapulco.com helloacapulco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloacworth.com helloacworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloalgonquin.com helloalgonquin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloallenpark.com helloallenpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloaltus.com helloaltus.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloamorgos.com helloamorgos.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloathens.com helloathens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloatlanticcity.com helloatlanticcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloavondale.com helloavondale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 3 days
hellobali.com hellobali.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobelgorod.com hellobelgorod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloblacksburg.com helloblacksburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobremen.com hellobremen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobrigham.com hellobrigham.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobrookpark.com hellobrookpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobuenosaires.com hellobuenosaires.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellocarmel.com hellocarmel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocasselberry.com hellocasselberry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocaymanislands.com hellocaymanislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellochapelhill.com hellochapelhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jul 2020 Aug 2020 27 days
hellocharlottesville.com hellocharlottesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocloquet.com hellocloquet.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocolombia.com hellocolombia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocoralsprings.com hellocoralsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodanbury.com hellodanbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodearbornheights.com hellodearbornheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloeastpeoria.com helloeastpeoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloedinburgh.com helloedinburgh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloelmonte.com helloelmonte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloescondido.com helloescondido.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloeuless.com helloeuless.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofairbanks.com hellofairbanks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofalklandislands.com hellofalklandislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloglasgow.com helloglasgow.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellogongzhuling.com hellogongzhuling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellograndforks.com hellograndforks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogreatbritain.com hellogreatbritain.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloguigang.com helloguigang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohagen.com hellohagen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohamtramck.com hellohamtramck.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellohanahan.com hellohanahan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2020 Aug 2020 60 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohartford.com hellohartford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohechuan.com hellohechuan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohims.com hellohims.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jan 2022 187 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohornlake.com hellohornlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohuainan.com hellohuainan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojacksonvillebeach.com hellojacksonvillebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellojamaica.com hellojamaica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellojinjiang.com hellojinjiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojodhpur.com hellojodhpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokaohsiung.com hellokaohsiung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokelso.com hellokelso.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloketchikan.com helloketchikan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jun 2020 Jun 2020 One Off
helloknoxville.com helloknoxville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolagrande.com hellolagrande.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloleesburg.com helloleesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloleicester.com helloleicester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolittlerock.com hellolittlerock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloliverpool.com helloliverpool.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellologansport.com hellologansport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloloslunas.com helloloslunas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolublin.com hellolublin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloludhiana.com helloludhiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomariupol.com hellomariupol.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomeriden.com hellomeriden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomichigan.com hellomichigan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomombasa.com hellomombasa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomoncton.com hellomoncton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomonrovia.com hellomonrovia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellomontereypark.com hellomontereypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomonterrey.com hellomonterrey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomysore.com hellomysore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonaypyidaw.com hellonaypyidaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloneijiang.com helloneijiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonewbedford.com hellonewbedford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonewnan.com hellonewnan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellonewportrichey.com hellonewportrichey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellonorthlittlerock.com hellonorthlittlerock.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloocala.com helloocala.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellooxnard.com hellooxnard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopadova.com hellopadova.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellopalmbay.com hellopalmbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopeabody.com hellopeabody.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloplymouth.com helloplymouth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopristina.com hellopristina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloredwood.com helloredwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellorexburg.com hellorexburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorichmondhill.com hellorichmondhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Jul 2020 Apr 2021 268 days
GTM GTM-UA-118129358-1 Jul 2020 Jan 2021 188 days
helloriverbank.com helloriverbank.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosaintcloud.com hellosaintcloud.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Mar 2020 Mar 2020 One Off
GTM GTM-UA-121239807-2 Mar 2020 Mar 2020 One Off
hellosaintthomas.com hellosaintthomas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellosamarkand.com hellosamarkand.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosandwell.com hellosandwell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosapporo.com hellosapporo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloselma.com helloselma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloshreveport.com helloshreveport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosolapur.com hellosolapur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosrinagar.com hellosrinagar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellostamford.com hellostamford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellostatecollege.com hellostatecollege.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosudan.com hellosudan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotaichung.com hellotaichung.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotalladega.com hellotalladega.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotampa.com hellotampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotangier.com hellotangier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotennessee.com hellotennessee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellothane.com hellothane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellotijuana.com hellotijuana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotirana.com hellotirana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotorreon.com hellotorreon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotroisrivieres.com hellotroisrivieres.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Jul 2022 315 days
GTM GTM-UA-118129358-1 Sep 2020 Apr 2021 189 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloulsan.com helloulsan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellouniversitypark.com hellouniversitypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellovegas.com hellovegas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellovienna.com hellovienna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowadsworth.com hellowadsworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellowakeforest.com hellowakeforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowesthaven.com hellowesthaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowestpoint.com hellowestpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowuppertal.com hellowuppertal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloxingyang.com helloxingyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloyaounde.com helloyaounde.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloyerevan.com helloyerevan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloyiyang.com helloyiyang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloyonkers.com helloyonkers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jun 2020 Jun 2020 One Off
hellozaria.com hellozaria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hipointfirearmsforums.com hipointfirearmsforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
homebrewtalk.com homebrewtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jan 2020 Feb 2020 24 days
huntingpa.com huntingpa.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
impalaforums.com impalaforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jagranjosh.com jagranjosh.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 159 days
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 62 days
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
kimbertalk.com kimbertalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
knowyourmeme.com knowyourmeme.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
lfhyhg.net lfhyhg.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
livestrong.com livestrong.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
mannshouji.com mannshouji.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mazda6club.com mazda6club.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
michigan-sportsman.com michigan-sportsman.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
motorcyclecruiser.com motorcyclecruiser.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
motorcycleforums.net motorcycleforums.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
motorcyclistonline.com motorcyclistonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
DM DM-100974 Sep 2019 Sep 2019 One Off
mountainbuzz.com mountainbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ndusc.ca ndusc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Feb 2020 282 days
FWHL FWHL-762737 Aug 2019 Aug 2019 13 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
nissanversaforums.com nissanversaforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
nsfoa.ca nsfoa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Feb 2020 236 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
outdoorlife.com outdoorlife.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
personalwatercraft.com personalwatercraft.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
petguide.com petguide.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
planetisuzoo.com planetisuzoo.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
pnwriders.com pnwriders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Feb 2020 282 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Aug 2019 Aug 2019 One Off
politifact.com politifact.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 279 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
poynter.org poynter.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
renaultcapturforum.com renaultcapturforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
aberdeenminorhockey.ca aberdeenminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 242 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
hellodover.com hellodover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
roughmaps.com roughmaps.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 268 days
SONO SONO-783272317B Jul 2019 Nov 2019 115 days
AOL AOL-49648 Oct 2019 Jan 2020 88 days
helloburlingame.com helloburlingame.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
rslgha.ca rslgha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
hellodeserthotsprings.com hellodeserthotsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
rvitch.com rvitch.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
scarymommy.com scarymommy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
airlinepilotforums.com airlinepilotforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
sfmha.ca sfmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Feb 2020 234 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
altimaforums.net altimaforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
shjianzi.com shjianzi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
silveradosierra.com silveradosierra.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
skincaretalk.com skincaretalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
skyscrapercity.com skyscrapercity.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
sljzmf.com sljzmf.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
smallbizdaily.com smallbizdaily.com
Attribute Value First Detected Last Detected Overlap Duration
CONN CONN-102738 Sep 2019 Sep 2019 One Off
TELA TELA-457 Sep 2019 Sep 2019 One Off
PRIM PRIM-19139 Sep 2019 Sep 2019 One Off
smokinvette.com smokinvette.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
spaceanswers.com spaceanswers.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
SONO SONO-783272317B Sep 2019 Mar 2020 175 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
sportskeeda.com sportskeeda.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
stevesnovasite.com stevesnovasite.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
stthomasringette.ca stthomasringette.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
svconline.com svconline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 186 days
DM DM-100974 Jul 2019 Jul 2019 One Off
AOL AOL-49648 Jan 2020 Jan 2020 One Off
szokco.cc szokco.cc
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
talkaboutmarriage.com talkaboutmarriage.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
arizonagunowners.com arizonagunowners.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
arkansashunting.net arkansashunting.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
terrificpets.com terrificpets.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
auto123.com auto123.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
thevog.net thevog.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
bagshotcc.co.uk bagshotcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 84 days
ORC ORC-402 May 2019 May 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
titantalk.com titantalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
txlhhk.com txlhhk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
uppercanadacyclones.com uppercanadacyclones.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 158 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Jan 2020 Jan 2020 One Off
urbo.com urbo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 17 days
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
uvskm.cn uvskm.cn
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
veloster.org veloster.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
waltherforums.com waltherforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
brainjet.com brainjet.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wideopenspaces.com wideopenspaces.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 128 days
AOL AOL-49648 Jan 2020 Feb 2020 28 days
DM DM-100974 Jan 2020 Feb 2020 28 days
wrestlinginc.com wrestlinginc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jan 2020 186 days
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
yojoe.com yojoe.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
zgyijiaosuo.com zgyijiaosuo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
helloforestpark.com helloforestpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomedina.com hellomedina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
chins-n-hedgies.com chins-n-hedgies.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 124 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
DM DM-100974 Nov 2019 Feb 2020 89 days
chryslerminivan.net chryslerminivan.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
civinfo.com civinfo.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clipd.com clipd.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
creativebloq.com creativebloq.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
csmba.ca csmba.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Mar 2020 276 days
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
diychatroom.com diychatroom.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dronedj.com dronedj.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 91 days
SONO SONO-783272317B May 2019 Aug 2019 91 days
ORC ORC-402 May 2019 May 2019 One Off
ealingcc.co.uk ealingcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 50 days
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
SONO SONO-783272317B May 2019 Jun 2019 42 days
ehow.co.uk ehow.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 45 days
ehpenguins.org ehpenguins.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
fancymicebreeders.com fancymicebreeders.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
firearmstalk.com firearmstalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
hellomidland.com hellomidland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
fnforum.net fnforum.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gamingsym.com gamingsym.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 122 days
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
glockforum.com glockforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 293 days
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
handgunsandammunition.com handgunsandammunition.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
helloeastlake.com helloeastlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloalameda.com helloalameda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloandover.com helloandover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloanegada.com helloanegada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloanshan.com helloanshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloarizona.com helloarizona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloastrakhan.com helloastrakhan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloaventura.com helloaventura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellobazhong.com hellobazhong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobeaumont.com hellobeaumont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobellaire.com hellobellaire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobelmopan.com hellobelmopan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellobolton.com hellobolton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellobrazzaville.com hellobrazzaville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118129358 Apr 2022 Jul 2022 90 days
hellobrighton.com hellobrighton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Jan 2021 Jan 2021 One Off
hellobuffalo.com hellobuffalo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellobulawayo.com hellobulawayo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellocairns.com hellocairns.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Sep 2020 Jan 2021 109 days
hellocedarcity.com hellocedarcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellocedarpark.com hellocedarpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellochampaign.com hellochampaign.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloclemson.com helloclemson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellocolumbiaheights.com hellocolumbiaheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodebrecen.com hellodebrecen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodesoto.com hellodesoto.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodestin.com hellodestin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodnipro.com hellodnipro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodominicanrepublic.com hellodominicanrepublic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellodoncaster.com hellodoncaster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellodouglas.com hellodouglas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellodrummondville.com hellodrummondville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 May 2022 335 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloduncan.com helloduncan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2020 Aug 2020 59 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodunlaoghaire.com hellodunlaoghaire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloelgin.com helloelgin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloerie.com helloerie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloerlanger.com helloerlanger.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloessen.com helloessen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellofortmyers.com hellofortmyers.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Jun 2020 Aug 2020 59 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellofortworth.com hellofortworth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellofrankfort.com hellofrankfort.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogaithersburg.com hellogaithersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogarfieldheights.com hellogarfieldheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellogdynia.com hellogdynia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogelsenkirchen.com hellogelsenkirchen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogijon.com hellogijon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellogreenwich.com hellogreenwich.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellogriffin.com hellogriffin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellohaicheng.com hellohaicheng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohaimen.com hellohaimen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellohamilton.com hellohamilton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohongkong.com hellohongkong.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellohopewell.com hellohopewell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Jul 2020 Jul 2020 One Off
hellohouston.com hellohouston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohurricane.com hellohurricane.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellojabalpur.com hellojabalpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojacksonhole.com hellojacksonhole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellojamshedpur.com hellojamshedpur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellojoplin.com hellojoplin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellojuba.com hellojuba.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellokaifeng.com hellokaifeng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Mar 2021 155 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellokawarthalakes.com hellokawarthalakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellokazan.com hellokazan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokingston.com hellokingston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokitchener.com hellokitchener.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokurgan.com hellokurgan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellokuwaitcity.com hellokuwaitcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellolagunabeach.com hellolagunabeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolahore.com hellolahore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolakeforest.com hellolakeforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolaquinta.com hellolaquinta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellolawrence.com hellolawrence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellolebanon.com hellolebanon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellolufeng.com hellolufeng.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomesa.com hellomesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomexicocity.com hellomexicocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellomilpitas.com hellomilpitas.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellomilwaukie.com hellomilwaukie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellominnesota.com hellominnesota.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomosspoint.com hellomosspoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellomultan.com hellomultan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellomuncie.com hellomuncie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomurrieta.com hellomurrieta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonampa.com hellonampa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonaucalpan.com hellonaucalpan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellonevada.com hellonevada.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellonewhope.com hellonewhope.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellonicosia.com hellonicosia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Nov 2020 29 days
hellonorway.com hellonorway.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloohio.com helloohio.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellooran.com hellooran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopapuanewguinea.com hellopapuanewguinea.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloparkforest.com helloparkforest.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloparma.com helloparma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellopassaic.com hellopassaic.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellopflugerville.com hellopflugerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopingdingshan.com hellopingdingshan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Jul 2022 1 year, 3 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloprichard.com helloprichard.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
helloprincegeorge.com helloprincegeorge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloquezoncity.com helloquezoncity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloradford.com helloradford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorichfield.com hellorichfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellorockford.com hellorockford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosaintjerome.com hellosaintjerome.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 May 2022 261 days
GTM GTM-UA-118129358-1 Sep 2020 Apr 2021 189 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosalvador.com hellosalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Nov 2020 2 years, 49 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellosaultstemarie.com hellosaultstemarie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellosereisaophoan.com hellosereisaophoan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
helloshijiazhuang.com helloshijiazhuang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Apr 2021 182 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
hellostafford.com hellostafford.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellostcatharines.com hellostcatharines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Sep 2021 Sep 2022 357 days
GTM GTM-UA-118129358-1 Oct 2020 Apr 2021 182 days
UA UA-118163407 Jan 2021 Apr 2021 80 days
hellosydney.com hellosydney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
helloszczecin.com helloszczecin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotallahassee.com hellotallahassee.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellotashkent.com hellotashkent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Nov 2020 Jan 2021 73 days
hellotempe.com hellotempe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellothehague.com hellothehague.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellotrieste.com hellotrieste.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotunis.com hellotunis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellotwentyninepalms.com hellotwentyninepalms.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellovadodara.com hellovadodara.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellovancouver.com hellovancouver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Jul 2022 1 year, 24 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellovictoria.com hellovictoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowafangdian.com hellowafangdian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowauwatosa.com hellowauwatosa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
CA CA-PUB-9695858187321950 Sep 2018 Sep 2018 One Off
hellowellington.com hellowellington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellowujiang.com hellowujiang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hellozaporizhia.com hellozaporizhia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
GTM GTM-UA-118129358-1 Oct 2020 Jan 2021 102 days
hockeybuzz.com hockeybuzz.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Mar 2020 321 days
DM DM-100974 Jun 2019 Feb 2020 238 days
AOL AOL-49648 Oct 2019 Feb 2020 127 days
impalassforum.com impalassforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
inspiremore.com inspiremore.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jan 2020 186 days
SONO SONO-783272317B Jul 2019 Jan 2020 186 days
AOL AOL-49648 Oct 2019 Jan 2020 105 days
jeeptrackhawk.org jeeptrackhawk.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jrvikingssoftball.com jrvikingssoftball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Jun 2019 47 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
kemptvillehockey.com kemptvillehockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Mar 2020 218 days
FWHL FWHL-762737 Oct 2019 Mar 2020 157 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
kia-forums.com kia-forums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ktmatvhq.com ktmatvhq.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
lyhongshengfhb.com lyhongshengfhb.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
makingstarwars.net makingstarwars.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Mar 2020 278 days
DM DM-100974 Jun 2019 Sep 2019 103 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mapsofindia.com mapsofindia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
miramichiunited.ca miramichiunited.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
moddedraptor.com moddedraptor.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
modernmuzzleloader.com modernmuzzleloader.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
SONO SONO-783272317B Sep 2019 Nov 2019 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
moviestvnetwork.com moviestvnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 110 days
DM DM-100974 Nov 2019 Feb 2020 89 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
musicradar.com musicradar.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Nov 2019 Feb 2020 89 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
myfastgti.com myfastgti.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
nafe.com nafe.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 161 days
FWHL FWHL-762737 Aug 2019 Oct 2019 75 days
AOL AOL-49648 Oct 2019 Oct 2019 One Off
newcelica.org newcelica.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nhra.com nhra.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
ohiogamefishing.com ohiogamefishing.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
SONO SONO-783272317B Nov 2019 Mar 2020 110 days
pavementsucks.com pavementsucks.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jan 2020 227 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jul 2019 Oct 2019 115 days
pkzcitl.com pkzcitl.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
planetminis.com planetminis.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
popphoto.com popphoto.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
preparedsociety.com preparedsociety.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jan 2020 234 days
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
prepperforums.net prepperforums.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
qihesk.net qihesk.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
rav4world.com rav4world.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rec-image.com rec-image.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
retrogamer.net retrogamer.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Jan 2020 131 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
DM DM-100974 Nov 2019 Nov 2019 One Off
rhinoforums.net rhinoforums.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ripbladehockeyeast.com ripbladehockeyeast.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Feb 2020 118 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
rmfhs.ca rmfhs.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 23 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
actoniansrfc.com actoniansrfc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
rugbyonslaught.com rugbyonslaught.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Mar 2020 75 days
DM DM-100974 Jan 2020 Feb 2020 40 days
hellografton.com hellografton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
accordxclub.com accordxclub.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
saab92x.com saab92x.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
saamtv.com saamtv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 75 days
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
santafeforums.com santafeforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
savedbygraceblog.com savedbygraceblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Jan 2020 129 days
AOL AOL-49648 Oct 2019 Jan 2020 89 days
science101.com science101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 63 days
NEX NEX-3391 Jul 2019 Aug 2019 31 days
sciencealert.com sciencealert.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
sciencetimes.com sciencetimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 55 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
sdfpl.co.uk sdfpl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
ardsrugby.co.uk ardsrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B May 2019 Jun 2019 34 days
secondnexus.com secondnexus.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
semidomesticatedmama.com semidomesticatedmama.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
hellopoquoson.com hellopoquoson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
shaalaa.com shaalaa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 129 days
MEDI MEDI-8CUZ310G2 Sep 2019 Jan 2020 129 days
allfreecrochetafghanpatterns.com allfreecrochetafghanpatterns.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
allfreeholidaycrafts.com allfreeholidaycrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
showt.com showt.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 229 days
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
siennachat.com siennachat.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
amusingmaralee.com amusingmaralee.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 65 days
DM DM-100974 Nov 2019 Jan 2020 65 days
armchairgeneral.com armchairgeneral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
amberdowns.net amberdowns.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Nov 2019 Jan 2020 66 days
skmov.com skmov.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Jan 2020 130 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
slatedroid.com slatedroid.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
anfieldindex.com anfieldindex.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
animalchannel.co animalchannel.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jun 2019 One Off
angsarap.net angsarap.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
sonisfood.com sonisfood.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
southbaystorm.com southbaystorm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
sport.co.uk sport.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jan 2020 186 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
sportbikes.com sportbikes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
spyderchat.com spyderchat.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
srsoccerleague.ca srsoccerleague.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 87 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
stdrivers.co.uk stdrivers.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
stealherstyle.net stealherstyle.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
stemha.ca stemha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
abaceltics.ca abaceltics.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Jul 2019 Jul 2019 One Off
superflysupermom.com superflysupermom.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 66 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
survivinginfidelity.com survivinginfidelity.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
swanseacity-mad.co.uk swanseacity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Sep 2019 Nov 2019 63 days
suzuki-forums.com suzuki-forums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
suzuki-forums.net suzuki-forums.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
anganwadirecruitment.in anganwadirecruitment.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 240 days
FWHL FWHL-762737 Aug 2019 Mar 2020 213 days
ask.fm ask.fm
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
tatertotsandjello.com tatertotsandjello.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
atlasetut.com atlasetut.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
atraccion360.com atraccion360.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 214 days
FWHL FWHL-762769 May 2019 May 2019 One Off
atv.com atv.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
teryxforums.net teryxforums.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
thaivisa.com thaivisa.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
thecraftyquilter.com thecraftyquilter.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
theglhl.com theglhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 155 days
AOL AOL-6748 May 2019 May 2019 One Off
azbasszone.com azbasszone.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
azchords.com azchords.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
theedd.ca theedd.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 232 days
FWHL FWHL-762737 Aug 2019 Mar 2020 205 days
theeggfarm.com theeggfarm.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
thegalaxytabforum.com thegalaxytabforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bachpan.com bachpan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 181 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
themobileindian.com themobileindian.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
thongsbridgecricketclub.co.uk thongsbridgecricketclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
threebridgesfc.co.uk threebridgesfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
tollypics.com tollypics.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 206 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
topsecretrecipes.com topsecretrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 89 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
toyotacelicas.com toyotacelicas.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
twinfinite.net twinfinite.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
twistynoodle.com twistynoodle.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
tysa.ca tysa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
udahl.com udahl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 206 days
AOL AOL-6748 Mar 2020 Mar 2020 One Off
ukulele-chords.com ukulele-chords.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 196 days
NEX NEX-3391 May 2019 Aug 2019 73 days
ultimateaircooled.com ultimateaircooled.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
updatepedia.com updatepedia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 131 days
FWHL FWHL-762737 Jan 2020 Mar 2020 48 days
bitjunkey.com bitjunkey.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 106 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
veblr.com veblr.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
veranotalk.com veranotalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vikingforum.org vikingforum.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vseries.net vseries.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
boilingwithbias.com boilingwithbias.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 110 days
FWHL FWHL-762769 May 2019 May 2019 One Off
vtxoa.com vtxoa.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gunboards.com gunboards.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wanderlustandwellness.org wanderlustandwellness.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
boredomtherapy.com boredomtherapy.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
wcoanimedub.tv wcoanimedub.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 194 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
wcoanimesub.tv wcoanimesub.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 178 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
wcoastswing.com wcoastswing.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
boxer-dog.org boxer-dog.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wellreadreviews.com wellreadreviews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
brigeeski.com brigeeski.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
browardpalmbeach.com browardpalmbeach.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 121 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
buggynews.com buggynews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wrcsoccer.com wrcsoccer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 176 days
AOL AOL-6748 Nov 2019 Mar 2020 111 days
writergirlm.com writergirlm.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 101 days
wrxtuners.com wrxtuners.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
buzztl.com buzztl.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 105 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
byfa.ca byfa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
cafecrime.com cafecrime.com
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 May 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
calbassin.com calbassin.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
caliberforumz.com caliberforumz.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ymcahc.ie ymcahc.ie
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
yoursciontc.com yoursciontc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cbr.com cbr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
cbr250.com cbr250.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
cbr300forum.com cbr300forum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
ccjhl.net ccjhl.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 315 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ccmb.co.uk ccmb.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 249 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
chinese-tools.com chinese-tools.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
coloradofisherman.com coloradofisherman.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
consequenceofsound.net consequenceofsound.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jan 2020 186 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
contractortalk.com contractortalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
cookingactress.com cookingactress.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 154 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
cookingalamel.com cookingalamel.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
cowboylyrics.com cowboylyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
crazy-wonderful.com crazy-wonderful.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Feb 2020 67 days
DM DM-100974 Dec 2019 Feb 2020 67 days
creativeincomeblog.com creativeincomeblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
crownvic.net crownvic.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
customercarecontacts.com customercarecontacts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
cyanogenmods.org cyanogenmods.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 6 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
cyclevolta.com cyclevolta.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 108 days
DM DM-100974 Aug 2019 Aug 2019 One Off
dailydream360.com dailydream360.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 131 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
dashofdee.com dashofdee.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 131 days
AOL AOL-49648 Dec 2019 Feb 2020 67 days
davesgarden.com davesgarden.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
decaregina.ca decaregina.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
deepika.com deepika.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
devilshockey.org devilshockey.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Feb 2020 280 days
FWHL FWHL-762737 Aug 2019 Dec 2019 115 days
dieselramforum.com dieselramforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ditchthewheat.com ditchthewheat.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
dlmha.ca dlmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
drivemag.com drivemag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
dynamitenews.com dynamitenews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 167 days
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
eastfife-mad.co.uk eastfife-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 195 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
ebook3000.biz ebook3000.biz
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Feb 2020 131 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
eldiariony.com eldiariony.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
DM DM-100974 Sep 2019 Sep 2019 One Off
ellenstumbo.com ellenstumbo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
AOL AOL-49648 Dec 2019 Feb 2020 67 days
empireofthekop.com empireofthekop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
FWHL FWHL-762769 May 2019 May 2019 One Off
enjoyingthesimplethings.com enjoyingthesimplethings.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
AOL AOL-49648 Oct 2019 Dec 2019 57 days
esakal.com esakal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Feb 2020 67 days
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
explorertalk.com explorertalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ezwatercalculator.com ezwatercalculator.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Mar 2020 228 days
DM DM-100974 Aug 2019 Feb 2020 193 days
fashionbeans.com fashionbeans.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Jul 2019 One Off
fashionstylefoodie.com fashionstylefoodie.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
federaltimes.com federaltimes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Sep 2019 104 days
hellonorthadams.com hellonorthadams.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
flyingmag.com flyingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jul 2019 Jul 2019 One Off
footballtransfertavern.com footballtransfertavern.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
fordfusionclub.com fordfusionclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fortheloveofcooking.net fortheloveofcooking.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
francetabs.com francetabs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 187 days
NEX NEX-3391 Jun 2019 Aug 2019 50 days
fresh2refresh.com fresh2refresh.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 110 days
futbolmundial.com futbolmundial.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 102 days
FWHL FWHL-762769 May 2019 May 2019 One Off
ganderminorhockey.ca ganderminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
gbcmag.com gbcmag.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Oct 2019 Feb 2020 127 days
gcmha.com gcmha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Mar 2020 225 days
FWHL FWHL-762737 Aug 2019 Mar 2020 223 days
gearbrain.com gearbrain.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 96 days
SONO SONO-783272317B May 2019 Aug 2019 96 days
georgetakei.com georgetakei.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
DM DM-100974 Sep 2019 Sep 2019 One Off
gfmha.ca gfmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Dec 2019 221 days
FWHL FWHL-762737 Aug 2019 Oct 2019 58 days
ggpan.com ggpan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 223 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
ghibliforum.com ghibliforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hellodesplaines.com hellodesplaines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellojackson.com hellojackson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
ginadwagner.com ginadwagner.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
glock.pro glock.pro
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
golf.co.uk golf.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 239 days
AOL AOL-49648 Oct 2019 Feb 2020 127 days
gomantaktimes.com gomantaktimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Dec 2019 64 days
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
govtyojanas.com govtyojanas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
grizzlycentral.com grizzlycentral.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
gtaall.net gtaall.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
gtavicecity.ru gtavicecity.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hackr.io hackr.io
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 35 days
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
headstory.com headstory.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 64 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
helloanguilla.com helloanguilla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloannapolis.com helloannapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobakersfield.com hellobakersfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobalchsprings.com hellobalchsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobaltimore.com hellobaltimore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobeaverton.com hellobeaverton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobloomingdale.com hellobloomingdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloboulder.com helloboulder.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobridgeport.com hellobridgeport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobrownsburg.com hellobrownsburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocalifornia.com hellocalifornia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocapecoral.com hellocapecoral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocedarburg.com hellocedarburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocharlotte.com hellocharlotte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellochesapeake.com hellochesapeake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocleveland.com hellocleveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocollinsville.com hellocollinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloconcord.com helloconcord.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodarien.com hellodarien.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodecatural.com hellodecatural.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodeerpark.com hellodeerpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodelmar.com hellodelmar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodepere.com hellodepere.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloeagan.com helloeagan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloelcentro.com helloelcentro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloforestgrove.com helloforestgrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellofremont.com hellofremont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellofullerton.com hellofullerton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogardner.com hellogardner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogatlinburg.com hellogatlinburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogerman.com hellogerman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jun 2020 1 year, 267 days
GTM GTM-UA-118129358-1 Jun 2020 Jun 2020 One Off
hellograndisland.com hellograndisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellograndrapids.com hellograndrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogranite.com hellogranite.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloharlingen.com helloharlingen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohempsteadvillage.com hellohempsteadvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohollysprings.com hellohollysprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohuntingtonpark.com hellohuntingtonpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloidahofalls.com helloidahofalls.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloillinois.com helloillinois.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolakecharles.com hellolakecharles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolaredo.com hellolaredo.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolauderhill.com hellolauderhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolexington.com hellolexington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolinolakes.com hellolinolakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomadison.com hellomadison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomaine.com hellomaine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomarana.com hellomarana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomargate.com hellomargate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomaryland.com hellomaryland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomcalester.com hellomcalester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomemphis.com hellomemphis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomorenovalley.com hellomorenovalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomountpleasant.com hellomountpleasant.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonashville.com hellonashville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonewhampshire.com hellonewhampshire.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonewmexico.com hellonewmexico.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonorthport.com hellonorthport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooakland.com hellooakland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooceancity.com hellooceancity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloolathe.com helloolathe.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopendleton.com hellopendleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopicayune.com hellopicayune.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopickerington.com hellopickerington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopleasantprairie.com hellopleasantprairie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloponca.com helloponca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloqueens.com helloqueens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloraymore.com helloraymore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellorevere.com hellorevere.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosafetyharbor.com hellosafetyharbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosaginaw.com hellosaginaw.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosantaana.com hellosantaana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloscottsdale.com helloscottsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloscranton.com helloscranton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosherbrooke.com hellosherbrooke.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosherwood.com hellosherwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosiouxcity.com hellosiouxcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloskokie.com helloskokie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosmyrna.com hellosmyrna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosnellville.com hellosnellville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosouthaven.com hellosouthaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosouthbend.com hellosouthbend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellostevenspoint.com hellostevenspoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellostillwater.com hellostillwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellotemple.com hellotemple.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloterrell.com helloterrell.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellovanburen.com hellovanburen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellovermont.com hellovermont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowestvirginia.com hellowestvirginia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowilkesbarre.com hellowilkesbarre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowilsonville.com hellowilsonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowoodlandpark.com hellowoodlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hindime.net hindime.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
historynet.com historynet.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jul 2019 Sep 2019 56 days
hobbytalk.com hobbytalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hondacrf.com hondacrf.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hondashadow.net hondashadow.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
hothardware.com hothardware.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Jul 2019 One Off
htconexforum.net htconexforum.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
huntsvillehavoc.com huntsvillehavoc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 1 day
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ibdsupport.org ibdsupport.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
iceboltztournament.com iceboltztournament.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Jun 2019 48 days
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
indiaparenting.com indiaparenting.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
inetgalaxy.com inetgalaxy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 96 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 96 days
infinitiqx50.org infinitiqx50.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
innerchildfun.com innerchildfun.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
italiaflyers.com italiaflyers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Dec 2019 Dec 2019 One Off
itproportal.com itproportal.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
jetlaggin.com jetlaggin.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 220 days
SONO SONO-783272317B Oct 2019 Mar 2020 159 days
jiujiure69.com jiujiure69.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
jojoebi.com jojoebi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 123 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
joscountryjunction.com joscountryjunction.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
jpost.com jpost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
kalamtimes.com kalamtimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 157 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 157 days
kawasakiz125.org kawasakiz125.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
keyw.com keyw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kimilove.com kimilove.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 126 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
koimoi.com koimoi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
kotaku.co.uk kotaku.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 280 days
AOL AOL-49648 Dec 2019 Feb 2020 56 days
kqvt.com kqvt.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kumudam.com kumudam.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 217 days
FWHL FWHL-762737 Oct 2019 Dec 2019 65 days
landroversonly.com landroversonly.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
lastwordonsports.com lastwordonsports.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
leasticoulddo.com leasticoulddo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jan 2020 186 days
AOL AOL-49648 Oct 2019 Jan 2020 105 days
leicestercity-mad.co.uk leicestercity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Dec 2019 177 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
leytonorient-mad.co.uk leytonorient-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 232 days
AOL AOL-49648 Dec 2019 Feb 2020 55 days
librarium-online.com librarium-online.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
lifebru.com lifebru.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
SONO SONO-783272317B Dec 2019 Mar 2020 90 days
lifewithfingerprints.com lifewithfingerprints.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Jan 2020 One Off
DM DM-100974 Jan 2020 Jan 2020 One Off
linkingsky.com linkingsky.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 124 days
FWHL FWHL-762737 Oct 2019 Feb 2020 124 days
loudwiremusicfestival.com loudwiremusicfestival.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
luxandlush.com luxandlush.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 266 days
FWHL FWHL-762737 Aug 2019 Feb 2020 195 days
lwos.life lwos.life
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Dec 2019 136 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
lwosports.com lwosports.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Feb 2020 186 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
lyricsmania.com lyricsmania.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
madhyamam.com madhyamam.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
FWHL FWHL-762737 Mar 2020 Mar 2020 14 days
mercurycougar.net mercurycougar.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mikw.cn mikw.cn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
mixonline.com mixonline.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
SONO SONO-783272317B Jan 2020 Jan 2020 One Off
mlyfood.com mlyfood.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 127 days
AOL AOL-49648 Oct 2019 Oct 2019 12 days
mmajunkie.com mmajunkie.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
momspresso.com momspresso.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 213 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 213 days
momworksitout.com momworksitout.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 127 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
monctonminorbaseball.ca monctonminorbaseball.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
mopar-nation.com mopar-nation.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mummymade.it mummymade.it
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Dec 2019 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
mustangevolution.com mustangevolution.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mykitchenescapades.com mykitchenescapades.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
mylargescale.com mylargescale.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nadinerebecca.com nadinerebecca.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Oct 2019 63 days
AOL AOL-49648 Oct 2019 Oct 2019 14 days
newcastleunited-mad.co.uk newcastleunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 114 days
DM DM-100974 Jul 2019 Oct 2019 113 days
newsbugz.com newsbugz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 211 days
FWHL FWHL-762737 Dec 2019 Feb 2020 57 days
newstm.in newstm.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 149 days
FWHL FWHL-762737 Oct 2019 Dec 2019 65 days
nigeriaworld.com nigeriaworld.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
nihl.net nihl.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Dec 2019 65 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
nipawinmha.ca nipawinmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 128 days
AOL AOL-6748 May 2019 May 2019 One Off
nnn102.top nnn102.top
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
novelcool.com novelcool.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
odishatv.in odishatv.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
rare.us rare.us
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 124 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
rarecountry.com rarecountry.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Feb 2020 119 days
DM DM-100974 Oct 2019 Feb 2020 107 days
ontarioballhockeyfederation.ca ontarioballhockeyfederation.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
oomph.co.id oomph.co.id
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
opelgt.com opelgt.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
openlist.com openlist.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
optbong.com optbong.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
orleansfirebirds.com orleansfirebirds.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 25 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
paw-talk.net paw-talk.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rccanada.ca rccanada.ca
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
readpl.com readpl.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
readamericanfootball.com readamericanfootball.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 99 days
readberserk.com readberserk.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
readbundesliga.com readbundesliga.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
readchelsea.com readchelsea.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
readfootball.co readfootball.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readgolf.com readgolf.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
readhull.com readhull.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 99 days
readshowbiz.co readshowbiz.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readstoke.com readstoke.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readtennis.co readtennis.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 99 days
readtottenham.com readtottenham.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 52 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
pbnation.com pbnation.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
pcrmra.ca pcrmra.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 260 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
peninsulaclarion.com peninsulaclarion.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 59 days
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 45 days
pghlesbian.com pghlesbian.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
phoenixnewtimes.com phoenixnewtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
phpclasses.hu phpclasses.hu
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 208 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
picbear.org picbear.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 16 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
pmfa.ca pmfa.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
punchng.com punchng.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
puradsifm.com puradsifm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 78 days
FWHL FWHL-762737 Jan 2020 Feb 2020 54 days
puthiyathalaimurai.com puthiyathalaimurai.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 54 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
radioandmusic.com radioandmusic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 14 days
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
redcarpet-fashionawards.com redcarpet-fashionawards.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
AOL AOL-49648 Jan 2020 Jan 2020 One Off
reginaballhockey.com reginaballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
renaultzeforum.com renaultzeforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
renfrewminorhockey.ca renfrewminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
hellosaintkitts.com hellosaintkitts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
aboomerslifeafter50.com aboomerslifeafter50.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
readbournemouth.com readbournemouth.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 99 days
acidcow.com acidcow.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
readceltic.com readceltic.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 99 days
readchampionship.com readchampionship.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
hellodenison.com hellodenison.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
bradfordcity-mad.co.uk bradfordcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 144 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
rugbypass.com rugbypass.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 169 days
SONO SONO-783272317B Feb 2020 Feb 2020 One Off
russbk.com russbk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
runlifteatrepeat.com runlifteatrepeat.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
saablink.net saablink.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
saabscene.com saabscene.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
arhlhockey.com arhlhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jan 2020 236 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
catflyph.com catflyph.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 87 days
ORC ORC-402 May 2019 May 2019 One Off
savoringthethyme.com savoringthethyme.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 66 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
agardenforthehouse.com agardenforthehouse.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
seaangling.org.uk seaangling.org.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
seagullsbaseballacademy.com seagullsbaseballacademy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Jan 2020 Jan 2020 One Off
seamsandscissors.com seamsandscissors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Sep 2019 Sep 2019 One Off
ahorrarmas.com ahorrarmas.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
airdrieunited-mad.co.uk airdrieunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 254 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
senpaizs.com senpaizs.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 66 days
DM DM-100974 Jan 2020 Jan 2020 One Off
seriousaboutrl.com seriousaboutrl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 21 days
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
aleandtere.com aleandtere.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Jan 2020 110 days
armytimes.com armytimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
allaccess.com allaccess.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sfseagulls.com sfseagulls.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
aliontherunblog.com aliontherunblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Jan 2020 110 days
shediacminorhockey.com shediacminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 May 2019 May 2019 One Off
allfreediyweddings.com allfreediyweddings.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Sep 2019 Sep 2019 One Off
allhiphop.com allhiphop.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
DM DM-100974 Sep 2019 Sep 2019 One Off
alfaowner.com alfaowner.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
shotgunforums.com shotgunforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
slingshotforums.com slingshotforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
smashedpeasandcarrots.com smashedpeasandcarrots.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
smdsc.com.au smdsc.com.au
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
snapguide.com snapguide.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
angelswin.com angelswin.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
snowblower.com snowblower.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
snsprospects.ca snsprospects.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Nov 2019 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
antonym.com antonym.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jul 2019 48 days
sonataforums.com sonataforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
apmha.org apmha.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
AOL AOL-6748 Nov 2019 Nov 2019 One Off
sportfishingmag.com sportfishingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
srxforum.net srxforum.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
10tv.in 10tv.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 110 days
FWHL FWHL-762737 Jan 2020 Mar 2020 58 days
hellokenner.com hellokenner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
readligue1.com readligue1.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
subaruoutback.org subaruoutback.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
agha.ca agha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 109 days
AOL AOL-6748 Mar 2020 Mar 2020 One Off
airforcetimes.com airforcetimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
albat.com.mx albat.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 213 days
FWHL FWHL-762769 May 2019 May 2019 One Off
suzukicentral.com suzukicentral.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
swanagefc.com swanagefc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
aspsnippets.com aspsnippets.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
astrostyle.com astrostyle.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
taxguru.in taxguru.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 278 days
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
atimeoutformommy.com atimeoutformommy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Jan 2020 112 days
tazandbelly.com tazandbelly.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
team-integra.net team-integra.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
atozproxy.com atozproxy.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 182 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
techlicious.com techlicious.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
telugumirchi.com telugumirchi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
teluguz.com teluguz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 198 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
terraceminorhockey.ca terraceminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Mar 2020 135 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
terezowens.com terezowens.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
the-gadgeteer.com the-gadgeteer.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Sep 2019 104 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
awwthings.com awwthings.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 107 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
theawesomer.com theawesomer.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Sep 2019 Sep 2019 One Off
thebeautygypsy.com thebeautygypsy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 66 days
DM DM-100974 Nov 2019 Jan 2020 66 days
thebeautymilk.com thebeautymilk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
thedailyworld.com thedailyworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 59 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
ayrunited-mad.co.uk ayrunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 146 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
azlyrics.com azlyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
thehairstyler.com thehairstyler.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 89 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
babynamegenie.com babynamegenie.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
backgrounddownload.com backgrounddownload.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 181 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
thesixthaxis.com thesixthaxis.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
thesmallthingsblog.com thesmallthingsblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
thetechgame.com thetechgame.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
bakingwithblondie.com bakingwithblondie.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Jan 2020 One Off
DM DM-100974 Jan 2020 Jan 2020 One Off
readwestbrom.com readwestbrom.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Aug 2019 52 days
SONO SONO-783272317B Jul 2019 Aug 2019 52 days
tidbitsofexperience.com tidbitsofexperience.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
tirereviewsandmore.com tirereviewsandmore.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
topnewsthamizh.com topnewsthamizh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 68 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
bcsportbikes.com bcsportbikes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
trails.com trails.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
beebom.com beebom.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
FWHL FWHL-762769 May 2019 May 2019 One Off
behindwoods.com behindwoods.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
trueself.com trueself.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Sep 2019 101 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
trukx.com trukx.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tsxclub.com tsxclub.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bernieburkegolf.ca bernieburkegolf.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
turkeyhuntingchat.com turkeyhuntingchat.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
turbododge.com turbododge.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
tvline.com tvline.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jan 2020 183 days
SONO SONO-783272317B May 2019 Nov 2019 166 days
ulifestyle.com.hk ulifestyle.com.hk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 131 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
bjpenn.com bjpenn.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
vauxhallownersnetwork.co.uk vauxhallownersnetwork.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
blacknaps.org blacknaps.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
victoryforums.com victoryforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
viperalley.com viperalley.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vintage-mustang.com vintage-mustang.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
bluefm.com.ar bluefm.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 171 days
FWHL FWHL-762769 May 2019 May 2019 One Off
vizslaforums.com vizslaforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bnwr.ca bnwr.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Sep 2019 143 days
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
volvo-forums.com volvo-forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
vtflameshockey.com vtflameshockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
vtvgujarati.com vtvgujarati.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 194 days
FWHL FWHL-762737 Sep 2019 Mar 2020 177 days
boldsky.com boldsky.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
bollywood3.in bollywood3.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 106 days
FWHL FWHL-762737 Nov 2019 Feb 2020 66 days
revelblog.com revelblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
wales-mad.co.uk wales-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 213 days
AOL AOL-49648 Jan 2020 Feb 2020 29 days
wantnot.net wantnot.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
wearethatfamily.com wearethatfamily.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
boxofficeindia.com boxofficeindia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
whatcharlottebaked.com whatcharlottebaked.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 35 days
whathifi.com whathifi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Feb 2020 24 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
windowscentral.com windowscentral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Jan 2020 Feb 2020 24 days
buddhanet01.com buddhanet01.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 48 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
woojr.com woojr.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
wonderwall.com wonderwall.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
wowkeren.com wowkeren.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
wrfc.net wrfc.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
xclient.info xclient.info
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
cali-zona.com cali-zona.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Jan 2020 One Off
DM DM-100974 Jan 2020 Jan 2020 One Off
yachtingmagazine.com yachtingmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Sep 2019 104 days
care2.com care2.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
yovizag.com yovizag.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
catchnews.com catchnews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 113 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
readysethappy.com readysethappy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Jan 2020 128 days
AOL AOL-49648 Oct 2019 Oct 2019 One Off
zepp.news zepp.news
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
zestysouthindiankitchen.com zestysouthindiankitchen.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Jan 2020 105 days
zksrilanka.com zksrilanka.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
zotyezone.com zotyezone.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hellohiltonheadisland.com hellohiltonheadisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellohercules.com hellohercules.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
cichlid-forum.com cichlid-forum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
helloemporia.com helloemporia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
cinemablend.com cinemablend.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
citiblog.co.uk citiblog.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B Jun 2019 Jul 2019 49 days
clubrsx.com clubrsx.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cobrashockeyaa.net cobrashockeyaa.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 227 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
cpdynamo.com cpdynamo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 180 days
AOL AOL-6748 Jun 2019 Jul 2019 49 days
craftster.org craftster.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 231 days
DM DM-100974 Jul 2019 Feb 2020 210 days
cumminsforum.com cumminsforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
curvestocontour.com curvestocontour.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 66 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
customdakotas.com customdakotas.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cute2w.in cute2w.in
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
dailypuppy.com dailypuppy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dainikgomantak.com dainikgomantak.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Dec 2019 64 days
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
data-base.pro data-base.pro
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
deerhuntersclub.com deerhuntersclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
deshtv.in deshtv.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 168 days
FWHL FWHL-762737 Sep 2019 Feb 2020 130 days
dinamalar.com dinamalar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
discuss.com.hk discuss.com.hk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
dlrccricket.com dlrccricket.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
DM DM-100974 Jun 2019 Jun 2019 One Off
dogforum.com dogforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
dunfermlineathletic-mad.co.uk dunfermlineathletic-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 245 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ehowenespanol.com ehowenespanol.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Jun 2019 One Off
einerd.com.br einerd.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 167 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
eldestaperadio.com eldestaperadio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
FWHL FWHL-762769 May 2019 May 2019 One Off
eleconomistaamerica.co eleconomistaamerica.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
FWHL FWHL-762769 May 2019 May 2019 One Off
elkhadra.com elkhadra.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 102 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
endurocross.com endurocross.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
entertainmentdaily.co.uk entertainmentdaily.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 54 days
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
etnet.com.hk etnet.com.hk
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Jan 2020 65 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
eugeniekitchen.com eugeniekitchen.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
everydaydiabeticrecipes.com everydaydiabeticrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Sep 2019 56 days
extratimetalk.com extratimetalk.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Feb 2020 186 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
favesouthernrecipes.com favesouthernrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
feoa.net feoa.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
finance101.com finance101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
fireblades.org fireblades.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
firstcry.com firstcry.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 58 days
floridaconcealedcarry.com floridaconcealedcarry.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
focusst.org focusst.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
followmanga.com followmanga.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 101 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
footballfancast.com footballfancast.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
AOL AOL-6748 Jun 2019 Jun 2019 One Off
forestgreenrovers-mad.co.uk forestgreenrovers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 2 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
framedcooks.com framedcooks.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
fsm-media.com fsm-media.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
gem021.com gem021.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 165 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
giants365.com giants365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 321 days
FWHL FWHL-762769 May 2019 May 2019 One Off
girlshockey.ca girlshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 165 days
AOL AOL-6748 Feb 2020 Feb 2020 One Off
goldwingowners.com goldwingowners.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
graspingforobjectivity.com graspingforobjectivity.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
gtpositive.com gtpositive.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 99 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
gujaratilexicon.com gujaratilexicon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
harbourcitylakersringette.com harbourcitylakersringette.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Mar 2020 274 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
helloaberdeen.com helloaberdeen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloalbany.com helloalbany.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloannarbor.com helloannarbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloardmore.com helloardmore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloarlington.com helloarlington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloavenal.com helloavenal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobatavia.com hellobatavia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobensenville.com hellobensenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobessemer.com hellobessemer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobloomington.com hellobloomington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobuenapark.com hellobuenapark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocedarhill.com hellocedarhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellochandler.com hellochandler.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocollegepark.com hellocollegepark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocottagegrove.com hellocottagegrove.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocudahy.com hellocudahy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodelaware.com hellodelaware.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodetroit.com hellodetroit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloeastorange.com helloeastorange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloelmirage.com helloelmirage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloevansville.com helloevansville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellofayetteville.com hellofayetteville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloflint.com helloflint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogoldenvalley.com hellogoldenvalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Aug 2020 Apr 2021 242 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellograyslake.com hellograyslake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogreenbay.com hellogreenbay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogreendale.com hellogreendale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellogulfshores.com hellogulfshores.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohattiesburg.com hellohattiesburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloholladay.com helloholladay.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloindianapolis.com helloindianapolis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloiowacity.com helloiowacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellojerseycity.com hellojerseycity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellokingsville.com hellokingsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellokinston.com hellokinston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Apr 2021 80 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloleawood.com helloleawood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloliberal.com helloliberal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolittleton.com hellolittleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolouisiana.com hellolouisiana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomacon.com hellomacon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomanassaspark.com hellomanassaspark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomendocino.com hellomendocino.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomequon.com hellomequon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomethuen.com hellomethuen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomiamilakes.com hellomiamilakes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellominden.com hellominden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomountainbrook.com hellomountainbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomyrtlebeach.com hellomyrtlebeach.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Sep 2019 Sep 2019 One Off
helloneworleans.com helloneworleans.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonicholasville.com hellonicholasville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonorthcanton.com hellonorthcanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellonorthplatte.com hellonorthplatte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloogden.com helloogden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooklahoma.com hellooklahoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloowatonna.com helloowatonna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopennsylvania.com hellopennsylvania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopinole.com hellopinole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Apr 2021 80 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloportwashington.com helloportwashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellopretoria.com hellopretoria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloquincy.com helloquincy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellorhodeisland.com hellorhodeisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloroanoke.com helloroanoke.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellorolla.com hellorolla.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosanfrancisco.com hellosanfrancisco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloseguin.com helloseguin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosoledad.com hellosoledad.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosouthsanfrancisco.com hellosouthsanfrancisco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellospartanburg.com hellospartanburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosuperior.com hellosuperior.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellotacoma.com hellotacoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellotrenton.com hellotrenton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowaco.com hellowaco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowatsonville.com hellowatsonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowestland.com hellowestland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowestlinn.com hellowestlinn.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowestmont.com hellowestmont.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowinona.com hellowinona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowyandotte.com hellowyandotte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
heraldspot.com heraldspot.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 163 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
hhla.ca hhla.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hket-work.com hket-work.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 163 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
hookedforlifepublishing.com hookedforlifepublishing.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 65 days
DM DM-100974 Nov 2019 Jan 2020 65 days
hornetforumz.com hornetforumz.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
hoverugby.club hoverugby.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
hrfc.ca hrfc.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 1 day
AOL AOL-6748 Aug 2019 Aug 2019 One Off
hrvforum.com hrvforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
humboldtminorhockey.ca humboldtminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
hungry-girl.com hungry-girl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 65 days
DM DM-100974 Nov 2019 Jan 2020 65 days
hunterr.site hunterr.site
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
DM DM-100974 Aug 2019 Aug 2019 One Off
hzeppfeed.com hzeppfeed.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 97 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 97 days
iasexamportal.com iasexamportal.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Feb 2020 188 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
ibc24.in ibc24.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 34 days
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
icehawkshockey.ca icehawkshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 34 days
AOL AOL-6748 Feb 2020 Feb 2020 One Off
imleagues.com imleagues.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 191 days
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
indezine.com indezine.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 110 days
FWHL FWHL-762737 Jan 2020 Mar 2020 45 days
infinitiqx60.org infinitiqx60.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
iranitv.com iranitv.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 221 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
islandfastpitchleague.com islandfastpitchleague.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
itsolutionstuff.com itsolutionstuff.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
iwsti.com iwsti.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
java2novice.com java2novice.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 220 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
jeepgarage.org jeepgarage.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jejakpiknik.com jejakpiknik.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 159 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
jockeyjournal.com jockeyjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jouelzy.com jouelzy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 184 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
justhungry.com justhungry.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 154 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
justmommies.com justmommies.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Nov 2019 169 days
SONO SONO-783272317B Jun 2019 Nov 2019 169 days
kawieriders.com kawieriders.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kezj.com kezj.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
khaleejtimes.com khaleejtimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 44 days
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 44 days
krod.com krod.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
laraza.com laraza.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jul 2019 Jul 2019 One Off
lecap.net lecap.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 90 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
letterboxd.com letterboxd.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Sep 2019 Sep 2019 One Off
lightpollutionmap.info lightpollutionmap.info
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 154 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
live959.com live959.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
lotustalk.com lotustalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
lumsdencubs.ca lumsdencubs.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Jun 2019 Jun 2019 One Off
lyricsreg.com lyricsreg.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
lyrster.com lyrster.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
manacinema.com manacinema.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
marinecorpstimes.com marinecorpstimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Sep 2019 104 days
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
massbaychiefs.com massbaychiefs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 136 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
mediotiempo.com mediotiempo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 45 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
melandboyskitchen.com melandboyskitchen.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 127 days
AOL AOL-49648 Oct 2019 Dec 2019 76 days
mirchistatus.com mirchistatus.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 151 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 151 days
moddedmustangs.com moddedmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
morecambe-mad.co.uk morecambe-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 229 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
mqtmutineers.com mqtmutineers.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
mrfood.com mrfood.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
muddybootsanddiamonds.com muddybootsanddiamonds.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 127 days
AOL AOL-49648 Oct 2019 Oct 2019 13 days
mykhel.com mykhel.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 39 days
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
myurbanfamily.com myurbanfamily.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 128 days
AOL AOL-49648 Oct 2019 Dec 2019 65 days
nationalgunforum.com nationalgunforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nativeplanet.com nativeplanet.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
newtonaycliffefc.co.uk newtonaycliffefc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
nfldraftdiamonds.com nfldraftdiamonds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 231 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nonilo.com nonilo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 122 days
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
nsmmhl.com nsmmhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
nvshl.org nvshl.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
odishareporter.in odishareporter.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 210 days
FWHL FWHL-762737 Oct 2019 Feb 2020 121 days
off-road.com off-road.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
offcampusjobs4u.com offcampusjobs4u.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 147 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 147 days
ohhappyplay.com ohhappyplay.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Dec 2019 65 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
omhahockey.ca omhahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Dec 2019 65 days
AOL AOL-6748 May 2019 May 2019 One Off
onefrugalgirl.com onefrugalgirl.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
ontheflix.com ontheflix.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
orlandoweekly.com orlandoweekly.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
AOL AOL-6748 Jul 2019 Sep 2019 56 days
outlookindia.com outlookindia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
paintballscene.com paintballscene.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
palachinkablog.com palachinkablog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 154 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
pamha.ca pamha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 145 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
parentingisnteasy.co parentingisnteasy.co
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 May 2019 One Off
patchworktimes.com patchworktimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
petawawaminorhockey.ca petawawaminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Feb 2020 Feb 2020 One Off
peterboroughunited-mad.co.uk peterboroughunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 224 days
AOL AOL-49648 Oct 2019 Oct 2019 18 days
pintester.com pintester.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
planetdiecast.com planetdiecast.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
playfa.com playfa.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 144 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
plmha.ca plmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 306 days
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
plymouthargyle-mad.co.uk plymouthargyle-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 172 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
pngdb.com pngdb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
popdust.com popdust.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 Jul 2019 Jul 2019 One Off
prajavani.net prajavani.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 207 days
FWHL FWHL-762737 Aug 2019 Jan 2020 146 days
predatortalk.com predatortalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
puradsi.com puradsi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Feb 2020 234 days
FWHL FWHL-762737 Aug 2019 Jan 2020 146 days
qashqaiforum.com qashqaiforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
queenspark-mad.co.uk queenspark-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jan 2020 Feb 2020 42 days
raptorforum.com raptorforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
renegadeforum.com renegadeforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
riverfronttimes.com riverfronttimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Nov 2019 121 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
rochakkhabare.com rochakkhabare.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 204 days
FWHL FWHL-762737 Nov 2019 Feb 2020 118 days
rochdale-mad.co.uk rochdale-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 106 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
roofingtalk.com roofingtalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
routerforums.com routerforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
acrediteounao.com acrediteounao.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 185 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
accessauburn.com accessauburn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
FWHL FWHL-762769 May 2019 May 2019 One Off
rugby.co.uk rugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Nov 2019 116 days
AOL AOL-49648 Oct 2019 Nov 2019 23 days
rughookingmagazine.com rughookingmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
DM DM-100974 Sep 2019 Sep 2019 One Off
rzrforums.net rzrforums.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hellosaintnevis.com hellosaintnevis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
sackvilleminorhockey.ca sackvilleminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 256 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
sacurrent.com sacurrent.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Nov 2019 121 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
saabcentral.com saabcentral.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
safetxt.us safetxt.us
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 140 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
saskatoonredwings.ca saskatoonredwings.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 84 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
saracensamateurrugby.com saracensamateurrugby.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
satyahindi.com satyahindi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 22 days
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 22 days
scr950forum.com scr950forum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
scramblerforum.com scramblerforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
scribol.com scribol.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Nov 2019 24 days
DM DM-100974 Jul 2019 Jul 2019 One Off
setalarmclock.net setalarmclock.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
allaboutjazz.com allaboutjazz.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Sep 2019 Mar 2020 175 days
alladsnetwork.com alladsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 119 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
sheffieldunited-mad.co.uk sheffieldunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 167 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
allfreepapercrafts.com allfreepapercrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Sep 2019 Sep 2019 One Off
shootersforum.com shootersforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
shootforthestarshockey.com shootforthestarshockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Feb 2020 52 days
FWHL FWHL-762737 Aug 2019 Sep 2019 22 days
articlebio.com articlebio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
allparenting.com allparenting.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
AOL AOL-49648 Jan 2020 Jan 2020 One Off
amherstramblersalumni.ca amherstramblersalumni.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
singletrackworld.com singletrackworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
sleafordcc.co.uk sleafordcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
skyelitenews.com skyelitenews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
sluiternation.com sluiternation.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 129 days
AOL AOL-49648 Oct 2019 Nov 2019 25 days
answertrade.com answertrade.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 107 days
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 107 days
snowblowerforum.com snowblowerforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
songoda.com songoda.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 102 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
sportsmedia101.com sportsmedia101.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 253 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ssbasketball.ca ssbasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Mar 2020 137 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ssbcrack.com ssbcrack.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 137 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
stack.com stack.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 153 days
AOL AOL-6748 Mar 2020 Mar 2020 20 days
stacysrandomthoughts.com stacysrandomthoughts.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Jan 2020 105 days
012763.com 012763.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
stereogum.com stereogum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
124spider.org 124spider.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
stylebybeth.com stylebybeth.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
subarubrzforum.com subarubrzforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
subject.com.ua subject.com.ua
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 204 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
sunset.com sunset.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allfreekidscrafts.com allfreekidscrafts.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
survivalistboards.com survivalistboards.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
anabelmagazine.com anabelmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 53 days
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 53 days
swindontown-mad.co.uk swindontown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jan 2020 Feb 2020 35 days
talkingwithtami.com talkingwithtami.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 65 days
DM DM-100974 Nov 2019 Jan 2020 65 days
techlearning.com techlearning.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jan 2020 186 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
technabob.com technabob.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
atwateraviators.com atwateraviators.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
aula2pl.com aula2pl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 May 2019 May 2019 One Off
avnetwork.com avnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
thecombineforum.com thecombineforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thehealthycookingcoach.com thehealthycookingcoach.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
theshapeofamother.com theshapeofamother.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
thesphl.com thesphl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
threemanycooks.com threemanycooks.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
barefootblonde.com barefootblonde.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
torl.ca torl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
toyotachrforum.com toyotachrforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
behindthename.com behindthename.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 65 days
DM DM-100974 Nov 2019 Jan 2020 65 days
beijixingyl.net beijixingyl.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
traverseforum.com traverseforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
trivia.com trivia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
MEDI MEDI-8CUZ310G2 Sep 2019 Nov 2019 65 days
trmzzdg.club trmzzdg.club
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
trxforums.com trxforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bigoven.com bigoven.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Feb 2020 24 days
AOL AOL-49648 Jan 2020 Feb 2020 24 days
utahconcealedcarry.com utahconcealedcarry.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
utvdriver.com utvdriver.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Nov 2019 167 days
DM DM-100974 May 2019 May 2019 One Off
bitcheswhobrunch.com bitcheswhobrunch.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 131 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
bitul.in bitul.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 180 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
valiant.org valiant.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
vectisrugby.co.uk vectisrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
blackburnrovers-mad.co.uk blackburnrovers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 202 days
AOL AOL-49648 Oct 2019 Feb 2020 114 days
blogher.com blogher.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jan 2020 186 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
viral-centre.com viral-centre.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Sep 2019 102 days
SONO SONO-783272317B May 2019 Sep 2019 102 days
vtcafe.com vtcafe.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
walleyecentral.com walleyecentral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
books2020.com books2020.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 79 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
watercoolerconvos.com watercoolerconvos.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 35 days
warman3on3.com warman3on3.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
wcmha.ca wcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
boxingtribune-news.com boxingtribune-news.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 216 days
FWHL FWHL-762769 May 2019 May 2019 One Off
weide28.com weide28.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
westword.com westword.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
wikitelegraph.com wikitelegraph.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
wildcatforums.net wildcatforums.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
bucksphoenixnc.co.uk bucksphoenixnc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 49 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
bulldogbreeds.com bulldogbreeds.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
burbankmom.com burbankmom.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Jan 2020 One Off
DM DM-100974 Jan 2020 Jan 2020 One Off
wranglerboard.com wranglerboard.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
wynyardminorhockey.ca wynyardminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Nov 2019 Nov 2019 One Off
hellosaintvincent.com hellosaintvincent.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
can-amtalk.com can-amtalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
yinbuzz.com yinbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 191 days
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 61 days
yourchords.com yourchords.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
yourhomeonlybetter.com yourhomeonlybetter.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
cbseportal.com cbseportal.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
celebmafia.com celebmafia.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Jan 2020 165 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
zeppstories.com zeppstories.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 14 days
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
ziperto.com ziperto.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
cheapeatsthriftycrafts.com cheapeatsthriftycrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Sep 2019 Sep 2019 One Off
chevroletcruze.net chevroletcruze.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chicgalleria.com chicgalleria.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
circuitdigest.com circuitdigest.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 234 days
FWHL FWHL-762737 Sep 2019 Mar 2020 176 days
clickrnews.com clickrnews.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
clubtouareg.com clubtouareg.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
clubxb.com clubxb.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
cnwhc.co.uk cnwhc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
coinagereport.com coinagereport.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
cookingdonelight.com cookingdonelight.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 66 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
cookstr.com cookstr.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
coventrycity-mad.co.uk coventrycity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 248 days
AOL AOL-49648 Dec 2019 Feb 2020 76 days
cowdenbeath-mad.co.uk cowdenbeath-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 199 days
AOL AOL-49648 Dec 2019 Feb 2020 76 days
cravecanada.com cravecanada.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
cricketforum.com cricketforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
cruisingworld.com cruisingworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jul 2019 Sep 2019 56 days
cruzetalk.com cruzetalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
crzforum.com crzforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
cufla.ca cufla.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Mar 2020 227 days
FWHL FWHL-762737 Aug 2019 Sep 2019 49 days
cvba.ca cvba.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Dec 2019 172 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
cyahs.club cyahs.club
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 104 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
cyclingnews.com cyclingnews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
davidlebovitz.com davidlebovitz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
defensenews.com defensenews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
discordhelp.net discordhelp.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
NEX NEX-3391 Aug 2019 Aug 2019 8 days
doctorlib.info doctorlib.info
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 172 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
dodge-nitro.com dodge-nitro.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
domesticbliss2.com domesticbliss2.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
AOL AOL-49648 Oct 2019 Dec 2019 55 days
domino.com domino.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Jul 2019 One Off
dootalk.com dootalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
dreamingloud.com dreamingloud.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
drivespark.com drivespark.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
dukemanorfarm.com dukemanorfarm.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
AOL AOL-49648 Oct 2019 Feb 2020 122 days
dundee-mad.co.uk dundee-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 196 days
AOL AOL-49648 Dec 2019 Feb 2020 72 days
dundeeunited-mad.co.uk dundeeunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 196 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
dynamitecandy.com dynamitecandy.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 103 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
eclecticevelyn.com eclecticevelyn.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
eleconomistaamerica.com.ar eleconomistaamerica.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
FWHL FWHL-762769 May 2019 May 2019 One Off
eleconomistaamerica.com.br eleconomistaamerica.com.br
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
FWHL FWHL-762769 May 2019 May 2019 One Off
equestriadaily.com equestriadaily.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 50 days
DM DM-100974 Aug 2019 Aug 2019 One Off
eskimoves.com eskimoves.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
esportslatest.com esportslatest.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 49 days
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
exchange4media.com exchange4media.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 59 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
fashionstyleology.com fashionstyleology.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
fiat500owners.com fiat500owners.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
firefaucet.win firefaucet.win
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Dec 2019 121 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
fordexplorer.org fordexplorer.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
forensicfilesnow.com forensicfilesnow.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Oct 2019 Feb 2020 126 days
free-power-point-templates.com free-power-point-templates.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
frugalvillage.com frugalvillage.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fuelingmamahood.com fuelingmamahood.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Feb 2020 Feb 2020 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
gaara.ca gaara.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 155 days
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
getsongbpm.com getsongbpm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 223 days
FWHL FWHL-762769 May 2019 May 2019 One Off
girlbossesrock.com girlbossesrock.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Oct 2019 Feb 2020 127 days
gmdietworks.com gmdietworks.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gminsidenews.com gminsidenews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
gohealth01.com gohealth01.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 100 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
gossiponthis.com gossiponthis.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
haytalk.com haytalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
gourmetgourmandfoodblog.com gourmetgourmandfoodblog.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Feb 2020 Feb 2020 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
govipersgo.com govipersgo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
gtaall.com gtaall.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
gtaall.com.br gtaall.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
gtaall.eu gtaall.eu
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 223 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
guelphminorfootball.net guelphminorfootball.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Feb 2020 287 days
FWHL FWHL-762737 Aug 2019 Feb 2020 189 days
guyandtheblog.com guyandtheblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 125 days
AOL AOL-49648 Oct 2019 Dec 2019 63 days
halifaxhockey.ca halifaxhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
haribhoomi.com haribhoomi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
FWHL FWHL-762737 Dec 2019 Feb 2020 64 days
haslemererugby.co.uk haslemererugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 May 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
headlinesoftoday.com headlinesoftoday.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
helloansonia.com helloansonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloartesia.com helloartesia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloaurora.com helloaurora.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobenbrook.com hellobenbrook.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloblueisland.com helloblueisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobossier.com hellobossier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellobowlinggreen.com hellobowlinggreen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobrownsville.com hellobrownsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellochinohills.com hellochinohills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocoralgables.com hellocoralgables.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocorcoran.com hellocorcoran.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodenver.com hellodenver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellodoral.com hellodoral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloflight.com helloflight.com
Attribute Value First Detected Last Detected Overlap Duration
CONN CONN-102738 Jun 2019 Mar 2020 293 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
helloflowermound.com helloflowermound.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloforestlake.com helloforestlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellofortlauderdale.com hellofortlauderdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellofranklinpark.com hellofranklinpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogainesville.com hellogainesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohamlake.com hellohamlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohialeahgardens.com hellohialeahgardens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohopkinsville.com hellohopkinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohouma.com hellohouma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellokingman.com hellokingman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellokiryasjoel.com hellokiryasjoel.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 3 days
hellokuna.com hellokuna.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolafayette.com hellolafayette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolakejackson.com hellolakejackson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolamesa.com hellolamesa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolancaster.com hellolancaster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolavergne.com hellolavergne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolawrenceville.com hellolawrenceville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomachesneypark.com hellomachesneypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomauldin.com hellomauldin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomiddleton.com hellomiddleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomoore.com hellomoore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonewark.com hellonewark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonewberg.com hellonewberg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonewjersey.com hellonewjersey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonewyork.com hellonewyork.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooakley.com hellooakley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellooklahomacity.com hellooklahomacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloopryland.com helloopryland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloorangeburg.com helloorangeburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooshkosh.com hellooshkosh.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopalmsprings.com hellopalmsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopanamacity.com hellopanamacity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloparagould.com helloparagould.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloparamount.com helloparamount.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopeekskill.com hellopeekskill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopensacola.com hellopensacola.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopinellaspark.com hellopinellaspark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloportarthur.com helloportarthur.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloporthueneme.com helloporthueneme.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloprovidence.com helloprovidence.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellorochester.com hellorochester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellorockhill.com hellorockhill.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellorockvillecentre.com hellorockvillecentre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosalina.com hellosalina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosanjose.com hellosanjose.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosantafesprings.com hellosantafesprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosearcy.com hellosearcy.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosouthgate.com hellosouthgate.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellospringboro.com hellospringboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellosteamboatsprings.com hellosteamboatsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosteubenville.com hellosteubenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellostockton.com hellostockton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellostoughton.com hellostoughton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellotulare.com hellotulare.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellounitedkingdom.com hellounitedkingdom.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellouniversal.com hellouniversal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellourbana.com hellourbana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellovannuys.com hellovannuys.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowestallis.com hellowestallis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowestcovina.com hellowestcovina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowestjordan.com hellowestjordan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowheatridge.com hellowheatridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowhitehall.com hellowhitehall.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hopejoyinchrist.com hopejoyinchrist.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 127 days
DM DM-100974 Oct 2019 Feb 2020 127 days
hotbikeweb.com hotbikeweb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
DM DM-100974 Jul 2019 Jul 2019 One Off
hotrodders.com hotrodders.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
howtoadult.com howtoadult.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 98 days
DM DM-100974 Jun 2019 Aug 2019 50 days
hrmladiesfastball.ca hrmladiesfastball.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 162 days
AOL AOL-6748 Feb 2020 Feb 2020 One Off
iknowthescore.co.uk iknowthescore.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Feb 2020 189 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
imore.com imore.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jul 2019 Nov 2019 121 days
indiaglitz.com indiaglitz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Sep 2019 35 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
inliterature.net inliterature.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
iptvplayerguide.com iptvplayerguide.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 96 days
FWHL FWHL-762737 Dec 2019 Feb 2020 63 days
islands.com islands.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jun 2019 Jun 2019 One Off
jeepcommander.com jeepcommander.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jrbanditsaaa.com jrbanditsaaa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Mar 2020 270 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
kanatabasketball.ca kanatabasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Feb 2020 237 days
FWHL FWHL-762737 Aug 2019 Feb 2020 192 days
karaspartyideas.com karaspartyideas.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Jan 2020 One Off
DM DM-100974 Jan 2020 Jan 2020 One Off
keralakaumudi.com keralakaumudi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 157 days
FWHL FWHL-762737 Dec 2019 Mar 2020 92 days
kffl.com kffl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Nov 2019 169 days
DM DM-100974 Jun 2019 Jun 2019 One Off
kitchenparade.com kitchenparade.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
klapboardpost.com klapboardpost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 156 days
FWHL FWHL-762737 Oct 2019 Dec 2019 64 days
kneadtocook.com kneadtocook.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 183 days
AOL AOL-49648 Oct 2019 Dec 2019 71 days
lacrossepei.ca lacrossepei.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 126 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
lazers.ca lazers.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Dec 2019 224 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
lcghl.com lcghl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
legacygt.org legacygt.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
lfcdata.co.uk lfcdata.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 98 days
SONO SONO-783272317B May 2019 Aug 2019 98 days
libertyproject.com libertyproject.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Aug 2019 51 days
SONO SONO-783272317B Jun 2019 Aug 2019 51 days
lifeabundant-blog.com lifeabundant-blog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 126 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
littleearthlingblog.com littleearthlingblog.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Dec 2019 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
livelovepasta.com livelovepasta.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
loophaiti.com loophaiti.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ltr450hq.com ltr450hq.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
luxury4play.com luxury4play.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
macdonaldhockey.ca macdonaldhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
mamavation.com mamavation.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
manalokam.com manalokam.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 152 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
manchestercity-mad.co.uk manchestercity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jun 2019 Oct 2019 113 days
mazda3revolution.com mazda3revolution.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mazdaworld.org mazdaworld.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mediotejo.net mediotejo.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 152 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
meganews.mx meganews.mx
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
melangery.com melangery.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
mercedesgleforum.com mercedesgleforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
metrotimes.com metrotimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Nov 2019 169 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
middlesbrough-mad.co.uk middlesbrough-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 229 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
migweb.co.uk migweb.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
militarytimes.com militarytimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
mixtapemonkey.com mixtapemonkey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 28 days
AVVID AVVID-7802 Aug 2019 Aug 2019 11 days
mksdrivers.com mksdrivers.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mmll.ca mmll.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Feb 2020 123 days
FWHL FWHL-762737 Aug 2019 Oct 2019 73 days
modernmom.com modernmom.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 65 days
DM DM-100974 Nov 2019 Jan 2020 65 days
moms.com moms.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
monctonminorhockey.ca monctonminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Aug 2019 Aug 2019 One Off
myaviation.net myaviation.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
mycolombianrecipes.com mycolombianrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
mydailyviral.com mydailyviral.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 310 days
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
myinnershakti.com myinnershakti.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
mylawnmowerforum.com mylawnmowerforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
naidunia.com naidunia.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 57 days
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
nevadafoodies.com nevadafoodies.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Oct 2019 62 days
AOL AOL-49648 Oct 2019 Oct 2019 14 days
newjerseyhunter.com newjerseyhunter.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
nnn88.net nnn88.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Dec 2019 One Off
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
ntnews.com ntnews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 83 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 83 days
nudaforums.com nudaforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
ohheyblog.com ohheyblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 128 days
AOL AOL-49648 Oct 2019 Dec 2019 81 days
oola.com oola.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
oswh.ca oswh.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
ouichefnetwork.com ouichefnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 128 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
riccialexis.com riccialexis.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Jan 2020 129 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
pentastars.com pentastars.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ringettepei.ca ringettepei.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 141 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
peterhead-mad.co.uk peterhead-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 224 days
AOL AOL-49648 Oct 2019 Oct 2019 One Off
phlniagara.com phlniagara.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 208 days
AOL AOL-6748 Jan 2020 Mar 2020 79 days
phpclasses.org phpclasses.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
practicalcaravan.com practicalcaravan.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 63 days
DM DM-100974 Oct 2019 Oct 2019 One Off
prcmba.ca prcmba.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Aug 2019 99 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
percolately.com percolately.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 162 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
punjabijeevansathi.in punjabijeevansathi.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Oct 2019 115 days
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
qaumiawaz.com qaumiawaz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 143 days
MEDI MEDI-8CUZ310G2 Jan 2020 Feb 2020 54 days
qunb.site qunb.site
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Jan 2020 66 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
raftaar.in raftaar.in
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 166 days
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
ram700forum.com ram700forum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
ramchargercentral.com ramchargercentral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
rangeroversport.org rangeroversport.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rap-up.com rap-up.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 Aug 2019 Aug 2019 One Off
rasfoiesc.com rasfoiesc.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 77 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
readcricket.com readcricket.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readfulham.com readfulham.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
readhuddersfield.com readhuddersfield.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readmanutd.com readmanutd.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
readtv.co readtv.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readwsl.com readwsl.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
reckontalk.com reckontalk.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 205 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
reductress.com reductress.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Feb 2020 89 days
DM DM-100974 Nov 2019 Feb 2020 89 days
rmfhl.com rmfhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 201 days
AOL AOL-6748 May 2019 Aug 2019 100 days
rollsroyceforums.com rollsroyceforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ronproject.com ronproject.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
DM DM-100974 Aug 2019 Aug 2019 One Off
achanationals.com achanationals.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Mar 2020 55 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
bostonterrierforums.com bostonterrierforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sakalsports.com sakalsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 140 days
FWHL FWHL-762737 Aug 2019 Nov 2019 63 days
sakaltimes.com sakaltimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 203 days
FWHL FWHL-762737 Nov 2019 Mar 2020 140 days
samachar.com samachar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 210 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
samacharjagat.com samacharjagat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 203 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 203 days
accringtonstanley-mad.co.uk accringtonstanley-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 207 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
artisanbreadinfive.com artisanbreadinfive.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
addtobuy.com addtobuy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
sciencealert2014.com sciencealert2014.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
scunthorpeunited-mad.co.uk scunthorpeunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Nov 2019 116 days
AOL AOL-49648 Oct 2019 Nov 2019 24 days
afrobella.com afrobella.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
sheffieldwednesday-mad.co.uk sheffieldwednesday-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jan 2020 Feb 2020 38 days
ashbridgesvolleyball.com ashbridgesvolleyball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 312 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
allfordmustangs.com allfordmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
shoppinglifestyle.com shoppinglifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
hellobarnstable.com hellobarnstable.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
allmusicals.com allmusicals.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
sify.com sify.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
am22tech.com am22tech.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 53 days
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 11 days
sixpackspeak.com sixpackspeak.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 230 days
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
slkworld.com slkworld.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
slowcookerfromscratch.com slowcookerfromscratch.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
somethingpositive.net somethingpositive.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 154 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
sparklecat.com sparklecat.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
androidheadlines.com androidheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
srtforums.com srtforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
srufc.com srufc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
stackovernet.com stackovernet.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 117 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
stackoverrun.com stackoverrun.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 117 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
astrosafari.com astrosafari.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
atabletopaffair.com atabletopaffair.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
014191.com 014191.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
125ccsportsbikes.com 125ccsportsbikes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
stourbridgefc.com stourbridgefc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 47 days
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
straightfromthea.com straightfromthea.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
stranraer-mad.co.uk stranraer-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Nov 2019 Feb 2020 102 days
stwalburghockey.com stwalburghockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Mar 2020 180 days
FWHL FWHL-762737 Aug 2019 Jan 2020 153 days
suburbanturmoil.com suburbanturmoil.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
summersideunited.com summersideunited.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 200 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
superstreetbike.com superstreetbike.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
acistampa.com acistampa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
FWHL FWHL-762769 May 2019 May 2019 One Off
aegean-travel.com aegean-travel.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
aldershottown-mad.co.uk aldershottown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 254 days
AOL AOL-49648 Jan 2020 Feb 2020 18 days
allfreecrochet.com allfreecrochet.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
swzhockey.ca swzhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 204 days
AOL AOL-6748 Jul 2019 Jul 2019 One Off
tastykitchen.com tastykitchen.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
techradar.com techradar.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
tenacityfastpitch.com tenacityfastpitch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 205 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
terraceadulthockey.ca terraceadulthockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Mar 2020 Mar 2020 One Off
autoguide.com autoguide.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
theakforum.net theakforum.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thebestdessertrecipes.com thebestdessertrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
thebigmamablog.com thebigmamablog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
thechive.com thechive.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
thecreeksidecook.com thecreeksidecook.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
thegolfnewsnet.com thegolfnewsnet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
themissusv.com themissusv.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 129 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
thepennyhoarder.com thepennyhoarder.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Jan 2020 65 days
DM DM-100974 Nov 2019 Jan 2020 65 days
therichest.com therichest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
theskinnyfork.com theskinnyfork.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
thewannabechef.net thewannabechef.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
timesnowtamil.com timesnowtamil.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 179 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
timesofoman.com timesofoman.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Nov 2019 169 days
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
tiny.cc tiny.cc
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
toptenz.net toptenz.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
DM DM-100974 Jul 2019 Jul 2019 One Off
bcbha.com bcbha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 108 days
AOL AOL-6748 Mar 2020 Mar 2020 One Off
bedequeminorhockey.com bedequeminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Jan 2020 Jan 2020 One Off
tutuapp.me tutuapp.me
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 114 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
bettyconfidential.com bettyconfidential.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
ultrasurfing.com ultrasurfing.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
bhopalsamachar.com bhopalsamachar.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
MEDI MEDI-8CUZ310G2 Sep 2019 Nov 2019 65 days
uwants.com uwants.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
birminghamcity-mad.co.uk birminghamcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 202 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
vanillajoy.com vanillajoy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
bleepingcomputer.com bleepingcomputer.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
viper5.com viper5.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wainwrightminorball.ca wainwrightminorball.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 May 2019 May 2019 One Off
wakeboardingmag.com wakeboardingmag.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jul 2019 Jul 2019 One Off
boingboing.net boingboing.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Mar 2020 124 days
AOL AOL-49648 Nov 2019 Feb 2020 89 days
bonnyvilleminorhockey.ca bonnyvilleminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 40 days
AOL AOL-6748 Nov 2019 Nov 2019 One Off
wco.tv wco.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Jan 2020 64 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
boomsbeat.com boomsbeat.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Sep 2019 56 days
boricua.com boricua.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
welcometothemousehouse.com welcometothemousehouse.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
break.com break.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
wideopenpets.com wideopenpets.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 193 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
wildandwanderful.com wildandwanderful.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
wiree.live wiree.live
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bsebportal.com bsebportal.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 114 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
wittyinthecity.com wittyinthecity.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
wokesloth.com wokesloth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
AOL AOL-6748 Sep 2019 Sep 2019 One Off
writenowcoach.com writenowcoach.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
wranglerforum.com wranglerforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
wrexham-mad.co.uk wrexham-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 260 days
AOL AOL-49648 Jan 2020 Feb 2020 27 days
business-standard.com business-standard.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
businessbru.com businessbru.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 105 days
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
buzzworthy.com buzzworthy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
caaleague.org caaleague.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
xsforums.com xsforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xtdct.com xtdct.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
xtratime.org xtratime.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yamahaforum.com yamahaforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
canveyislandfc.com canveyislandfc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
capecatfish.com capecatfish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 111 days
AOL AOL-6748 Mar 2020 Mar 2020 One Off
yeah1music.net yeah1music.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 126 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
yourdictionary.com yourdictionary.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
casebriefs.com casebriefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
cbs58.com cbs58.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
SONO SONO-783272317B Sep 2019 Mar 2020 175 days
cdmha.ca cdmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 322 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
celiacandthebeast.com celiacandthebeast.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
chargerforumz.com chargerforumz.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
cinemakuruvi.com cinemakuruvi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
cirencesterhockeyclub.co.uk cirencesterhockeyclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Jul 2019 88 days
ORC ORC-402 May 2019 May 2019 One Off
citybeat.com citybeat.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jan 2020 234 days
NEX NEX-3391 Jul 2019 Aug 2019 21 days
clasificadospl.com clasificadospl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 112 days
FWHL FWHL-762769 May 2019 May 2019 One Off
clubroadster.net clubroadster.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
clubtread.com clubtread.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
coingape.com coingape.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 59 days
PUBM PUBM-158017 Feb 2020 Mar 2020 45 days
coloradofans.com coloradofans.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
components101.com components101.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 283 days
FWHL FWHL-762737 Sep 2019 Feb 2020 130 days
corshamcc.co.uk corshamcc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 39 days
DM DM-100974 Jun 2019 Jun 2019 One Off
cosmicbook.news cosmicbook.news
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 218 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
crawleyrfc.com crawleyrfc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
cucinare.tv cucinare.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 104 days
FWHL FWHL-762769 May 2019 May 2019 One Off
cycleworld.com cycleworld.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
czattcn.com czattcn.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 66 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
dagenhamandredbridge-mad.co.uk dagenhamandredbridge-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 198 days
AOL AOL-49648 Oct 2019 Dec 2019 53 days
dailyholics.com dailyholics.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Aug 2019 Aug 2019 9 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
deeconstructed.com deeconstructed.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
derbycounty-mad.co.uk derbycounty-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 246 days
AOL AOL-49648 Oct 2019 Dec 2019 54 days
dharilo.com dharilo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
dirtrider.com dirtrider.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
dishingouthealth.com dishingouthealth.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
AOL AOL-49648 Nov 2019 Nov 2019 One Off
diycentral.com diycentral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
dodge-dart.org dodge-dart.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
doggydessertchef.com doggydessertchef.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
dogspot.in dogspot.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
doverathletic-mad.co.uk doverathletic-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 196 days
AOL AOL-49648 Oct 2019 Dec 2019 55 days
eastcoastdaily.com eastcoastdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 36 days
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
eckvilleminorhockey.com eckvilleminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
AOL AOL-6748 Dec 2019 Dec 2019 One Off
edexlive.com edexlive.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
IEX IEX-189205 Dec 2019 Dec 2019 One Off
edmhunters.com edmhunters.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Feb 2020 131 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
eisforeat.com eisforeat.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Feb 2020 Feb 2020 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
eleconomista.net eleconomista.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
FWHL FWHL-762769 May 2019 May 2019 One Off
eltiempohoy.es eltiempohoy.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
FWHL FWHL-762769 May 2019 May 2019 One Off
enpareja.com enpareja.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 221 days
FWHL FWHL-762769 May 2019 May 2019 One Off
evoxforums.com evoxforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
excellup.com excellup.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 44 days
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
favequilts.com favequilts.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
feedclub.com.br feedclub.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 168 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
fieldandstream.com fieldandstream.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
DM DM-100974 Jul 2019 Jul 2019 One Off
figandoliveplatter.com figandoliveplatter.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Feb 2020 Feb 2020 One Off
DM DM-100974 Feb 2020 Feb 2020 One Off
fightful.com fightful.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
fightmatrix.com fightmatrix.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 120 days
FWHL FWHL-762769 May 2019 May 2019 One Off
fnsflagfootball.ca fnsflagfootball.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 121 days
AOL AOL-6748 Mar 2020 Mar 2020 One Off
folkestonerugbyclub.co.uk folkestonerugbyclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 50 days
SONO SONO-783272317B May 2019 Jun 2019 45 days
foodieandthechef.com foodieandthechef.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Feb 2020 Feb 2020 One Off
fountainof30.com fountainof30.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Oct 2019 Feb 2020 126 days
freekibble.com freekibble.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Oct 2019 Jan 2020 104 days
friaryscouts.com friaryscouts.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Oct 2019 60 days
SONO SONO-783272317B Aug 2019 Oct 2019 60 days
heraldnet.com heraldnet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
fundysoccernb.com fundysoccernb.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Feb 2020 285 days
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
gasserhotrods.com gasserhotrods.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
gastronomyblog.com gastronomyblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 190 days
AOL AOL-49648 Oct 2019 Feb 2020 127 days
georgiapacking.org georgiapacking.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 175 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ghafla.com ghafla.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 100 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
gifimage.net gifimage.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 165 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
gildshire.com gildshire.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 100 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
gizbot.com gizbot.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
glamourandgiggles91.com glamourandgiggles91.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Feb 2020 65 days
DM DM-100974 Dec 2019 Feb 2020 65 days
gmcacsports.org gmcacsports.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 123 days
FWHL FWHL-762769 May 2019 May 2019 One Off
gojhl.ca gojhl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 123 days
AOL AOL-6748 Feb 2020 Feb 2020 One Off
goldenretrieverforum.com goldenretrieverforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
gpfans.com gpfans.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 130 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
grizzlyriders.com grizzlyriders.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
hancinema.net hancinema.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
happybeinghealthy.com happybeinghealthy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 189 days
AOL AOL-49648 Oct 2019 Dec 2019 64 days
happydays365.org happydays365.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 99 days
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 99 days
hawkeyenation.com hawkeyenation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloalabamausa.com helloalabamausa.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloalexandria.com helloalexandria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloaltamontesprings.com helloaltamontesprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloauburnhills.com helloauburnhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloavonlake.com helloavonlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobenicia.com hellobenicia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobeverlyhills.com hellobeverlyhills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobocaraton.com hellobocaraton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobolivia.com hellobolivia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
helloboston.com helloboston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellobrooklynpark.com hellobrooklynpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocathedral.com hellocathedral.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloclearwater.com helloclearwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocoloradospings.com hellocoloradospings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Sep 2018 One Off
GTM GTM-UA-118163407-2 Sep 2018 Sep 2018 One Off
hellocrowley.com hellocrowley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellocrownpoint.com hellocrownpoint.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodayton.com hellodayton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodesmoines.com hellodesmoines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellodyersburg.com hellodyersburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloearth.com helloearth.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 May 2019 Aug 2020 1 year, 97 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
helloelmwoodpark.com helloelmwoodpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloelyria.com helloelyria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloennis.com helloennis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloevergreenpark.com helloevergreenpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloferguson.com helloferguson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellofortcollins.com hellofortcollins.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellofrontroyal.com hellofrontroyal.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogarland.com hellogarland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogeorgia.com hellogeorgia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogolden.com hellogolden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogreensboro.com hellogreensboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogreenville.com hellogreenville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellogrenadines.com hellogrenadines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloharrisburg.com helloharrisburg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellohomerglen.com hellohomerglen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloithaca.com helloithaca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellokansascity.com hellokansascity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellokenya.com hellokenya.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Nov 2018 54 days
hellokilleen.com hellokilleen.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolakeinthehills.com hellolakeinthehills.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolakeland.com hellolakeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloleessummit.com helloleessummit.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellolewisville.com hellolewisville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Apr 2021 Apr 2021 One Off
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellolondon.com hellolondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118129358 Jun 2021 Sep 2022 1 year, 66 days
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellolynwood.com hellolynwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomadera.com hellomadera.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomandeville.com hellomandeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomanteca.com hellomanteca.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomarinette.com hellomarinette.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomassachusetts.com hellomassachusetts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellomidvale.com hellomidvale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellomoseslake.com hellomoseslake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonaples.com hellonaples.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonewhaven.com hellonewhaven.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonorris.com hellonorris.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellonorthcarolina.com hellonorthcarolina.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellonorthogden.com hellonorthogden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooakpark.com hellooakpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloorangecounty.com helloorangecounty.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellooverlandpark.com hellooverlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopainesville.com hellopainesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopalatine.com hellopalatine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopierre.com hellopierre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloplover.com helloplover.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellopomona.com hellopomona.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloportland.com helloportland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloracine.com helloracine.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloriverton.com helloriverton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellorollingmeadows.com hellorollingmeadows.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellorosemount.com hellorosemount.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellorwanda.com hellorwanda.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
CA CA-PUB-5369125237996028 Sep 2018 Sep 2018 One Off
hellosanibelisland.com hellosanibelisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosaukrapids.com hellosaukrapids.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloscarsdale.com helloscarsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosebastian.com hellosebastian.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosheboygan.com hellosheboygan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloshelbyville.com helloshelbyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosherman.com hellosherman.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosouthsaltlake.com hellosouthsaltlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellostudiocity.com hellostudiocity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosugarland.com hellosugarland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellosunlandpark.com hellosunlandpark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellotarponsprings.com hellotarponsprings.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellotaylorsville.com hellotaylorsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellotexarkana.com hellotexarkana.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellotualatin.com hellotualatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellotullahoma.com hellotullahoma.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
helloutica.com helloutica.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowhitebearlake.com hellowhitebearlake.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowoodland.com hellowoodland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hellowooster.com hellowooster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
UA UA-121239807 Aug 2020 Aug 2020 One Off
helloworcester.com helloworcester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
GTM GTM-UA-118163407-2 Sep 2018 Nov 2018 54 days
hibernian-mad.co.uk hibernian-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Oct 2019 Feb 2020 128 days
hmtvlive.com hmtvlive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 223 days
FWHL FWHL-762737 Oct 2019 Feb 2020 128 days
hockeyforum.com hockeyforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
homesicktexan.com homesicktexan.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
honest-food.net honest-food.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
hoopshype.com hoopshype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 273 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
huddersfieldtown-mad.co.uk huddersfieldtown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 125 days
AOL AOL-49648 Oct 2019 Dec 2019 65 days
huskerboard.com huskerboard.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
huskermax.com huskermax.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 186 days
hybridcars.com hybridcars.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hzxtjdz.com hzxtjdz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
icshl.org icshl.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Mar 2020 45 days
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
imgrumsite.com imgrumsite.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 161 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
indiaprofile.com indiaprofile.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
infinitiq50.org infinitiq50.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
insightcentral.net insightcentral.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
iqcolony.com iqcolony.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
iqhockey.ca iqhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 3 days
AOL AOL-6748 May 2019 May 2019 One Off
irlamvale.co.uk irlamvale.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
SONO SONO-783272317B May 2019 May 2019 One Off
islandstarshockey.ca islandstarshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Feb 2020 63 days
AOL AOL-6748 Dec 2019 Dec 2019 One Off
iwkprohockeydraft.com iwkprohockeydraft.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Mar 2020 271 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
jantakiawaz.org jantakiawaz.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 220 days
jellibeanjournals.com jellibeanjournals.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
jerusalemonline.com jerusalemonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
jobalerthindi.com jobalerthindi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 158 days
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 158 days
jobschat.in jobschat.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 94 days
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
jsclasses.org jsclasses.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 219 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
juneauempire.com juneauempire.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 59 days
FWHL FWHL-762737 Jan 2020 Mar 2020 45 days
justjennrecipes.com justjennrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
AOL AOL-49648 Nov 2019 Jan 2020 65 days
kannadaprabha.com kannadaprabha.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Jan 2020 65 days
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
kawasakimotorcycle.org kawasakimotorcycle.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
kiastonicforum.org kiastonicforum.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
kilmarnock-mad.co.uk kilmarnock-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Feb 2020 57 days
DM DM-100974 Dec 2019 Feb 2020 57 days
kitchengetaway.com kitchengetaway.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Dec 2019 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
kolkata24x7.com kolkata24x7.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 156 days
FWHL FWHL-762737 Oct 2019 Dec 2019 64 days
laptopmag.com laptopmag.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Jan 2020 Jan 2020 One Off
leedsunited-mad.co.uk leedsunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
DM DM-100974 Dec 2019 Feb 2020 55 days
leitesculinaria.com leitesculinaria.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Nov 2019 39 days
DM DM-100974 Sep 2019 Sep 2019 One Off
leoboivinshowcase.ca leoboivinshowcase.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
lessdebt.com lessdebt.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 154 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
lfg.co lfg.co
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Dec 2019 64 days
SONO SONO-783272317B Oct 2019 Dec 2019 64 days
lfgcomic.com lfgcomic.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
SONO SONO-783272317B Jan 2020 Jan 2020 One Off
livingsharp.com livingsharp.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
longislandfirearms.com longislandfirearms.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
lovetaza.com lovetaza.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Dec 2019 64 days
AOL AOL-49648 Dec 2019 Dec 2019 One Off
lovetoknow.com lovetoknow.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
lwofs.com lwofs.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
lyricsondemand.com lyricsondemand.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
NEX NEX-3391 Jun 2019 Aug 2019 69 days
maboref.ca maboref.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
macaroniandcheesecake.com macaroniandcheesecake.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Oct 2019 62 days
AOL AOL-49648 Oct 2019 Oct 2019 One Off
mahshl.com mahshl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 88 days
AOL AOL-6748 Feb 2020 Feb 2020 One Off
manchesterunited-mad.co.uk manchesterunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 180 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
mdhlmi.com mdhlmi.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 160 days
FWHL FWHL-762737 Aug 2019 Aug 2019 10 days
merchantselect.com merchantselect.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mid-day.com mid-day.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
mini2.com mini2.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
mirchi9.com mirchi9.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 311 days
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
mkcforum.com mkcforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
momentswithjenny.com momentswithjenny.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 127 days
AOL AOL-49648 Oct 2019 Oct 2019 One Off
momsrow.com momsrow.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Oct 2019 62 days
DM DM-100974 Aug 2019 Oct 2019 62 days
motherwell-mad.co.uk motherwell-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 178 days
AOL AOL-49648 Oct 2019 Feb 2020 115 days
mundodeportivo.com mundodeportivo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
musc.ca musc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Oct 2019 160 days
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
musselburghathleticfc.co.uk musselburghathleticfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
mytractorforum.com mytractorforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
DM DM-100974 Nov 2019 Nov 2019 One Off
natureworldnews.com natureworldnews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
navytimes.com navytimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Sep 2019 104 days
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
nbgha.com nbgha.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
AOL AOL-6748 Oct 2019 Oct 2019 One Off
new-delhi-hotels.com new-delhi-hotels.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
newagegto.com newagegto.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
newbeetle.org newbeetle.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
news24online.com news24online.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
newsarama.com newsarama.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jun 2019 Jun 2019 One Off
ngshockey.com ngshockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Dec 2019 65 days
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
niadd.com niadd.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 211 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
nissanclub.com nissanclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nissankicksforum.com nissankicksforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
AOL AOL-49648 Oct 2019 Oct 2019 One Off
notepad-plus-plus.org notepad-plus-plus.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 124 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
notquitesupermom.com notquitesupermom.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Dec 2019 One Off
DM DM-100974 Dec 2019 Dec 2019 One Off
novas.net novas.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nsmmaaahl.ca nsmmaaahl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
octaneforum.com octaneforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
okz.ca okz.ca
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Dec 2019 226 days
FWHL FWHL-762737 Aug 2019 Dec 2019 142 days
oldhamathletic-mad.co.uk oldhamathletic-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Dec 2019 65 days
DM DM-100974 Oct 2019 Dec 2019 65 days
ottawajr67aaa.com ottawajr67aaa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
AOL AOL-6748 Dec 2019 Dec 2019 One Off
outdoorforums.com outdoorforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
DM DM-100974 Oct 2019 Oct 2019 One Off
outdoorhub.com outdoorhub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
DM DM-100974 Jun 2019 Sep 2019 104 days
peidoctordirectory.ca peidoctordirectory.ca
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
penguinmd.com penguinmd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 183 days
peninsuladailynews.com peninsuladailynews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
phlaleagues.ca phlaleagues.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
pngimage.net pngimage.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
poshinprogress.com poshinprogress.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Jan 2020 65 days
AOL AOL-49648 Oct 2019 Oct 2019 One Off
poshlittledesigns.com poshlittledesigns.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Jan 2020 65 days
AOL AOL-49648 Jan 2020 Jan 2020 One Off
prabhasakshi.com prabhasakshi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 144 days
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
prepbaseballreport.com prepbaseballreport.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
DM DM-100974 Jul 2019 Jul 2019 One Off
psneurope.com psneurope.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
pupcity.com pupcity.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
AOL AOL-49648 Nov 2019 Nov 2019 One Off
queenofthesouth-mad.co.uk queenofthesouth-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 223 days
AOL AOL-49648 Oct 2019 Jan 2020 86 days
queensparkrangers-mad.co.uk queensparkrangers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 223 days
AOL AOL-49648 Jan 2020 Feb 2020 42 days
radioworld.com radioworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Nov 2019 121 days
DM DM-100974 Jul 2019 Sep 2019 56 days
rajasthankhabre.com rajasthankhabre.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 206 days
FWHL FWHL-762737 Oct 2019 Mar 2020 142 days
ratforum.com ratforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
readastonvilla.com readastonvilla.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 May 2019 One Off
readbasketball.com readbasketball.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readburnley.com readburnley.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
readcardiff.com readcardiff.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 99 days
DM DM-100974 May 2019 Aug 2019 99 days
readfilm.co readfilm.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readlaliga.com readlaliga.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Jul 2019 47 days
readliverpoolfc.com readliverpoolfc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 Aug 2019 99 days
readmiddlesbrough.com readmiddlesbrough.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 99 days
SONO SONO-783272317B May 2019 May 2019 One Off
realitypod.com realitypod.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
recipechatter.com recipechatter.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 56 days
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
record.com.mx record.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 59 days
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
redouxinteriors.com redouxinteriors.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
AOL AOL-49648 Oct 2019 Nov 2019 39 days
reellifewithjane.com reellifewithjane.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Jan 2020 One Off
DM DM-100974 Jan 2020 Jan 2020 One Off
referatele.com referatele.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 205 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
footymad.net footymad.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
AOL AOL-49648 Oct 2019 Feb 2020 128 days
repairmymobile.in repairmymobile.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 76 days
IEX IEX-189205 Dec 2019 Dec 2019 One Off
rmev.cn rmev.cn
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Nov 2019 63 days
rochesterrams.org rochesterrams.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rock967online.com rock967online.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
romewolvesathletics.com romewolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
aberystwythleague.co.uk aberystwythleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 32 days
rollingstone.com rollingstone.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Mar 2020 245 days
achahockey.org achahockey.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Mar 2020 110 days
achhikhabar.com achhikhabar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 55 days
rotter.net rotter.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
acpathletics.com acpathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
actionsportstoday.com actionsportstoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jan 2020 235 days
acadianapostgame.com acadianapostgame.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
rubiconownersforum.com rubiconownersforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rumbunter.com rumbunter.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
ruathletics.com ruathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rushthecourt.net rushthecourt.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
russellvilleathletics.com russellvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rvathletics.com rvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
saladoeaglenation.org saladoeaglenation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
salemathletics.com salemathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
salemathletics.org salemathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
samandfuzzy.com samandfuzzy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
arcamax.com arcamax.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Nov 2019 Jan 2020 65 days
advancedsportsmedia.com advancedsportsmedia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 120 days
santabanta.com santabanta.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Mar 2020 175 days
archauthority.com archauthority.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
saveig.org saveig.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
saskatoontouchfootball.com saskatoontouchfootball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
savingcountrymusic.com savingcountrymusic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sci-techmaven.io sci-techmaven.io
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
scoopduck.com scoopduck.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
scottbulldogs.org scottbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
scseaglenation.com scseaglenation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
secretui.com secretui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 302 days
seattlepi.com seattlepi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
aiyinsitanblog.ml aiyinsitanblog.ml
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Nov 2019 105 days
sedmha.com sedmha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
sepiratesathletics.com sepiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sfasawmill.com sfasawmill.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
alaskabaseballleague.org alaskabaseballleague.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
alaskafromscratch.com alaskafromscratch.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
shabiba.com shabiba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 163 days
alugha.com alugha.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
allfreecopycatrecipes.com allfreecopycatrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allfreesewing.com allfreesewing.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allthetests.com allthetests.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
allthingsbeautifulxo.com allthingsbeautifulxo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
allucanheat.com allucanheat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
sidexsideworld.com sidexsideworld.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
sicem365.com sicem365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
simplemomreview.com simplemomreview.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 129 days
sircharlesincharge.com sircharlesincharge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
sjraidersathletics.com sjraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ans-wer.com ans-wer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 59 days
skyroadster.com skyroadster.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
armtv.org armtv.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 118 days
skywayshoutout.com skywayshoutout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
anfieldleague.co.uk anfieldleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 204 days
slwceaglenationathletics.com slwceaglenationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
smll.ca smll.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Jan 2020 One Off
smnwcougars.com smnwcougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
snakkle.com snakkle.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
snowmobileworld.com snowmobileworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
soapoperadigest.com soapoperadigest.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
soaringtoglory.com soaringtoglory.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
sojo1049.com sojo1049.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
sonichits.com sonichits.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
soobluedevils.com soobluedevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
soy502.com soy502.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 87 days
soycarmin.com soycarmin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 23 days
spartanation300.com spartanation300.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
spartanavenue.com spartanavenue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
speypages.com speypages.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
spnhunters.com spnhunters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 87 days
spoiledmaltese.com spoiledmaltese.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
sportressofblogitude.com sportressofblogitude.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
sportsradio1250.com sportsradio1250.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
springlakeathletics.com springlakeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
spudnet.co spudnet.co
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sputnamathletics.com sputnamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sscportal.in sscportal.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 71 days
artfullywed.com artfullywed.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
staffordshirecsl.co.uk staffordshirecsl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 100 days
012965.com 012965.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
1039thebreezealbany.com 1039thebreezealbany.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
103wjod.com 103wjod.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stcharlessports.com stcharlessports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
10thtyper.com 10thtyper.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
stlyrics.com stlyrics.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
stmirren-mad.co.uk stmirren-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 165 days
stockholmexpat.com stockholmexpat.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 63 days
stockpilingmoms.com stockpilingmoms.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
stokecity-mad.co.uk stokecity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 218 days
stormininnorman.com stormininnorman.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
strettynews.com strettynews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
stripehype.com stripehype.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
aahj.top aahj.top
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
aakc.top aakc.top
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
stvmathletics.com stvmathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
abplive.com abplive.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 12 days
aciprensa.com aciprensa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
suitlandathletics.com suitlandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
adjfa.org.uk adjfa.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 268 days
sundreminorhockey.ca sundreminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Jan 2020 One Off
summerfieldathletics.com summerfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
supermotojunkie.com supermotojunkie.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
supernummy.com supernummy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 66 days
alternateuni.com alternateuni.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
swagvilla.com swagvilla.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
svcardinals.com svcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
svhsathletics.org svhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ask.com ask.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
tailieu.vn tailieu.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
taftathletics.com taftathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
taftraiderathletics.com taftraiderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
takmp3.com takmp3.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
astrologyanswers.com astrologyanswers.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
taylortitansathletics.com taylortitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
technipages.com technipages.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
techienewsnetwork.com techienewsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tecumsehathletics.com tecumsehathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
teennovels.net teennovels.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 100 days
telva.com telva.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
templetonlife.com templetonlife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Jul 2019 48 days
tfln.co tfln.co
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Jan 2020 One Off
tfpdl.live tfpdl.live
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tfpdl.pw tfpdl.pw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tfpdl.to tfpdl.to
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
awimb.com awimb.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 252 days
theboxhouston.com theboxhouston.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
thedieselgarage.com thedieselgarage.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thecanuckway.com thecanuckway.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
theclemsoninsider.com theclemsoninsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
theclintonjournal.com theclintonjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Mar 2020 44 days
azhimukham.com azhimukham.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
thelandryhat.com thelandryhat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
babygaga.com babygaga.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
thescooterreview.com thescooterreview.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
theshubox.com theshubox.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
thesportster.com thesportster.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
thestokesnews.com thestokesnews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Nov 2019 65 days
thethao247.vn thethao247.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
ballparksofbaseball.com ballparksofbaseball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
thsathletics.org thsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bamsmackpow.com bamsmackpow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
bandamax.tv bandamax.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
tigardtigers.com tigardtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tigerbait.com tigerbait.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tikout.com tikout.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
tips-and-tricks.co tips-and-tricks.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 Aug 2019 75 days
tiptonathletics.com tiptonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tinthethao.com.vn tinthethao.com.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tintucbaomoi.net tintucbaomoi.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tlhannasports.com tlhannasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bathcountyathletics.com bathcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tolucalabellacd.com tolucalabellacd.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
bayart.org bayart.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 50 days
baycitywesternathletics.com baycitywesternathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
topclassactions.com topclassactions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
total49ers.com total49ers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalbig12.com totalbig12.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalbulls.com totalbulls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totaldallascowboys.com totaldallascowboys.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totaldevils.com totaldevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalmonarchs.com totalmonarchs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalnewswire.com totalnewswire.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
totalredsox.com totalredsox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalsox.com totalsox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalutahjazz.com totalutahjazz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
beatingbroke.com beatingbroke.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
beinsports.com beinsports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 106 days
trojanpride.net trojanpride.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
trx250r.net trx250r.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
benzforum.com benzforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
benzinga.com benzinga.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tsmdev1.com tsmdev1.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tsmdev3.com tsmdev3.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
berkeleystagsathletics.com berkeleystagsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bermudatriplecrown.com bermudatriplecrown.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bersapistolforum.com bersapistolforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tutsmake.com tutsmake.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
tvhsgoldenbearathletics.com tvhsgoldenbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tvlia.com tvlia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 179 days
tvplayer.com tvplayer.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
bestofthislife.com bestofthislife.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
tvseriesfinale.com tvseriesfinale.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
twolvesathletics.com twolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
beyondblackwhite.com beyondblackwhite.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
bglancers.com bglancers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
uhstitansathletics.com uhstitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
uintacountyherald.com uintacountyherald.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
bhssports.com bhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bia2.tv bia2.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
unicable.tv unicable.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
uni-watch.com uni-watch.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
bigfrog104.com bigfrog104.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
uniondailytimes.com uniondailytimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
bikez.info bikez.info
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
unpuzzlefinance.com unpuzzlefinance.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 131 days
uprepathletics.net uprepathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
uptotheminutemen.com uptotheminutemen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 158 days
usssalive.com usssalive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
birdsandblooms.com birdsandblooms.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
vacation101.com vacation101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
bitrixc.info bitrixc.info
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
bizcritics.com bizcritics.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
vandaliabutlerathletics.com vandaliabutlerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bladesofteal.com bladesofteal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
vegashockeyknight.com vegashockeyknight.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 159 days
veggieboards.com veggieboards.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
blic.rs blic.rs
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
vfathletics.com vfathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
vgchartz.com vgchartz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
victorybellrings.com victorybellrings.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
vikingforum.net vikingforum.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
blognife.com blognife.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 8 days
vnexpress.net vnexpress.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
bmw-driver.net bmw-driver.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bobcatattack.com bobcatattack.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
volusiariders.com volusiariders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gunblog.com gunblog.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
vrwolvesathletics.com vrwolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
vwupforums.com vwupforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
vuighe.net vuighe.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 17 days
vultusforum.com vultusforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
boltonwanderers-mad.co.uk boltonwanderers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
waggenerathletics.com waggenerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
waldronathletics.com waldronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bongda24h.vn bongda24h.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
wammnation.com wammnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wapahaniathletics.com wapahaniathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wasatchhighathletics.com wasatchhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wbathletics.org wbathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bossip.com bossip.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wbir.com wbir.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
wchram.com wchram.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wauseonsports.org wauseonsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bouldercityathletics.com bouldercityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
weareauburndaleathletics.com weareauburndaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
weartesters.com weartesters.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
boxofficebuz.com boxofficebuz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 44 days
bradybulldogs.com bradybulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
brainfall.com brainfall.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
brewersfriend.com brewersfriend.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bridgendanddistrictsfl.co.uk bridgendanddistrictsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 274 days
westashleyathletics.org westashleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wghathletics.org wghathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wgrz.com wgrz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
wheatfieldblades.com wheatfieldblades.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Jan 2020 One Off
whodoyouthinkyouarelive.com whodoyouthinkyouarelive.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
wikiholics.com wikiholics.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 63 days
wildcatbluenation.com wildcatbluenation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
bsmf.ca bsmf.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 171 days
wimp.com wimp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
winamacathletics.com winamacathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
btimesonline.com btimesonline.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 48 days
wisconsinmommy.com wisconsinmommy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
wittyfeed.tv wittyfeed.tv
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
wittylady.com wittylady.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 63 days
wizardsandwhatnot.com wizardsandwhatnot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
wizofawes.com wizofawes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
wjbq.com wjbq.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
buffalowdown.com buffalowdown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
wkyc.com wkyc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
wlathletics.com wlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wmcsports.org wmcsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wnbf.com wnbf.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wnhsathletics.com wnhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wokq.com wokq.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
woodburnbulldogs.com woodburnbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
woodhavenathletics.com woodhavenathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
burlingameathletics.com burlingameathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
worldwideinterweb.com worldwideinterweb.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jan 2020 234 days
wossmanwildcatsathletics.com wossmanwildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wowbiz.ro wowbiz.ro
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
wowinterface.com wowinterface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
wranglerjlforum.com wranglerjlforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wranglerpickupforum.com wranglerpickupforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
writingillini.com writingillini.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
wrrv.com wrrv.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wtbdfm.com wtbdfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
wuhanshengqiao.com wuhanshengqiao.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Sep 2019 One Off
wtol.com wtol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 32 days
bvathletics.net bvathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cacavaliers.com cacavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wythemaroons.org wythemaroons.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
xaluan.net xaluan.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 16 days
xbad.info xbad.info
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
cajathletics.com cajathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
xcyjb.com xcyjb.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Mar 2020 47 days
xeniaathletics.com xeniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gunhub.com gunhub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
camaros.net camaros.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
xlm338.com xlm338.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
gunnathletics.com gunnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
xrv.org.uk xrv.org.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
xsport.ua xsport.ua
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
xxiuw.com xxiuw.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
canyonathletics.org canyonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
yabo0990.com yabo0990.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
yallalive.tv yallalive.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
yamaha-forum.net yamaha-forum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yamahar25.org yamahar25.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
yasss.es yasss.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
cardiffcity-mad.co.uk cardiffcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 249 days
yeoviltown-mad.co.uk yeoviltown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
yettisays.com yettisays.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
ygoprodeck.com ygoprodeck.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jan 2020 233 days
ynetnews.com ynetnews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
youandyourwedding.co.uk youandyourwedding.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
youlike89.com youlike89.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
catcountry1029.com catcountry1029.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
ythrhome.com ythrhome.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
cbr250.net cbr250.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
cbs8.com cbs8.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
cccsathletics.com cccsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
yzmnfbz.xyz yzmnfbz.xyz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
zasterr.com zasterr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
cedargroveathletics.com cedargroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
zeelandeastsports.com zeelandeastsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
celebrityz.xyz celebrityz.xyz
Attribute Value First Detected Last Detected Overlap Duration
ORC ORC-402 May 2019 May 2019 One Off
centervilleelkathletics.com centervilleelkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
zhaobf.cn zhaobf.cn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
zhiphopcleveland.com zhiphopcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
zoffar.com zoffar.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
zmescience.com zmescience.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
chine-nouvelle.com chine-nouvelle.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rt.com rt.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 244 days
chschieftains.com chschieftains.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chscoyotes.org chscoyotes.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chsreddevils.com chsreddevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chswarriors.org chswarriors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chumplady.com chumplady.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 130 days
ciceroprepathletics.com ciceroprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cjrono24.com cjrono24.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
classical-music.com classical-music.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
classicrock961.com classicrock961.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
clonesconfidential.com clonesconfidential.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
cltampa.com cltampa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Nov 2019 121 days
club937.com club937.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
clubfrontier.org clubfrontier.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clumberpark.cc clumberpark.cc
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
clyde-mad.co.uk clyde-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 199 days
concealednation.org concealednation.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
confessionsofachocoholic.com confessionsofachocoholic.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
connectionstrings.com connectionstrings.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
convenientaf.com convenientaf.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
convert-me.com convert-me.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
cookingfromheart.com cookingfromheart.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 130 days
craftpaperscissors.com craftpaperscissors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
crash.net crash.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
creativeplanetnetwork.com creativeplanetnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Jan 2020 130 days
crockathletics.com crockathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
crossingbroad.com crossingbroad.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
crriverhawks.com crriverhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
culinarykitchenchicago.com culinarykitchenchicago.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 147 days
curiosity.com curiosity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
cvathletics.org cvathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cwncathletics.org cwncathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cyclonesacademy.com cyclonesacademy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
cyka.cn cyka.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Dec 2019 One Off
dalevillesports.com dalevillesports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
daringwomaninc.com daringwomaninc.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
dbzgames.org dbzgames.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
dchawks.com dchawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dctigersathletics.com dctigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ddd6699.com ddd6699.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
decibo.com decibo.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
deliciousmagazine.co.uk deliciousmagazine.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
derbyathletics.com derbyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
designyourway.net designyourway.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
dewtour.com dewtour.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
dfa-ifleague.co.uk dfa-ifleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 280 days
digitalcorvettes.com digitalcorvettes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
directexpose.com directexpose.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Jun 2019 One Off
diredota.com diredota.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Feb 2020 66 days
djcup.ca djcup.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Dec 2019 124 days
dmbha.com dmbha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
dobberprospects.com dobberprospects.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 172 days
dodgetalk.com dodgetalk.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
doramatv.live doramatv.live
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
downeastthunderfarm.com downeastthunderfarm.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
downersgroveathletics.com downersgroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dpsdunbarathletics.com dpsdunbarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
draftthreads.com draftthreads.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
dramha.com dramha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
driveaccord.net driveaccord.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
drstephaniesmith.com drstephaniesmith.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
dsvenetta.net dsvenetta.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
ducatifighter.com ducatifighter.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
duckhuntingchat.com duckhuntingchat.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
dumbbell-exercises.com dumbbell-exercises.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
dundeerugby.co.uk dundeerugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
dundurnminorhockey.ca dundurnminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
durhamwestjr.com durhamwestjr.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
eathealthyeathappy.com eathealthyeathappy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
ebonybird.com ebonybird.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
ecardsforfriends.com ecardsforfriends.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
ecetia.com ecetia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 4 days
eclecticesoterica.com eclecticesoterica.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
ecvbraves.com ecvbraves.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
edhspanthers.com edhspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
egotastic.com egotastic.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 234 days
ehhsathletics.com ehhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eksiup.com eksiup.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 40 days
eleconomistaamerica.com eleconomistaamerica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
eleconomistaamerica.pe eleconomistaamerica.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
elginwildcatathletics.com elginwildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ellisonathletics.com ellisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eltoroathletics.com eltoroathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
emeraldathletics.com emeraldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
energytv.es energytv.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 103 days
entrepreneur.com entrepreneur.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 110 days
eplfootballmatch.com eplfootballmatch.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
ericafinds.com ericafinds.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
esportsgags.com esportsgags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
etfchannel.com etfchannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
evansvilleharrisonathletics.com evansvilleharrisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
exetercity-mad.co.uk exetercity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 243 days
explosm.net explosm.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 110 days
expreso.ec expreso.ec
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
extracine.com extracine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
fadeawayworld.com fadeawayworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Dec 2019 124 days
fanspeak.com fanspeak.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
fantasyrundown.com fantasyrundown.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
fascinately.com fascinately.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
faustisland.com faustisland.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 One Off
favehealthyrecipes.com favehealthyrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
fcmustangs.com fcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fearthestingihs.org fearthestingihs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fgrirish.com fgrirish.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fhsindians.com fhsindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fiestafaction.com fiestafaction.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
fightingzebrasports.com fightingzebrasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fitness-singles.com fitness-singles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
flyfishingforum.com flyfishingforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
foleyathletics.com foleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
foodfromportugal.com foodfromportugal.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
fordescape.org fordescape.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
forumblueandgold.com forumblueandgold.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
freegameempire.com freegameempire.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
frozenfutures.com frozenfutures.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
fulham-mad.co.uk fulham-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 241 days
fulltimefantasy.com fulltimefantasy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 320 days
fulltvshows.org fulltvshows.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
funnelmojo.com funnelmojo.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
gainesvilleredelephantathletics.com gainesvilleredelephantathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gameranx.com gameranx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
ganeshagiantsathletics.com ganeshagiantsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gardenguides.com gardenguides.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
garnetandcocky.com garnetandcocky.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 122 days
gatorforums.net gatorforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gavitathletics.com gavitathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gchsgreyhounds.com gchsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gechnas.ru gechnas.ru
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Oct 2019 One Off
geekextreme.com geekextreme.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
geeky-gadgets.com geeky-gadgets.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 175 days
gemequityinc.com gemequityinc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
mhs-mavericks.com mhs-mavericks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ghsgladiators.com ghsgladiators.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ghslancers.org ghslancers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ghsvikings.com ghsvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gifcrib.com gifcrib.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
girardindians.org girardindians.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gjhssports.com gjhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
glamsham.com glamsham.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
glasgowcollegesfa.co.uk glasgowcollegesfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 286 days
glencoeathletics.com glencoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gmtoday.com gmtoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goaustinhighathletics.com goaustinhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goballardbruins.com goballardbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocatsgo.org gocatsgo.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocentennialathletics.com gocentennialathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocometsathletics.com gocometsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goghsreddevils.com goghsreddevils.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gohealthinsurane.com gohealthinsurane.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
gohebronathletics.com gohebronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goheightsbulldogs.com goheightsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gohutchathletics.com gohutchathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gojoebruin.com gojoebruin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
golancerssports.com golancerssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goldderby.com goldderby.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
goldenknightshockey.org goldenknightshockey.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
gomarshallredhawks.com gomarshallredhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gomeritknights.com gomeritknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gomilbybuffs.com gomilbybuffs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gondolierathletics.com gondolierathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gonmbchiefs.com gonmbchiefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gonwtigers.com gonwtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mhsbluedevilnation.com mhsbluedevilnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gopatriotpride.com gopatriotpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gophhsathletics.com gophhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goramsathletics.com goramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gorangerathletics.com gorangerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gorocketsathletics.com gorocketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goschscougars.com goschscougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goscorpionsports.com goscorpionsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gosheneagles.com gosheneagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goshermanbearcats.com goshermanbearcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gotechtigers.com gotechtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gouctigers.com gouctigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gowildcatsports.com gowildcatsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
grcathletics.com grcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
greenwichtime.com greenwichtime.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
gujaratimidday.com gujaratimidday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 224 days
halewoodsummerleague2019.co.uk halewoodsummerleague2019.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Oct 2019 110 days
halohangout.com halohangout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
hamiltonacademical-mad.co.uk hamiltonacademical-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
hamiltonminorhockey.com hamiltonminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
handgunforum.net handgunforum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
handlebay.com handlebay.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
hardawayathletics.com hardawayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hawkathletics.net hawkathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hdbeachcams.com hdbeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
headcramp.com headcramp.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloalton.com helloalton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloanniston.com helloanniston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellobangor.com hellobangor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellobelton.com hellobelton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloburton.com helloburton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellocenterville.com hellocenterville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloclarksdale.com helloclarksdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocompton.com hellocompton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloelcajon.com helloelcajon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloelmira.com helloelmira.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloevans.com helloevans.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellofridley.com hellofridley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogarner.com hellogarner.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellograndville.com hellograndville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellogreer.com hellogreer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogulfport.com hellogulfport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohazelwood.com hellohazelwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellohazleton.com hellohazleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohendersonville.com hellohendersonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellojapan.com hellojapan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
hellojonesboro.com hellojonesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellokaysville.com hellokaysville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellokearney.com hellokearney.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomokena.com hellomokena.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomustang.com hellomustang.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellonorthlauderdale.com hellonorthlauderdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellooakparkvillage.com hellooakparkvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopasorobles.com hellopasorobles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopearland.com hellopearland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopleasanton.com hellopleasanton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloramsey.com helloramsey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellorobbinsdale.com hellorobbinsdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellorockledge.com hellorockledge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloroselle.com helloroselle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosachse.com hellosachse.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosaintbarts.com hellosaintbarts.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosaintcroix.com hellosaintcroix.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
hellosanger.com hellosanger.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosaudiarabia.com hellosaudiarabia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloscandinavia.com helloscandinavia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
hellosolon.com hellosolon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosouthholland.com hellosouthholland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosudbury.com hellosudbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotallmadge.com hellotallmadge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellothornton.com hellothornton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotifton.com hellotifton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotooele.com hellotooele.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloturkey.com helloturkey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellounitedarabemirates.com hellounitedarabemirates.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellovacaville.com hellovacaville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellovaticancity.com hellovaticancity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
helloventura.com helloventura.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellovineland.com hellovineland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellovirginislands.com hellovirginislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
hellowaterbury.com hellowaterbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellowestspringfield.com hellowestspringfield.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowilmington.com hellowilmington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowoodbury.com hellowoodbury.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloworthington.com helloworthington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
heraldathletics.com heraldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hfathletics.com hfathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hhringette.ca hhringette.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
hhspatriots.org hhspatriots.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hiddenremote.com hiddenremote.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
hiepsiduongpho.net hiepsiduongpho.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
hillsboroathletics.org hillsboroathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hiperdef.com hiperdef.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 163 days
history101.com history101.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 May 2019 One Off
hitchcockbulldogs.org hitchcockbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hitched.ca hitched.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hondaatvforums.net hondaatvforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hondacb1000r.com hondacb1000r.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
hondaforeman.com hondaforeman.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
hondagrom.net hondagrom.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
hondaownersclubs.com hondaownersclubs.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
hondarebelforum.com hondarebelforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
hormonejungle.com hormonejungle.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jrhsathletics.com jrhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
horoscopo.com horoscopo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
hot1047.com hot1047.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
hotspurhq.com hotspurhq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
hoy.com.do hoy.com.do
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
htcradarforum.net htcradarforum.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
huashengblg.com huashengblg.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 64 days
hudsonexplorersathletics.com hudsonexplorersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hurontigerathletics.com hurontigerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hvlathletics.com hvlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ibtimes.com ibtimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
idotaketwo.com idotaketwo.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
igardenplanting.com igardenplanting.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
ilovemy5kids.com ilovemy5kids.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 62 days
imagenescool.com imagenescool.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 64 days
indgovtjobs.in indgovtjobs.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Dec 2019 64 days
indianmotorcycles.net indianmotorcycles.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
infinitiqx80.org infinitiqx80.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
inflationdata.com inflationdata.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
inkonindy.com inkonindy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
inquisitr.com inquisitr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 186 days
insideibrox.com insideibrox.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 191 days
islanderathletics.com islanderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
iwastesomuchmoney.com iwastesomuchmoney.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
jamcarclub.com jamcarclub.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
jamilakyari.com jamilakyari.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
jasperathletics.com jasperathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jeffersonbluejays.com jeffersonbluejays.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jenisonathletics.com jenisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
joelamontagne.com joelamontagne.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
johnmarshallathletics.com johnmarshallathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
joneshighathletics.com joneshighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
joshreads.com joshreads.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jourdantonathletics.com jourdantonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
journalstar.com journalstar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
juksy.me juksy.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 61 days
junebugweddings.com junebugweddings.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
justarsenal.com justarsenal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
jvhsjaguars.com jvhsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kacsathletics.com kacsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kalamazoocountry.com kalamazoocountry.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kamloopsballhockey.com kamloopsballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
kardashiandish.com kardashiandish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Feb 2020 125 days
kcbsnewsradio.com kcbsnewsradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
kfx450central.com kfx450central.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
kgha.ca kgha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Aug 2019 51 days
kgw.com kgw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 6 days
khmoradio.com khmoradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kikn.com kikn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kipptexas-sanantonioathletics.com kipptexas-sanantonioathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kiss4d.com kiss4d.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
kissfm.cat kissfm.cat
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
kissfm.es kissfm.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
kitchencookbook.net kitchencookbook.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Dec 2019 One Off
kltigersrfc.com kltigersrfc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
kmmountaineers.com kmmountaineers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
knighthawksathletics.com knighthawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kodiakowners.com kodiakowners.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
kongregate.com kongregate.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kool1017.com kool1017.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kroc.com kroc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
ksjcathletics.com ksjcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kto-chto-gde.ru kto-chto-gde.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 91 days
kvhsathletics.com kvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kvue.com kvue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
lagaceta.com.ar lagaceta.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
raisingzona.com raisingzona.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
laisureste.com laisureste.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
lajkar.se lajkar.se
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
lamusica.com lamusica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
lanacion.com.ar lanacion.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 7 days
laopinion.com.co laopinion.com.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 30 days
lbpolyathletics.com lbpolyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lcctbirdsports.com lcctbirdsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lebanon-express.com lebanon-express.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
leedavisathletics.com leedavisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
leegeneralsathletics.com leegeneralsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lehiathletics.com lehiathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
letrasmania.com letrasmania.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 58 days
letrasweb.com.br letrasweb.com.br
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
letsthinkeasy.com letsthinkeasy.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 90 days
lexusfforum.com lexusfforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
lghsathletics.com lghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
miaminewtimes.com miaminewtimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 121 days
lincolnprepathletics.com lincolnprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
littlefiggy.com littlefiggy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 127 days
lizzieinlace.com lizzieinlace.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
lmhatournament.com lmhatournament.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 89 days
lnka.tw lnka.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
logiastarata.gr logiastarata.gr
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Feb 2020 124 days
lombardiave.com lombardiave.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
lonestar995fm.com lonestar995fm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
losaltosathletics.org losaltosathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
losaltossports.com losaltossports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lotrointerface.com lotrointerface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 231 days
lrathletics.org lrathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lrgarden.cn lrgarden.cn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 29 days
luathletics.org luathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
luvtobnatural.com luvtobnatural.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Oct 2019 62 days
lvyuanzl.com lvyuanzl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Feb 2020 53 days
macclesfieldtown-mad.co.uk macclesfieldtown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 53 days
madeformums.com madeformums.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
magnumforumz.com magnumforumz.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
makingmemorieswithyourkids.com makingmemorieswithyourkids.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
makingtheworldcuter.com makingtheworldcuter.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
maraudersathletics.com maraudersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mashable.com mashable.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
matadorathletics.org matadorathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
matchendirect.fr matchendirect.fr
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 312 days
mazda2forums.com mazda2forums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
mbbuccaneers.com mbbuccaneers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mbuk.com mbuk.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
mcaathletics.com mcaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mcamustangsathletics.org mcamustangsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mccallumknightsnation.com mccallumknightsnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mckinleyathletics.org mckinleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mdzol.com mdzol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
meadowbrookathletics.com meadowbrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
helloatlanta.com media1.helloatlanta.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 Aug 2020 Aug 2020 One Off
medinaathletics.com medinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
memorialhsathletics.com memorialhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mendotareporter.com mendotareporter.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jan 2020 234 days
menscrown.com menscrown.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
metsmerizedonline.com metsmerizedonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
midsouthhockey.com midsouthhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Mar 2020 87 days
mitsubishi-forums.com mitsubishi-forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mixedarticle.com mixedarticle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 86 days
mjsportszone.com mjsportszone.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mmatorch.com mmatorch.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
mmhl.ca mmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
modeliiiforum.com modeliiiforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
modeltrainforum.com modeltrainforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
molliemakes.com molliemakes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
mom365.com mom365.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
mondayismeatloaf.com mondayismeatloaf.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
moneyintern.com moneyintern.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 86 days
morelikehome.net morelikehome.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 66 days
mountainhouseathletics.com mountainhouseathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
movie-moron.com movie-moron.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
mpsctoday.com mpsctoday.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
mqtathletics.com mqtathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mtgsideboard.com mtgsideboard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 196 days
mudinmyblood.net mudinmyblood.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
muscatinejournal.com muscatinejournal.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
musipedia.org musipedia.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 59 days
musketeersathletics.com musketeersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mvjaguars.com mvjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mwerks.com mwerks.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
mwhswildcats.com mwhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mybaltimorespirit.com mybaltimorespirit.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mycolumbuspower.com mycolumbuspower.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mydomesticchurch.com mydomesticchurch.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
mylearningtable.com mylearningtable.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 127 days
mymmanews.com mymmanews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
myspiritdc.com myspiritdc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mysticscripts.com mysticscripts.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
mystylevita.com mystylevita.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
myxperiaplay.com myxperiaplay.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
naeagles.com naeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
naibuzz.com naibuzz.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
national-preservation.com national-preservation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
nationalenquirer.com nationalenquirer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
nbbaysox.com nbbaysox.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
nchsathletics.com nchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ncwhsathletics.com ncwhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ndhl.ca ndhl.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
nertazw.com nertazw.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
netflixlife.com netflixlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
new-educ.com new-educ.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 27 days
newbgame.com newbgame.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 57 days
newninja.com newninja.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
newschoolers.com newschoolers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 175 days
ram1500diesel.com ram1500diesel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
newsmax.com newsmax.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ramblinfan.com ramblinfan.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
ramsayramsathletics.com ramsayramsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nhknightshockey.com nhknightshockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
nhseagleathletics.com nhseagleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nissancubelife.com nissancubelife.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
njbeachcams.com njbeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 278 days
njspathletics.com njspathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nlaeagles.org nlaeagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nocartridge.com nocartridge.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 141 days
range365.com range365.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
rangersmajorbantam.com rangersmajorbantam.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
northbankrsl.com northbankrsl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 141 days
northfieldathletics.com northfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
northwestathletics.org northwestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nphsathletics.org nphsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nsfll.ca nsfll.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
nsjhl.ca nsjhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
nssll.ca nssll.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 198 days
nswings.net nswings.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
nuviewbridgeathletics.com nuviewbridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oaathletics.org oaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oakmountainathletics.org oakmountainathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oakridgeathletics.com oakridgeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
obozrevatel.com obozrevatel.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Nov 2019 100 days
oddcup.com oddcup.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ohztv.com ohztv.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
olaathletics.com olaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oldmillathletics.com oldmillathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
olivemagazine.com olivemagazine.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
omg-daily.com omg-daily.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Dec 2019 One Off
online-knigi.com online-knigi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
onlyoneheidi.com onlyoneheidi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 128 days
orangeintheoven.com orangeintheoven.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
oregoncityschoolsathletics.org oregoncityschoolsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oremhighathletics.com oremhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
orhc.ca orhc.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Oct 2019 One Off
otowns11.com otowns11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
owlsathletics.org owlsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pacerathletics.org pacerathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
paddymcguinnessbingo.uk paddymcguinnessbingo.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Feb 2020 Feb 2020 One Off
parolesmania.com parolesmania.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
pasoroblespress.com pasoroblespress.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Sep 2019 103 days
patriotproud.net patriotproud.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pay-box.in pay-box.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Jan 2020 65 days
pcmha.com pcmha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 128 days
pcspacers.com pcspacers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pensacolafishingforum.com pensacolafishingforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rebelstrue.com rebelstrue.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
perfdrive.com perfdrive.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
phhspatriotpride.com phhspatriotpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
phinphanatic.com phinphanatic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
phnhuskies.com phnhuskies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
phpatriots.net phpatriots.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
phswarriors.com phswarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
piedmontwildcatsathletics.com piedmontwildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pierandsurf.com pierandsurf.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
pikesvilleathletics.com pikesvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pikstagram.net pikstagram.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
piquaindiansathletics.org piquaindiansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
piratesnation.org piratesnation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pleasantgrovevikings.com pleasantgrovevikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pmhsfalcons.com pmhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
polarisfiles.com polarisfiles.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
ponyfans.com ponyfans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
popeathletics.com popeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
popxo.com popxo.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Jan 2020 65 days
porkandhops.com porkandhops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
prepvolleyball.com prepvolleyball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 278 days
pricepanda.com.my pricepanda.com.my
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 271 days
proceso.com.mx proceso.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 81 days
prosoundnetwork.com prosoundnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jan 2020 Mar 2020 45 days
prowrestling.net prowrestling.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 231 days
puckettspond.com puckettspond.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
pucksandpitchforks.com pucksandpitchforks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
pwinsider.com pwinsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
qchsathletics.com qchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
quattroworld.com quattroworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
questionablecontent.net questionablecontent.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
quizpeek.com quizpeek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 143 days
redbankathletics.com redbankathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
reddeerrollerhockey.com reddeerrollerhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
reellifewithjane.net reellifewithjane.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
reeserocketsathletics.com reeserocketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
register-pajaronian.com register-pajaronian.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
registercitizen.com registercitizen.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
reptileforums.co.uk reptileforums.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
retrievertraining.net retrievertraining.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
rexputnamathletics.com rexputnamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rhodyrampage.com rhodyrampage.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
rickheinz.com rickheinz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
ringgoldrams.org ringgoldrams.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ritenourathletics.com ritenourathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
riverbluffathletics.com riverbluffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
arbroath-mad.co.uk arbroath-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 253 days
rkkln.com rkkln.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
rmx.com.mx rmx.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 148 days
abilenecooperathletics.org abilenecooperathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rochellenews-leader.com rochellenews-leader.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Jan 2020 One Off
rocketshockey.net rocketshockey.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
roguesportforum.com roguesportforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
abreo.co abreo.co
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
romagladiatornation.com romagladiatornation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
romancemeetslife.com romancemeetslife.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Feb 2020 24 days
ac778.xyz ac778.xyz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 12 days
rpp.pe rpp.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
rsvponline.mx rsvponline.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
rubbingtherock.com rubbingtherock.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
rugbyclub9.be rugbyclub9.be
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
areavibes.com areavibes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rvblazerathletics.com rvblazerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sabrehockey.com sabrehockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 182 days
sabrenoise.com sabrenoise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
saddlebackathletics.com saddlebackathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
salinehornets.com salinehornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sandraandwoo.com sandraandwoo.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Jan 2020 One Off
sanjuan8.com sanjuan8.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
adventuregamers.com adventuregamers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 110 days
saturdayblitz.com saturdayblitz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
saucyrecipes.com saucyrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Aug 2019 52 days
saxonathletics.com saxonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
afyfc.co.uk afyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 202 days
scarletandgame.com scarletandgame.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
scbuffalostrong.com scbuffalostrong.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
arismenu.com arismenu.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
scienceglory.com scienceglory.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
sdcavers.com sdcavers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ahsathletics.com ahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ahsindians.com ahsindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ahsrocketsports.org ahsrocketsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
seerahockey.ca seerahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
sendscraps.com sendscraps.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
seo-fast.ru seo-fast.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
seqsports.com seqsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
alt-codes.net alt-codes.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
seventyfirstathletics.com seventyfirstathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
alohaathletics.org alohaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sgcathletics.com sgcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
seymourathletics.com seymourathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
aroyalpain.com aroyalpain.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
shabdkosh.com shabdkosh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 163 days
arrowheadaddict.com arrowheadaddict.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
allfreecasserolerecipes.com allfreecasserolerecipes.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
algonabulldogs.org algonabulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
shoresportsnetwork.com shoresportsnetwork.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
shs-falcons.com shs-falcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
shsnolesathletics.com shsnolesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
shswolfpack.com shswolfpack.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
am66g.com am66g.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
amhsraptors.com amhsraptors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
simbaly.com simbaly.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Nov 2019 116 days
sistematdcvip.com sistematdcvip.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
amcg.cn amcg.cn
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
skinnyover40.com skinnyover40.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 64 days
ankaclan.com ankaclan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
skyscraperblues.com skyscraperblues.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
slamonline.com slamonline.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jul 2019 48 days
slcavaliers.com slcavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
anthemprepathletics.com anthemprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
animalgourmet.com animalgourmet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
sneakhype.com sneakhype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
smpanthersports.com smpanthersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
angelswin-forum.com angelswin-forum.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
anitube.biz anitube.biz
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
socasteeathletics.com socasteeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
soddydaisyathletics.com soddydaisyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
antonymsfor.com antonymsfor.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
soundersnation.com soundersnation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
sovsport.ru sovsport.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
southceredigionjfl.co.uk southceredigionjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 230 days
aptoslife.com aptoslife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Jun 2019 34 days
spachethespatula.com spachethespatula.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 66 days
autorii.com autorii.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
specialoperations.com specialoperations.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
spectorshockey.net spectorshockey.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 292 days
spiritofboise.com spiritofboise.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
spoonpullers.com spoonpullers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sportbikes.net sportbikes.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sportdfw.com sportdfw.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
sprmha.com sprmha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
spsl.ca spsl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
arundelathletics.com arundelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
014358.com 014358.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
stamfordadvocate.com stamfordadvocate.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
starsandsticks.com starsandsticks.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
starcrush.com starcrush.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stcathletics.com stcathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
1007sandiego.com 1007sandiego.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 101 days
1027kord.com 1027kord.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1079ishot.com 1079ishot.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stingrayforums.com stingrayforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
stittsvilleminorhockey.com stittsvilleminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
12newsnow.com 12newsnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
stlfinder.com stlfinder.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Nov 2019 63 days
stockinvest.us stockinvest.us
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 20 days
13newsnow.com 13newsnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
1428elm.com 1428elm.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
asianjournal.com asianjournal.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 58 days
stripers247.com stripers247.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
stylecartel.com stylecartel.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
abovethelaw.com abovethelaw.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
subiecalendar.com subiecalendar.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
suke.in suke.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
adaatude.com adaatude.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
aimeebroussard.com aimeebroussard.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
surfline.com surfline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
surfturfandmurph.com surfturfandmurph.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
allfreeknitting.com allfreeknitting.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
suzukigw250.org suzukigw250.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
sweetslyrics.com sweetslyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
amherstfc.co.uk amherstfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 269 days
swantonathletics.org swantonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
swraidersathletics.com swraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
swtorui.com swtorui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 252 days
swwgl.co.uk swwgl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 182 days
anchoragebucs.com anchoragebucs.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
tabascohoy.com tabascohoy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
tabcrawler.com tabcrawler.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 59 days
tamaracamerablog.com tamaracamerablog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
asweetspoonful.com asweetspoonful.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
tcchsrebels.com tcchsrebels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
atititor.com atititor.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
tcrams.net tcrams.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
atvtorture.com atvtorture.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
techbulldogs.com techbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
techgenyz.com techgenyz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 69 days
technorms.com technorms.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
tephockey.com tephockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
avidoutdoorsman.com avidoutdoorsman.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 117 days
avonworthathletics.com avonworthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
thatballsouttahere.com thatballsouttahere.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
awkwardmom.com awkwardmom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
ayrshireschoolsfa.co.uk ayrshireschoolsfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 206 days
thegameraccess.com thegameraccess.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
thedieselstop.com thedieselstop.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
thelatinkitchen.com thelatinkitchen.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 154 days
babsonfashion1.com babsonfashion1.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
therealdeal.com therealdeal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
thepostgame.com thepostgame.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
therooster.com therooster.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
thesmokingcuban.com thesmokingcuban.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
thespicedlife.com thespicedlife.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
thesquishymonster.com thesquishymonster.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
balancingtoday.com balancingtoday.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
thomasdaleathletics.com thomasdaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
theyucatantimes.com theyucatantimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
thibodauxtigers.org thibodauxtigers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
thyroidboards.com thyroidboards.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
banana1015.com banana1015.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
thsouthsports.com thsouthsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
thunderathletics.org thunderathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ticehurstfc.co.uk ticehurstfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
tideandthyme.com tideandthyme.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
timbercreekathletics.com timbercreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tigerland.com tigerland.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
baratacademyathletics.org baratacademyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tippecanoeathletics.com tippecanoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
timeskerala.com timeskerala.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 49 days
timesnowhindi.com timesnowhindi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 19 days
titansathletics.org titansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tjpatriotathletics.com tjpatriotathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
baseballoshawa.com baseballoshawa.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Sep 2019 57 days
basketball.com basketball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tohsathletics.org tohsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tnxl.nl tnxl.nl
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
bawarchi.com bawarchi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Sep 2019 43 days
tonaletalk.com tonaletalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
toonclub-th.co toonclub-th.co
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
bbmha.ca bbmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 238 days
bchsdolphins.com bchsdolphins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
total911.com total911.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
totalbengals.com totalbengals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalceltics.com totalceltics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalchiefs.com totalchiefs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalcubs.com totalcubs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totaldenverbroncos.com totaldenverbroncos.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalduke.com totalduke.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalillini.com totalillini.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalindy.com totalindy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
beargoggleson.com beargoggleson.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
bearinsider.com bearinsider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 231 days
totalmiamiheat.com totalmiamiheat.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalpac12.com totalpac12.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
trabzonilkadimgayrimenkul.com trabzonilkadimgayrimenkul.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
bebehblog.com bebehblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
beechgrove-athletics.com beechgrove-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
beeremovalsource.com beeremovalsource.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
beldingathletics.com beldingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tri-centraltrojans.com tri-centraltrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tri-countyathletics.com tri-countyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bemad.es bemad.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Feb 2020 66 days
truestreetcars.com truestreetcars.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
truthuncensored.net truthuncensored.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
trx450r.org trx450r.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
tscougarssports.com tscougarssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ttcp5577.com ttcp5577.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
tudn.mx tudn.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
tuningcult.com tuningcult.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
tvnewz.xyz tvnewz.xyz
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
twobillsdrive.com twobillsdrive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
typingclub.com typingclub.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
uancx15.com uancx15.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
bexleyathletics.com bexleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bghsathletics.com bghsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bgpurplessports.com bgpurplessports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
unakem.com unakem.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
bigbangnews.com bigbangnews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 49 days
bigblueinteractive.com bigblueinteractive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
bikemag.com bikemag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
bikez.biz bikez.biz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
uovmhl.ca uovmhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
urbanahawksathletics.com urbanahawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bimmerforums.co.uk bimmerforums.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
uscscoop.com uscscoop.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
utvblog.net utvblog.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
utvsl.co.uk utvsl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
bishopenglandathletics.com bishopenglandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
valleyviewtigers1.com valleyviewtigers1.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bizcochosysancochos.com bizcochosysancochos.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 66 days
vanderhoofminorhockey.ca vanderhoofminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 280 days
vanessahwood.com vanessahwood.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
vanvan200.com vanvan200.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vasjvikings.com vasjvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
blackfaldsminorhockey.com blackfaldsminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
veintitres.com.ar veintitres.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 113 days
blacksportsonline.com blacksportsonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 110 days
bladenjournal.com bladenjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
videotoolbox.com videotoolbox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
viralcuba.com viralcuba.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
viralplot.com viralplot.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 65 days
vintagesleds.com vintagesleds.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vivaligamx.com vivaligamx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 95 days
blythewoodbengals.com blythewoodbengals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
vmsa.ca vmsa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
volleyballpei.com volleyballpei.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
bobjonesathletics.com bobjonesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bobvila.com bobvila.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
volnation.com volnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
bold.global bold.global
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
vulture.com vulture.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
boltbeat.com boltbeat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
vwt4forum.co.uk vwt4forum.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
wabashapaches.net wabashapaches.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bongbo.ng bongbo.ng
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
wapa.pe wapa.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 178 days
warhistoryonline.com warhistoryonline.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
bosseathletics.com bosseathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bostonbulldogshockey.com bostonbulldogshockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
wblm.com wblm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wcnc.com wcnc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
bowmanathletics.org bowmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wearebeggs.com wearebeggs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wearenorco.org wearenorco.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wearesc.com wearesc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
boxelderathletics.com boxelderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bradshawmountainathletics.com bradshawmountainathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
weddingchicks.com weddingchicks.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
bricksareawesome.com bricksareawesome.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
brickseek.com brickseek.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
westbromwichalbion-mad.co.uk westbromwichalbion-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 93 days
wfmynews2.com wfmynews2.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
wforum.com wforum.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 Aug 2019 71 days
wgna.com wgna.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
broadneckathletics.org broadneckathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
broadstreetbuzz.com broadstreetbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
brockeaglesathletics.com brockeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
whiskers101.com whiskers101.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
brookingsregister.com brookingsregister.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 231 days
wideopencountry.com wideopencountry.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 193 days
whspanthers.com whspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
brvathletics.com brvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wildcatforum.com wildcatforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
btwathletics.com btwathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wionews.com wionews.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
buccaneerstrong.com buccaneerstrong.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
winteriscoming.net winteriscoming.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
wkfr.com wkfr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wkmi.com wkmi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wlvfl.co.uk wlvfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 167 days
wopanthers.com wopanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
workingclassmag.com workingclassmag.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
bustingbrackets.com bustingbrackets.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
wpst.com wpst.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
buzzadamsshow.com buzzadamsshow.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
bvayouthsoccer.com bvayouthsoccer.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
wwfoldschool.com wwfoldschool.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Nov 2019 65 days
bysi.ca bysi.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 111 days
wxc-yl.com wxc-yl.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
wykewanderers.com wykewanderers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
wzakcleveland.com wzakcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
cafepharma.com cafepharma.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cajoncowboyathletics.com cajoncowboyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cakewrecks.com cakewrecks.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Jan 2020 65 days
calcalist.co.il calcalist.co.il
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
calltothepen.com calltothepen.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
xiehui.org xiehui.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
xoxobella.com xoxobella.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
can-amforum.com can-amforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
canaln.pe canaln.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
xsr700forums.com xsr700forums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
hailwv.com hailwv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
yamaha-motorcycles.org yamaha-motorcycles.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
yanksgoyard.com yanksgoyard.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
yarisgrmn.com yarisgrmn.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yesplz.co yesplz.co
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 246 days
yetiownersclub.co.uk yetiownersclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yoamoloszapatos.com yoamoloszapatos.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 126 days
catcountry1073.com catcountry1073.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
causewaycrowd.com causewaycrowd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
cavsathletics.com cavsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ysyl222.com ysyl222.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
ccsmsathletics.org ccsmsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
zafiraowners.co.uk zafiraowners.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
cekingathletics.com cekingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
celebrityaccess.com celebrityaccess.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
zeelandwestsports.com zeelandwestsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
centralscotlandfa.co.uk centralscotlandfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 276 days
centralscottishafl.co.uk centralscottishafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 276 days
cfcolts.com cfcolts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cgbulldogs.com cgbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cheapism.com cheapism.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
chopchat.com chopchat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
chowderandchampions.com chowderandchampions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
chsfalconpride.com chsfalconpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chsfalcons.com chsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chslionsathletics.com chslionsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cincinnatisteam.com cincinnatisteam.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
cincyontheprowl.com cincyontheprowl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
clarets-mad.co.uk clarets-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 77 days
clevescene.com clevescene.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Nov 2019 One Off
clintonnc.com clintonnc.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Sep 2019 104 days
cmaspartans.com cmaspartans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cmh4444.com cmh4444.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
cnynews.com cnynews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
collegegridirons.com collegegridirons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 278 days
convertfiles.com convertfiles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
couleeregionsledhockey.com couleeregionsledhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Dec 2019 172 days
coventryathletics.org coventryathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
covers.com covers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
covinahighathletics.com covinahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
craftbuds.com craftbuds.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
cricket.co.uk cricket.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
cricketfox.com cricketfox.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
cricketpakistan.com.pk cricketpakistan.com.pk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
crnorthampton.com crnorthampton.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
crookanddistrictleague.co.uk crookanddistrictleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 278 days
crooksandliars.com crooksandliars.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
crowdpac.com crowdpac.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
crxcommunity.com crxcommunity.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
csfbl.com csfbl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
csfda.co.uk csfda.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 49 days
csnbbs.com csnbbs.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
csskodiaks.com csskodiaks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cycling.co.uk cycling.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 75 days
daculaathletics.com daculaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dailyarmy.com dailyarmy.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Feb 2020 190 days
daingerfieldathletics.com daingerfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dairycarrie.com dairycarrie.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
dallasobserver.com dallasobserver.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
damienathletics.com damienathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
darklegacycomics.com darklegacycomics.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Feb 2020 75 days
dawgpounddaily.com dawgpounddaily.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
dawu-cn.com dawu-cn.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 8 days
dbhssports.org dbhssports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dbltap.com dbltap.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
ddotomen.co ddotomen.co
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Feb 2020 181 days
ddyfa.co.uk ddyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 279 days
dealbreaker.com dealbreaker.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
deliciouslysavvy.com deliciouslysavvy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 130 days
denmarkathletics.com denmarkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
destinationtips.com destinationtips.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
devid.info devid.info
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
dfl2009.co.uk dfl2009.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 90 days
dhsdragonsathletics.com dhsdragonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dhshsathletics.com dhshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
diabloathletics.com diabloathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
diariolasamericas.com diariolasamericas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
diffuser.fm diffuser.fm
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
diyelectriccar.com diyelectriccar.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
dkn.tv dkn.tv
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
dobberhockey.com dobberhockey.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 130 days
dobbersports.com dobbersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Oct 2019 59 days
dobiepride.com dobiepride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dodgersway.com dodgersway.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
doggiedessertchef.com doggiedessertchef.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 130 days
doublem-atm.com doublem-atm.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Feb 2020 Feb 2020 One Off
dowathletics.com dowathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dpsbelmontathletics.com dpsbelmontathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
droidviews.com droidviews.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Feb 2020 67 days
drphillipshsathletics.com drphillipshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
drywalltalk.com drywalltalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
duvalathletics.com duvalathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dvskyhawksathletics.com dvskyhawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
easleyathletics.com easleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eastcoasterlifestyle.com eastcoasterlifestyle.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 One Off
eastlansingathletics.com eastlansingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eastviewathletics.com eastviewathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eddiesathletics.com eddiesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ehsathletics.org ehsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ejeagleathletics.org ejeagleathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eleconomista.es eleconomista.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
eleconomistaamerica.cl eleconomistaamerica.cl
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 220 days
elfann.com elfann.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
elheraldo.hn elheraldo.hn
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
elmonteathletics.com elmonteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eluxemagazine.com eluxemagazine.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
empirewritesback.com empirewritesback.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
ennislions.org ennislions.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eqinterface.com eqinterface.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
equinoxforum.net equinoxforum.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
estrategia45.com estrategia45.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 166 days
etowahhighathletics.com etowahhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
excelsemipro.com excelsemipro.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
excelsior.com.mx excelsior.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
expansion.com expansion.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
expertsphp.com expertsphp.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 38 days
expressnews.com expressnews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
eyelinerwingsandprettythings.com eyelinerwingsandprettythings.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
factoryofsadness.co factoryofsadness.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
fairbornathletics.com fairbornathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fairfieldcitizenonline.com fairfieldcitizenonline.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
fantasyhockeygeek.com fantasyhockeygeek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 319 days
fantasysharks.com fantasysharks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jan 2020 186 days
fashionnewsera.com fashionnewsera.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
fcflashes.com fcflashes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
feedmephoebe.com feedmephoebe.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
feelslikehomeblog.com feelslikehomeblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
fftoday.com fftoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
fftodayforums.com fftodayforums.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 230 days
fightersweep.com fightersweep.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
filedmz.com filedmz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
filmcraft.club filmcraft.club
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 One Off
firebirdnation.com firebirdnation.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
firefightingnews.com firefightingnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
five2go.com five2go.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 192 days
fliernation.org fliernation.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
floridaleague.com floridaleague.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
flucoathletics.com flucoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fmhsathletics.com fmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
football.com football.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
fordforums.com fordforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
forresnairnwfa.co.uk forresnairnwfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 285 days
fortnitedb.com fortnitedb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 101 days
fosterfalcons.com fosterfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
foxcreekathletics.com foxcreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
foxiauto.com foxiauto.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
foxyoxie.com foxyoxie.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
fullertonindiansathletics.com fullertonindiansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
funattic.com funattic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
gahannalincolnathletics.com gahannalincolnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gahrgladiators.com gahrgladiators.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
galido.net galido.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 36 days
gameandfishrecipes.com gameandfishrecipes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
gameob.com gameob.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
gbhsathletics.com gbhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gbpicsonline.com gbpicsonline.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
gcaathletics.org gcaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
geargods.net geargods.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
geekycamel.com geekycamel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Dec 2019 220 days
geoguessr.com geoguessr.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
gigemgazette.com gigemgazette.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
gilbertathletics.org gilbertathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gillingham-mad.co.uk gillingham-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 65 days
gingerize.com gingerize.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
givemeasecond.com givemeasecond.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
gladewaterathletics.com gladewaterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
glendoraathletics.com glendoraathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
globalgrind.com globalgrind.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
goaliepost.com goaliepost.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 321 days
gobluedevilsports.com gobluedevilsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocomets.net gocomets.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goconquerors.com goconquerors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goconquistadors.com goconquistadors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocrusadersathletics.com gocrusadersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
godwinheightsathletics.com godwinheightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goeatoneagles.com goeatoneagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gofcswarriors.com gofcswarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gofreedombulldogs.com gofreedombulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gohemi.com gohemi.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
golargolions.com golargolions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
golfmagic.com golfmagic.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
golfweek.com golfweek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jan 2020 234 days
gonewalbany.com gonewalbany.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gonwpanthers.com gonwpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gool24.net gool24.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 59 days
goonertalk.com goonertalk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Dec 2019 64 days
gopolarbears.com gopolarbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gorattlernation.com gorattlernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goskylineraiders.com goskylineraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gosparkplugs.com gosparkplugs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gotaftathletics.com gotaftathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gotfhsbruins.com gotfhsbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
govalleyvikings.com govalleyvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gowestviewathletics.com gowestviewathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gowilsonwildcats.com gowilsonwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gowyattathletics.com gowyattathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gphswildcats.com gphswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
grchristianeagles.com grchristianeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
greatlakesleague.org greatlakesleague.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
greenbulldogathletics.com greenbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
griffinbearsathletics.com griffinbearsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
groceryshopforfreeatthemart.com groceryshopforfreeatthemart.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
groundedreason.com groundedreason.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
gsxs1000.org gsxs1000.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
gthstitanathletics.com gthstitanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
guitars101.com guitars101.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gunco.net gunco.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
gunforums.net gunforums.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gunlistings.org gunlistings.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
hannity.com hannity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
hauserathletics.com hauserathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hcathletics.net hcathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hdtuto.com hdtuto.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
headphonereview.com headphonereview.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
helloabbeville.com helloabbeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloammon.com helloammon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloangleton.com helloangleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellobrooklyncenter.com hellobrooklyncenter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocapecod.com hellocapecod.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocarbondale.com hellocarbondale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocartersville.com hellocartersville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocentennial.com hellocentennial.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocicero.com hellocicero.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocolleyville.com hellocolleyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocranston.com hellocranston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocrestwood.com hellocrestwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellododge.com hellododge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloeastlansing.com helloeastlansing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Apr 2021 80 days
helloedmond.com helloedmond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloedwardsville.com helloedwardsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloelkriver.com helloelkriver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloelsalvador.com helloelsalvador.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
helloengland.com helloengland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogadsden.com hellogadsden.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogoldsboro.com hellogoldsboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohammond.com hellohammond.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellohermiston.com hellohermiston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohollywood.com hellohollywood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohutchinson.com hellohutchinson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloinkster.com helloinkster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellojerseyshore.com hellojerseyshore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellolahabra.com hellolahabra.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolansing.com hellolansing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellolascruces.com hellolascruces.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolemoore.com hellolemoore.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloleominster.com helloleominster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellolosangeles.com hellolosangeles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
hellolyon.com hellolyon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomaplevalley.com hellomaplevalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomaryville.com hellomaryville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomattoon.com hellomattoon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomorganton.com hellomorganton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellonetherlands.com hellonetherlands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
hellonewlondon.com hellonewlondon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellonogales.com hellonogales.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellonorthampton.com hellonorthampton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellooakharbor.com hellooakharbor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloowensboro.com helloowensboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopalmdale.com hellopalmdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloparkland.com helloparkland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloparmaheights.com helloparmaheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopaterson.com hellopaterson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopineville.com hellopineville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloplantation.com helloplantation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloportage.com helloportage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloportchester.com helloportchester.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopuertorico.com hellopuertorico.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
helloreunion.com helloreunion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorussellville.com hellorussellville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellorussia.com hellorussia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintlucia.com hellosaintlucia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosaintmaarten.com hellosaintmaarten.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
hellosanclemente.com hellosanclemente.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloschererville.com helloschererville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloseattle.com helloseattle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
hellosolomonislands.com hellosolomonislands.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellostarkville.com hellostarkville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellostatesboro.com hellostatesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosummerville.com hellosummerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotrotwood.com hellotrotwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotucson.com hellotucson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
helloupland.com helloupland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellovadnaisheights.com hellovadnaisheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellovisalia.com hellovisalia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowaynesboro.com hellowaynesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowestcolumbia.com hellowestcolumbia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowestvalleycity.com hellowestvalleycity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowheaton.com hellowheaton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellowhittier.com hellowhittier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellowilliamsport.com hellowilliamsport.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellozion.com hellozion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hepangda.com hepangda.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
herzindagi.com herzindagi.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
heyquiz.com heyquiz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
hhpboosterclub.com hhpboosterclub.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hhshoyasports.com hhshoyasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hidalgopirates.org hidalgopirates.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
higherlevelsportsacademy.com higherlevelsportsacademy.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hindijeevansathi.in hindijeevansathi.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
hip-hopvibe.com hip-hopvibe.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 61 days
hiplatina.com hiplatina.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
historyextra.com historyextra.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hitched.co.in hitched.co.in
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hitched.co.za hitched.co.za
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hlsdsports.us hlsdsports.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hmbhsathletics.com hmbhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hnsop.ca hnsop.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
hokesbluffathletics.com hokesbluffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hole-io.com hole-io.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
hondarebel3forum.com hondarebel3forum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
hoosierstateofmind.com hoosierstateofmind.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
horoscope520.com horoscope520.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
hot975fm.com hot975fm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
housesforrent.ws housesforrent.ws
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
houstononthecheap.com houstononthecheap.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
houstonpress.com houstonpress.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Nov 2019 169 days
hypebot.com hypebot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
hysterectomyresearch.com hysterectomyresearch.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
iangavet.com iangavet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
idabelwarriors.com idabelwarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ifagrassrootsabc.co.uk ifagrassrootsabc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 286 days
ilovemydogsomuch.com ilovemydogsomuch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
ilwarriors.com ilwarriors.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
immediate.co.uk immediate.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
impressiveinteriordesign.com impressiveinteriordesign.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
infinitiq60.org infinitiq60.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
ringsidenews.com ringsidenews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 189 days
insideweddings.com insideweddings.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
intouchweekly.com intouchweekly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
ironhorseathletics.net ironhorseathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ivf.ca ivf.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
jalisaharris.com jalisaharris.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
jamesclemensathletics.com jamesclemensathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jcpantherathletics.org jcpantherathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jdtechtalk.com jdtechtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jeeppatriot.com jeeppatriot.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jeffathletics.com jeffathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jeffersonfalconathletics.com jeffersonfalconathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jensalittleloopy.com jensalittleloopy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 185 days
jetsathletics.org jetsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jetski.com jetski.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jetskinews.com jetskinews.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
jimrome.com jimrome.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
jjj109.top jjj109.top
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
jobsarkari.com jobsarkari.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 62 days
jomustangathletics.com jomustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jonesborocardinals.com jonesborocardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
journalindia.com journalindia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 32 days
judoinside.com judoinside.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
jugofsnyder.com jugofsnyder.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
justputzing.com justputzing.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
kawasakiz650.com kawasakiz650.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kcmha.ca kcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
kearnsathletics.com kearnsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kekbfm.com kekbfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kellathletics.org kellathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kempnerathletics.com kempnerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kens5.com kens5.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
kentuckysportsradio.com kentuckysportsradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
kfilradio.com kfilradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kfox95.com kfox95.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kicks105.com kicks105.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kingjamesgospel.com kingjamesgospel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
kissrichmond.com kissrichmond.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kixs.com kixs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
klaq.com klaq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
kmhsmustangathletics.net kmhsmustangathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
knightnationathletics.com knightnationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
korrespondent.net korrespondent.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 124 days
ksmglobe.com ksmglobe.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 31 days
kvgo1043.com kvgo1043.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
kxkx.com kxkx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
lackeyathletics.com lackeyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lafayettefightingirish.com lafayettefightingirish.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lagunahillsathletics.com lagunahillsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lakecityathletics.org lakecityathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lakers365.com lakers365.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 315 days
lakeshowlife.com lakeshowlife.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
lancasterathletics.com lancasterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
laoutdoorexpo.com laoutdoorexpo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
laprensagrafica.com laprensagrafica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
larepublica.pe larepublica.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
latintimes.com latintimes.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
lavoz.com.ar lavoz.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
lawlessrepublic.com lawlessrepublic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
lawndaleathletics.com lawndaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lecathletics.com lecathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lehighvalleybaseball.com lehighvalleybaseball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
lewiscountyathletics.com lewiscountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lewisfalconsathletics.com lewisfalconsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lhathletics.com lhathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lhshornets.com lhshornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lhslancers.com lhslancers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lifeandstylemag.com lifeandstylemag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
lifeinleggings.com lifeinleggings.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 126 days
lighterthanheir.com lighterthanheir.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 90 days
linantalk.com linantalk.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 30 days
lincolncity-mad.co.uk lincolncity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 232 days
lincolnprepathletics.org lincolnprepathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lingq.com lingq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
listindiario.com listindiario.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
livefromwdw.com livefromwdw.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Oct 2019 62 days
livemusicblog.com livemusicblog.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 175 days
ljloboathletics.com ljloboathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
loogooteeathletics.com loogooteeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
losandespass.com.ar losandespass.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
losgatosathletics.com losgatosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lowellvilleathletics.com lowellvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lrgarden.net lrgarden.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 153 days
lutonrugby.com lutonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Aug 2019 51 days
lwwathletics.com lwwathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lynbrookathletics.com lynbrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lyricalduniya.com lyricalduniya.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 29 days
maharajas-express-india.com maharajas-express-india.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 59 days
majestyusa.com majestyusa.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
malaysiaindru.my malaysiaindru.my
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
manatelugu.to manatelugu.to
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
manchesterdutchmen.com manchesterdutchmen.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
marca.com marca.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
marketrealist.com marketrealist.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jan 2020 234 days
maseratilevanteforum.com maseratilevanteforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
masfl.co.uk masfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 283 days
mavpride.com mavpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mbeqclub.com mbeqclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
mchiathletics.com mchiathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mcmustangs.com mcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
meadeathletics.com meadeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mega.tv mega.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
mercedesclaforum.com mercedesclaforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
merthyrtydfilafl.co.uk merthyrtydfilafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 282 days
metacafe.com metacafe.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 110 days
metacarpolis.com metacarpolis.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 58 days
metsminors.net metsminors.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
midcenturymenu.com midcenturymenu.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
milfordyouthbaseball.com milfordyouthbaseball.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
miramichiminorhockey.ca miramichiminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
mix108.com mix108.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mjandhungryman.com mjandhungryman.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
mlsmultiplex.com mlsmultiplex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
mmasucka.com mmasucka.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 11 days
mmhsathletics.com mmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mmorpg.com mmorpg.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 231 days
mohawks4life.com mohawks4life.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
momentumorthopaedics.co.uk momentumorthopaedics.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Dec 2019 One Off
montevistajournal.com montevistajournal.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Mar 2020 293 days
moodytrojans.com moodytrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
motherwellmag.com motherwellmag.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Dec 2019 One Off
motorsport.co.uk motorsport.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
mountainstatesman.com mountainstatesman.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
mrhsathletics.com mrhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mrhsgrizzlies.org mrhsgrizzlies.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mthfightingowls.com mthfightingowls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mtmorrisathletics.com mtmorrisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mujerde10.com mujerde10.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 85 days
munciecentralathletics.com munciecentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
munstermustangs.com munstermustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
muyinteresante.es muyinteresante.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
mvhsathletics.com mvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mwsoccer.com mwsoccer.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
mybama.com mybama.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
mycleo.tv mycleo.tv
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
myhoustonmajic.com myhoustonmajic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mypraiseatl.com mypraiseatl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
mytherapistsays.ca mytherapistsays.ca
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 128 days
nacionrex.com nacionrex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 75 days
nagpurtoday.in nagpurtoday.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 27 days
nataliasports.net nataliasports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
navaraownersclub.com navaraownersclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
ncacrusaders.org ncacrusaders.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ndaeagles.org ndaeagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ndathletics.com ndathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
neptuneathletics.org neptuneathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
newcougar.org newcougar.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
newsbytesapp.com newsbytesapp.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
newstalk1280.com newstalk1280.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
newswest9.com newswest9.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
next-video.ru next-video.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 27 days
nflanalysis.net nflanalysis.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 309 days
ngemu.com ngemu.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
nghsbulldogs.com nghsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nibfanational.co.uk nibfanational.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Dec 2019 179 days
ninernoise.com ninernoise.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
nisoutherngirlsleague.co.uk nisoutherngirlsleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
niusdiario.es niusdiario.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
nlvideo.com nlvideo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
nmhsathletics.com nmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nnshshl.com nnshshl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Oct 2019 114 days
noisecreep.com noisecreep.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
novahockey.ca novahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
novelzzz.com novelzzz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 113 days
npaaathletics.com npaaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
npcmustangs.com npcmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nswildcats.com nswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nsxforums.com nsxforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
nulltx.com nulltx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
numismaster.com numismaster.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
nycbl.com nycbl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
nymag.com nymag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
oberlinathletics.org oberlinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
obsev.com obsev.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
oconnellathletics.com oconnellathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oconnorathletics.com oconnorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ohahockey.ca ohahockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
ohstigers.com ohstigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ohtake-root.com ohtake-root.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 Mar 2020 Aug 2020 131 days
oilerathletics.com oilerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oinkoink.com.mx oinkoink.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
okbridaldress.com okbridaldress.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 128 days
okjeffersoncity.com okjeffersoncity.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
okmagazine.com okmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
olehottytoddy.com olehottytoddy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
olentangyberlinathletics.com olentangyberlinathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
olsmj.com olsmj.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 May 2019 One Off
ondu.ru ondu.ru
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
onlinebackupreviews.com onlinebackupreviews.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
organicsleepreviews.com organicsleepreviews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
orient-news.net orient-news.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 81 days
oronospartans.org oronospartans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ovffl.com ovffl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ovpatriots.com ovpatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
owhsbruins.com owhsbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
paininthearsenal.com paininthearsenal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
pajiba.com pajiba.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
paladins.guru paladins.guru
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Mar 2020 208 days
redmarleyfc.co.uk redmarleyfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
parentztalk.com parentztalk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 227 days
pceagles.com pceagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pcepactivities.com pcepactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pembrokeminorhockey.com pembrokeminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
penslabyrinth.com penslabyrinth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
perfectmancave.com perfectmancave.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
phhsbigreds.com phhsbigreds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
phsindians.info phsindians.info
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
picpug.com picpug.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
pikecountyathletics.com pikecountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pikstagram.org pikstagram.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
plainsman.com plainsman.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 245 days
pokespost.com pokespost.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 145 days
popaxiom.com popaxiom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Feb 2020 55 days
popcrush.com popcrush.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
popularmilitary.com popularmilitary.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
poststar.com poststar.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
poultonprimaryleague.co.uk poultonprimaryleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
power959.com power959.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
powerstroke.org powerstroke.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
preferredstockchannel.com preferredstockchannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
premierballhockey.net premierballhockey.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
prensalibre.com prensalibre.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
pricepanda.co.id pricepanda.co.id
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 271 days
pricepanda.com.sg pricepanda.com.sg
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Jan 2020 Feb 2020 43 days
priusonline.com priusonline.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
problitz.com problitz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 305 days
prowlertalk.net prowlertalk.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
pryouthsoccer.com pryouthsoccer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
psdispatch.com psdispatch.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Nov 2019 169 days
psindians.com psindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pwtorchlivecast.com pwtorchlivecast.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 258 days
qocougars.com qocougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
qqsssj.com qqsssj.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
quickplumb.club quickplumb.club
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Jan 2020 129 days
racer.com racer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Sep 2019 104 days
ramonahighathletics.com ramonahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ramrebelforum.com ramrebelforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
ramsathletics.org ramsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ran-myrosso.com ran-myrosso.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
rap4ever.org rap4ever.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
rappler.com rappler.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
ravensathletics.com ravensathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rayscoloredglasses.com rayscoloredglasses.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
razzball.com razzball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 19 days
riderforums.com riderforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
ridgelineownersclub.com ridgelineownersclub.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
ringtv.com ringtv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 23 days
riverfrontball.com riverfrontball.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
archeryaddix.com archeryaddix.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
buzznoble.com buzznoble.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 61 days
rncavaliers.com rncavaliers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
roadglide.org roadglide.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
abunawaf.com abunawaf.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
rock1041.com rock1041.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
robesonian.com robesonian.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Sep 2019 56 days
roscoeathletics.com roscoeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
royalathletics.net royalathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
roughriderathletics.net roughriderathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
roughridersports.net roughridersports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
roverathletics.org roverathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rowancountyvikings.com rowancountyvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cchsathletics.org cchsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cchssports.com cchssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rswarrior.com rswarrior.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
ruta0.com ruta0.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 22 days
rvguide.com rvguide.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
rvinsurance.net rvinsurance.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
rzwjjc.com rzwjjc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
sachhoc.com sachhoc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
saeasports.org saeasports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
safekidsworld.org safekidsworld.org
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
sailnet.com sailnet.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
saintjohnstone-mad.co.uk saintjohnstone-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 221 days
sammichespsychmeds.com sammichespsychmeds.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jan 2020 233 days
adjfl.co.uk adjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 268 days
adswiki.net adswiki.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
santamariatimes.com santamariatimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
aecorteamer.club aecorteamer.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
satiride.com satiride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
sbisoccer.com sbisoccer.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 162 days
scpringette.com scpringette.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
scyl.org scyl.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 228 days
sdyfl.org sdyfl.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 163 days
seattletimes.com seattletimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
sellitmt.com sellitmt.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
senshot.com senshot.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
arsenal-world.co.uk arsenal-world.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
alhslynx.com alhslynx.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
alternatifim.com alternatifim.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
sgmha.com sgmha.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
sgvikings.com sgvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
allfreechristmascrafts.com allfreechristmascrafts.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
allfreejewelrymaking.com allfreejewelrymaking.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
alvarezeagles.com alvarezeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
shsgreyhounds.com shsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
shsjaguars.com shsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
shskyhawksathletics.com shskyhawksathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
shpanthernation.com shpanthernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
amherststeelecomets.com amherststeelecomets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
amhsathletics.com amhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sidelionreport.com sidelionreport.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
amongtech.com amongtech.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
silverbelt.com silverbelt.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Jan 2020 228 days
singforyoursupperblog.com singforyoursupperblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 64 days
skiingforum.com skiingforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
slambasketball.ca slambasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
autzenzoo.com autzenzoo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
animalog.online animalog.online
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 16 days
smcathletics.us smcathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
animesonlinebr.biz animesonlinebr.biz
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 Jun 2019 34 days
animesonlinebr.co animesonlinebr.co
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
smtitansathletics.org smtitansathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
smyrnahighathletics.com smyrnahighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
antonymswords.com antonymswords.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 68 days
someecards.com someecards.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 110 days
somoskudasai.com somoskudasai.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 May 2019 Aug 2019 77 days
songlyrics.com songlyrics.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Mar 2020 Mar 2020 One Off
aouex.com aouex.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
southernathletics.org southernathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
southboundanddown.com southboundanddown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
spacecityscoop.com spacecityscoop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
spacecoastdaily.com spacecoastdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
speckyboy.club speckyboy.club
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 23 days
sportbikeworld.com sportbikeworld.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sportingsota.com sportingsota.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
sportsecyclopedia.com sportsecyclopedia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
spydertalk.com spydertalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
sqsiil.com sqsiil.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
sswildcatactivities.com sswildcatactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ascentforums.com ascentforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
013249.com 013249.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
0199962.com 0199962.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
1023thebullfm.com 1023thebullfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1033uscountry.com 1033uscountry.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1035kissfmboise.com 1035kissfmboise.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1037theloon.com 1037theloon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1073popcrush.com 1073popcrush.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
10best.com 10best.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
10fastfingers.com 10fastfingers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
1130cc.com 1130cc.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
1199forums.com 1199forums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
stingtut.com stingtut.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
12thmanrising.com 12thmanrising.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
1520theticket.com 1520theticket.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stormthepaint.com stormthepaint.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
studio92.com studio92.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 204 days
stromtrooper.com stromtrooper.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
stxcharge.com stxcharge.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
accorsd.site accorsd.site
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 55 days
achswolvesathletics.net achswolvesathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
acura-legend.com acura-legend.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
sulphurbulldogs.org sulphurbulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
suntamiltv.net suntamiltv.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
airalamo.com airalamo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
susiej.com susiej.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
allaroundhappy.com allaroundhappy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
alt1035.com alt1035.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
swanseaseniorfootballleague.co.uk swanseaseniorfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 230 days
svilleathletics.com svilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
swmavs.com swmavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
swordz.io swordz.io
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 50 days
swrandolphathletics.com swrandolphathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ancafl.co.uk ancafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
androidcentral.com androidcentral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 210 days
sybermoms.com sybermoms.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
annanathletic-mad.co.uk annanathletic-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 83 days
apacheathletics.org apacheathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
syriaohr.com syriaohr.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Nov 2019 63 days
talkparrotlets.com talkparrotlets.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tamspeak.com tamspeak.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
astrologycircle.com astrologycircle.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
atalakers.com atalakers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tasteofcountry.com tasteofcountry.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tbssowners.com tbssowners.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
tchadcarriere.com tchadcarriere.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 50 days
atlantafire.com atlantafire.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
tcodesearch.com tcodesearch.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 19 days
tcwestathletics.org tcwestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
techdeed.com techdeed.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 69 days
atvdragracers.com atvdragracers.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
audiophix.com audiophix.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
televisa.com televisa.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
tenntruth.com tenntruth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
terrapinstationmd.com terrapinstationmd.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
teradatabase.net teradatabase.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 135 days
tfp.is tfp.is
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
awesome923.com awesome923.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
awkward.com awkward.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
thebeatdfw.com thebeatdfw.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
aydengriftonathletics.com aydengriftonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ayersvillepilots.com ayersvillepilots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ayrshireafa.co.uk ayrshireafa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 271 days
thebuzzcincy.com thebuzzcincy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
thejetpress.com thejetpress.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
theprideoflondon.com theprideoflondon.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
therattrick.com therattrick.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
badgerofhonor.com badgerofhonor.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
baenegocios.com baenegocios.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 107 days
thewellflouredkitchen.com thewellflouredkitchen.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
bairdbearathletics.com bairdbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bakedambrosia.com bakedambrosia.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
theurbandaily.com theurbandaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
thhsathletics.com thhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
thisis50.com thisis50.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
thv11.com thv11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
festusathletics.com festusathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
threepercenternation.com threepercenternation.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
thumbnailsave.com thumbnailsave.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 19 days
thunderousintentions.com thunderousintentions.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
tiebreaker.com tiebreaker.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 64 days
tinymixtapes.com tinymixtapes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
tippecanoevalleyathletics.com tippecanoevalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
timesnowmarathi.com timesnowmarathi.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
tisdaleminorhockey.com tisdaleminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
titanathleticshq.com titanathleticshq.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
barnsleyanddistrictjfl.co.uk barnsleyanddistrictjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
barnsleyfa.co.uk barnsleyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 272 days
tlxforums.com tlxforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
tomshardware.co.uk tomshardware.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
bayathletics.org bayathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
toocool2betrue.com toocool2betrue.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 27 days
tooeleathletics.org tooeleathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bbcgoodfood.com bbcgoodfood.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
bcjaguarsathletics.com bcjaguarsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bdyfl.co.uk bdyfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 206 days
tornadoathletics.org tornadoathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
torotimes.com torotimes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
tosawesttrojans.com tosawesttrojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bealestreetbears.com bealestreetbears.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
beamingnotes.com beamingnotes.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
totalprosports.com totalprosports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
totalsacramentokings.com totalsacramentokings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalufc.com totalufc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalvikings.com totalvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalwba.com totalwba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
beautybymissl.com beautybymissl.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
behsathletics.com behsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
beingzhenya.com beingzhenya.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
triwestbruins.com triwestbruins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
trojansrugby.co.uk trojansrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Jul 2019 One Off
bereanathletics.org bereanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tsminteractive.com tsminteractive.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
ttforum.co.uk ttforum.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bessemerathletics.com bessemerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tvinsider.com tvinsider.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
tvmusicnetwork.net tvmusicnetwork.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 97 days
tusaksamomuutru.club tusaksamomuutru.club
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
twgram.me twgram.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Nov 2019 92 days
twice.com twice.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
twinsdaily.com twinsdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
twistity.com twistity.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jan 2020 Jan 2020 One Off
uasdathletics.com uasdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bewebsmart.com bewebsmart.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
bfbluejays.com bfbluejays.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
uglyeaglesathletics.com uglyeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
undeadwalking.com undeadwalking.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
unfinishedman.com unfinishedman.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 189 days
unionandblue.com unionandblue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
unofficialnetworks.com unofficialnetworks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
upownersclub.co.uk upownersclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
billiesathletics.com billiesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
upscsuccess.com upscsuccess.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Nov 2019 66 days
binghamathletics.com binghamathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
usatodayhss.com usatodayhss.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
usmagazine.com usmagazine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
birdathletics.com birdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bishopcanevinathletics.com bishopcanevinathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bishopmoorecatholicathletics.com bishopmoorecatholicathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bishopnollathletics.org bishopnollathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
vagdrivers.net vagdrivers.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
vage7.com vage7.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
vaingloriouscomic.com vaingloriouscomic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 130 days
value101.net value101.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 65 days
vangdata.mx vangdata.mx
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
varinaathletics.com varinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
blackenterprise.com blackenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 110 days
blackoutdallas.com blackoutdallas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
vcscrusaderathletics.com vcscrusaderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
veganook.com veganook.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
bleedinblue.com bleedinblue.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
villaparkathletics.com villaparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
blogredmachine.com blogredmachine.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
blpanthers.com blpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
blscots.org blscots.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
vitalivesfree.com vitalivesfree.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 129 days
vivaglammagazine.com vivaglammagazine.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 159 days
visordown.com visordown.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Jan 2020 165 days
blueovalfanatics.com blueovalfanatics.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vnnplayground.com vnnplayground.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
vnplus.online vnplus.online
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
volkswagenownersclub.com volkswagenownersclub.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
vocesabia.biz vocesabia.biz
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
boards2go.com boards2go.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
vredprospects.ca vredprospects.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Mar 2020 112 days
bollywoodhungama.com bollywoodhungama.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
waconiaathletics.com waconiaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wannacomewith.com wannacomewith.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
waylandunionwildcats.com waylandunionwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wbkr.com wbkr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wblk.com wblk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wcfcourier.com wcfcourier.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
wearebartlett.com wearebartlett.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wearemaranatha.com wearemaranatha.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bpringette.ca bpringette.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
brcardinals.com brcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
break.com.ar break.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
weddinginspirasi.com weddinginspirasi.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
wendelltrojansports.com wendelltrojansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wenonahdragonathletics.com wenonahdragonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
weregeek.com weregeek.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Feb 2020 93 days
wesleychapelathletics.com wesleychapelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
westbloomfieldathletics.com westbloomfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
westcoastconvo.com westcoastconvo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
westernpanthersports.com westernpanthersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wghawksactivities.com wghawksactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
whatinvestment.co.uk whatinvestment.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
brockleycc.co.uk brockleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 86 days
wheelerbearcatsathletics.com wheelerbearcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
brokenteepee.com brokenteepee.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 66 days
whhssports.com whhssports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
whsowls.com whsowls.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
whodatdish.com whodatdish.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
wildaaa.ca wildaaa.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
brutecentral.com brutecentral.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
bryanstationathletics.com bryanstationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
willcookforfriends.com willcookforfriends.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
bsmotoring.com bsmotoring.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
wiltonbulletin.com wiltonbulletin.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
winchesterfootballleague.co.uk winchesterfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 102 days
btw-athletics.com btw-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wiscnews.com wiscnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
wiznation.com wiznation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wndietcs.com wndietcs.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Nov 2019 65 days
bulliomvault.com bulliomvault.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
bunkersparadise.com bunkersparadise.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
womanofstyleandsubstance.com womanofstyleandsubstance.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
burlesonathletics.com burlesonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wonderfeed.com wonderfeed.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
worldboxingnews.net worldboxingnews.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
wowhead.com wowhead.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
wpgtalkradio.com wpgtalkradio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 168 days
wpspanthers.com wpspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wrenhurricanesathletics.com wrenhurricanesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wrhsfalcons.com wrhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wsbs.com wsbs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
wsrkfm.com wsrkfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 168 days
byroncentersports.com byroncentersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wxq68.com wxq68.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Jan 2020 One Off
wzozfm.com wzozfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
cadetathletics.com cadetathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wxwildcats.com wxwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wycombesaintsfc.org.uk wycombesaintsfc.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 103 days
wyomingwolvesathletics.com wyomingwolvesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cagepages.com cagepages.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
cahlhockey.net cahlhockey.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
xclassforums.com xclassforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xcrforum.com xcrforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
xfforum.co.uk xfforum.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
xfsportbrakeforum.com xfsportbrakeforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
camberleycc.co.uk camberleycc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 87 days
camdenfutsalleague.co.uk camdenfutsalleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 87 days
camhl.com camhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 111 days
capiac.org capiac.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
dlisted.com dlisted.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
ycmha.ca ycmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 98 days
careerjobs360.in careerjobs360.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
yellowjackedup.com yellowjackedup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
ynrcjzw.com ynrcjzw.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
yorkshire-divers.com yorkshire-divers.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
casecoltingersoll.com casecoltingersoll.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
yourcobalt.com yourcobalt.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
catcrave.com catcrave.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
ysquarebiyq.site ysquarebiyq.site
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
catholicnewsagency.com catholicnewsagency.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
caughtoffside.com caughtoffside.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
cbbtoday.com cbbtoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 315 days
zcar.com zcar.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
celebdirtylaundry.com celebdirtylaundry.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
celebjar.com celebjar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 46 days
celebritax.com celebritax.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 178 days
cesarsway.com cesarsway.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
cfallsathletics.org cfallsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cfhspanthers.com cfhspanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cgsentinel.com cgsentinel.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Sep 2019 55 days
zonazealots.com zonazealots.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
challengertalk.com challengertalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
challengerforumz.com challengerforumz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
zoioi.com zoioi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
chatib.us chatib.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
chhsathletics.com chhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chlloe.com chlloe.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
chocolate.com chocolate.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
chron.com chron.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
chrono14.com chrono14.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
chsathletics.net chsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chscolts.org chscolts.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
chsgreyhounds.com chsgreyhounds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
churchpop.com churchpop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
hawkeyesathletics.com hawkeyesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cibercuba.com cibercuba.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 58 days
cincinnatichristianathletics.org cincinnatichristianathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cincytacoweek.com cincytacoweek.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Mar 2020 105 days
cinemapettai.com cinemapettai.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
cirangers.org cirangers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ciudad.com.ar ciudad.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 217 days
closerweekly.com closerweekly.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
clpminerals.com clpminerals.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 One Off
clubwrx.net clubwrx.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
clyfa.co.uk clyfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 277 days
cochranerefs.com cochranerefs.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Mar 2020 104 days
cocinadelirante.com cocinadelirante.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Mar 2020 104 days
coffmanathletics.net coffmanathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
collectivebeautyblog.com collectivebeautyblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
collegefootballpoll.com collegefootballpoll.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 231 days
cometsgalaxy.com cometsgalaxy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
coogs4life.net coogs4life.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cookandshare.com cookandshare.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
coppellathletics.com coppellathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
coppercountrynews.com coppercountrynews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
cosbytitansathletics.com cosbytitansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
countryfile.com countryfile.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
courttv.com courttv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 218 days
covenantathletics.org covenantathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cqst.ca cqst.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 180 days
crackberry.com crackberry.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
craigmontathletics.com craigmontathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
creativesports2.com creativesports2.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
crumblycookie.net crumblycookie.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
cubbiescrib.com cubbiescrib.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
cupertinoathletics.com cupertinoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cupw.cn cupw.cn
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Dec 2019 One Off
cvaviators.com cvaviators.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cvilleathletics.com cvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cvjags.com cvjags.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cwmods.com cwmods.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
cyclonefanatic.com cyclonefanatic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
dagelijksevideos.nl dagelijksevideos.nl
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 58 days
daily-stuff.com daily-stuff.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Aug 2019 Aug 2019 9 days
dailyconservative.com dailyconservative.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Feb 2020 131 days
dailyddt.com dailyddt.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
dawnofthedawg.com dawnofthedawg.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
ddmba.net ddmba.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 218 days
deperedeacons.com deperedeacons.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 168 days
dhscats.com dhscats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dhshockey.ca dhshockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
diecastaircraftforum.com diecastaircraftforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
diecastxchange.com diecastxchange.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
dieselplace.com dieselplace.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
digit.in digit.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
dividendchannel.com dividendchannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dnaindia.com dnaindia.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
dodgeintrepid.net dodgeintrepid.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
dodgersnation.com dodgersnation.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
dokry.com dokry.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 5 days
dovikingsathletics.com dovikingsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
downeyathletics.com downeyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dpsmarshallathletics.com dpsmarshallathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dpsmeadowdaleathletics.com dpsmeadowdaleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dpsponitzathletics.com dpsponitzathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dreadnaughtathletics.com dreadnaughtathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dreamjob.ma dreamjob.ma
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 67 days
drumhellerraptorshockey.com drumhellerraptorshockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
duncanball.ca duncanball.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
dunlapeaglesathletics.com dunlapeaglesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dwightmorrowraiders.com dwightmorrowraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eaglevilleschoolathletics.com eaglevilleschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eastbournerugby.com eastbournerugby.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Aug 2019 92 days
eastlancsleague.com eastlancsleague.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 92 days
eastthunderhawks.com eastthunderhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eauclaireathletics.org eauclaireathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ecaathletics.org ecaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
edgewoodmustangsathletics.com edgewoodmustangsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
editorinleaf.com editorinleaf.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
efthunderbirds.com efthunderbirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ehcsathletics.com ehcsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ehs-tigers.com ehs-tigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
elgrafico.com elgrafico.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
elmsathletics.org elmsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
elmundo.es elmundo.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
elmwoodparkathletics.com elmwoodparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
elsegundoathletics.com elsegundoathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eluniversalclasificados.com eluniversalclasificados.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
eluniversaldiario.com eluniversaldiario.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
emeraldcityswagger.com emeraldcityswagger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
eprice.com.tw eprice.com.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
eprmha.ca eprmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
escapefanatics.com escapefanatics.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Dec 2019 Mar 2020 102 days
escootersg.com escootersg.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 70 days
esoui.com esoui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
esportsx.com esportsx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
ettingersmithmemorial.org ettingersmithmemorial.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
evansathletics.com evansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
evansvillenorthathletics.com evansvillenorthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
everythingontap.com everythingontap.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
evolveandascend.com evolveandascend.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
ewrestlingnews.com ewrestlingnews.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
excite.es excite.es
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
exmouthrugby.co.uk exmouthrugby.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
eyesonisles.com eyesonisles.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
fairfieldathletics.org fairfieldathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
falkirk-mad.co.uk falkirk-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 69 days
fbschedules.com fbschedules.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
fclionathletics.com fclionathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
femalefirstly.com femalefirstly.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Feb 2020 Feb 2020 One Off
hawtcelebs.com hawtcelebs.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 175 days
fhcrangers.com fhcrangers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fightbookmma.com fightbookmma.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
filehippo.com filehippo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
filmibeat.com filmibeat.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
finetunedfinances.com finetunedfinances.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
firstforwomen.com firstforwomen.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 14 days
firsttoknow.com firsttoknow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
fisherstigersathletics.com fisherstigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
foodchannel.com foodchannel.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
fourfourtwo.com fourfourtwo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
foxync.com foxync.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
fraghero.com fraghero.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 187 days
freelandfc.co.uk freelandfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 45 days
friarsonbase.com friarsonbase.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
friendlyathletics.org friendlyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
frontieracademyathletics.com frontieracademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
frontierathletics.com frontierathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
frugalgardening.com frugalgardening.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
fsusathletics.com fsusathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fullmatch24.com fullmatch24.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 35 days
fullsizebronco.com fullsizebronco.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
fun1043.com fun1043.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
fwoe.club fwoe.club
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 96 days
gaborone2014.com gaborone2014.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 34 days
gaithersburgathletics.com gaithersburgathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gamefishin.com gamefishin.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
gamesided.com gamesided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
gcak12athletics.org gcak12athletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gcaspartansports.com gcaspartansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gchscougars.com gchscougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gcinee.net gcinee.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
gcmpatriots.com gcmpatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gconnect.in gconnect.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 101 days
geeksided.com geeksided.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
geektyrant.com geektyrant.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
germanshepherds.com germanshepherds.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
ggha.ca ggha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 321 days
ghnorthernoaksathletics.org ghnorthernoaksathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gizmodo.co.uk gizmodo.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 287 days
glendaleprepathletics.com glendaleprepathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
glennathletics.com glennathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
glenoakathletics.org glenoakathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gmenhq.com gmenhq.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
goaviatorsathletics.com goaviatorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gobearcats.org gobearcats.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gobgnsports.com gobgnsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gobluecats.com gobluecats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocabeacons.com gocabeacons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocaliforniaathletics.com gocaliforniaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocanebayathletics.net gocanebayathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocentralindians.com gocentralindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goclarkathletics.com goclarkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gogram.club gogram.club
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
gohermleigh.com gohermleigh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goherronathletics.com goherronathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gohornetsathletics.com gohornetsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gokanelandknights.com gokanelandknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
golakeviewsports.com golakeviewsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
golamarmustangs.com golamarmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goldandgopher.com goldandgopher.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
gomhswarhawks.com gomhswarhawks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gomustangathletics.com gomustangathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gopantherathletics.com gopantherathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gopaolirams.com gopaolirams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gophoenixathletics.com gophoenixathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goportageindians.com goportageindians.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gorangernation.com gorangernation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gordonleeathletics.com gordonleeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goredknightathletics.org goredknightathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goroyalsgo.net goroyalsgo.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gosachristian.org gosachristian.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goslicers.com goslicers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gotjpatsathletics.com gotjpatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
govalhalla.org govalhalla.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
govikingathletics.com govikingathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gowestfieldathletics.com gowestfieldathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goyellowjacketsathletics.com goyellowjacketsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gpucheck.com gpucheck.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 59 days
graduatez.com graduatez.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 157 days
gridironexperts.com gridironexperts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
gridironnewjersey.com gridironnewjersey.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
gromforum.com gromforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
grrlpowercomic.com grrlpowercomic.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Feb 2020 89 days
gstitans.com gstitans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gvgatorathletics.com gvgatorathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hancockcountyathletics.com hancockcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
harley-davidsonforums.com harley-davidsonforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
hboilersports.com hboilersports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hcbeavers.org hcbeavers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hchshornets.com hchshornets.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hdmatches.com hdmatches.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
hdyfl.co.uk hdyfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
headcoachranking.com headcoachranking.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
heatwaved.com heatwaved.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
hellobarbados.com hellobarbados.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellobellflower.com hellobellflower.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellobrowndeer.com hellobrowndeer.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellobrownwood.com hellobrownwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloceres.com helloceres.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloclemmons.com helloclemmons.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocookeville.com hellocookeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocortland.com hellocortland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellocorvallis.com hellocorvallis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloculpeper.com helloculpeper.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloeastcleveland.com helloeastcleveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloeaston.com helloeaston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloedmonton.com helloedmonton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
hellofarmington.com hellofarmington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogallup.com hellogallup.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogautier.com hellogautier.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogreeley.com hellogreeley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogreenwood.com hellogreenwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloherndon.com helloherndon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohinesville.com hellohinesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohuntley.com hellohuntley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellokefalonia.com hellokefalonia.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Nov 2020 29 days
hellokentwood.com hellokentwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellokerrville.com hellokerrville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolawton.com hellolawton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellolayton.com hellolayton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolewiston.com hellolewiston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolibertyville.com hellolibertyville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellolisle.com hellolisle.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolittlechute.com hellolittlechute.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolovespark.com hellolovespark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomadisonville.com hellomadisonville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomapleheights.com hellomapleheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellomartinsville.com hellomartinsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomarylandheights.com hellomarylandheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomissoula.com hellomissoula.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomountclemens.com hellomountclemens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomountwashington.com hellomountwashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomurfreesboro.com hellomurfreesboro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellonorthcharleston.com hellonorthcharleston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellooregon.com hellooregon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopapillion.com hellopapillion.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopayson.com hellopayson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopicorivera.com hellopicorivera.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloportlandme.com helloportlandme.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloportlandor.com helloportlandor.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloportorange.com helloportorange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloranchomirage.com helloranchomirage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloreading.com helloreading.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellorhodes.com hellorhodes.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellorichardson.com hellorichardson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
helloridgeland.com helloridgeland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellorockyriver.com hellorockyriver.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloruston.com helloruston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellosaintmatin.com hellosaintmatin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosantamaria.com hellosantamaria.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloshakerheights.com helloshakerheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloshermanoaks.com helloshermanoaks.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloskokievillage.com helloskokievillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellospokanevalley.com hellospokanevalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellostaunton.com hellostaunton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosumter.com hellosumter.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotaiwan.com hellotaiwan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
hellothomasville.com hellothomasville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotitusville.com hellotitusville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowasco.com hellowasco.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowentzville.com hellowentzville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowestminster.com hellowestminster.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowilkes-barre.com hellowilkes-barre.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowillmar.com hellowillmar.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
henryclayathletics.com henryclayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hesperiaathletics.com hesperiaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hgfpl.co.uk hgfpl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
hhihsathletics.org hhihsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hiepsiduongpho.com hiepsiduongpho.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
hightownjfl.co.uk hightownjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
hillcrestathletics.org hillcrestathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hillcrestknightsathletics.com hillcrestknightsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hinkleyathletics.com hinkleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hipertextual.com hipertextual.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
hipfonts.com hipfonts.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
histdata.com histdata.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hitched.com.au hitched.com.au
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hket.com hket.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 34 days
homesweetjones.com homesweetjones.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
honeygirlsworld.com honeygirlsworld.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 127 days
hookemheadlines.com hookemheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
hoopshabit.com hoopshabit.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
hooverhighathletics.com hooverhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hopevalleyleague.co.uk hopevalleyleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
hotmessgoestooz.com hotmessgoestooz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
houlihansbirkenheadsundayleague.co.uk houlihansbirkenheadsundayleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
houseofhouston.com houseofhouston.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
housewifeglamour.com housewifeglamour.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 63 days
houstonchronicle.com houstonchronicle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
hrvathletics.com hrvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hudsonvilleathletics.com hudsonvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
huffmanhighschoolathletics.com huffmanhighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hulkpop.com hulkpop.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
hurricanesathletics.com hurricanesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hybridforums.org hybridforums.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
ibpsguide.com ibpsguide.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Dec 2019 64 days
iccpathletics.org iccpathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
idcfl.co.uk idcfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 286 days
ilovejeangrey.com ilovejeangrey.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Dec 2019 Dec 2019 One Off
indiehoy.com indiehoy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 128 days
infinitifx.org infinitifx.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
infinitiqx30.org infinitiqx30.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
infoprediksi4d.com infoprediksi4d.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
information-age.com information-age.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
kboards.com kboards.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
iphonehacks.com iphonehacks.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
ipowerrichmond.com ipowerrichmond.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
irabulldogs.org irabulldogs.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
irtv24.tv irtv24.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
irtv98.com irtv98.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 96 days
istory01.com istory01.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 33 days
izkj.cn izkj.cn
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
jagathletics.us jagathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jaguarcountry.org jaguarcountry.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
javaconceptoftheday.com javaconceptoftheday.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
jbwtest.com jbwtest.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
jdvolsathletics.com jdvolsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jeevansathi.com jeevansathi.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
jemsite.com jemsite.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
jetswhiteout.com jetswhiteout.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 126 days
jettajunkie.com jettajunkie.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
jgathletics.org jgathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jgtst.com jgtst.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
jichsathletics.com jichsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jobinfoguru.in jobinfoguru.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
journeyswithjenn.com journeyswithjenn.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
jpecfalcons.com jpecfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jukeforums.com jukeforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
justaddglam.com justaddglam.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 58 days
justinalba.com justinalba.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Oct 2019 Oct 2019 One Off
jwnorthathletics.org jwnorthathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kalakkalcinema.com kalakkalcinema.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Feb 2020 192 days
kalkaskaathletics.com kalkaskaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kanyetothe.com kanyetothe.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
kaorinusantara.or.id kaorinusantara.or.id
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
kare11.com kare11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
kashmereathletics.com kashmereathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kayakfishingforum.com kayakfishingforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
keltecforum.com keltecforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
kemmerergazette.com kemmerergazette.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 316 days
keyj.com keyj.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
khak.com khak.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
khou.com khou.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 126 days
kiatrailsterforum.com kiatrailsterforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kickingitwithkelly.com kickingitwithkelly.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
kissfm969.com kissfm969.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
klrforum.com klrforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
kmmsam.com kmmsam.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
knue.com knue.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kool1079.com kool1079.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
koolfmabilene.com koolfmabilene.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kwknights.com kwknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lahstoppers.com lahstoppers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lakenonaathletics.org lakenonaathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lamarcountyathletics.com lamarcountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lamarvikings.net lamarvikings.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
laopinion.com laopinion.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Sep 2019 104 days
lapatilla.com lapatilla.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
laplataathletics.org laplataathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lastwordonrugby.com lastwordonrugby.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Dec 2019 134 days
latestpricealert.com latestpricealert.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Dec 2019 65 days
latina.com latina.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 258 days
laurinburgexchange.com laurinburgexchange.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jan 2020 186 days
lavandos.pro lavandos.pro
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
lccathletics.com lccathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lebanonathletics.com lebanonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
leopardathletics.org leopardathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lgbworld.com lgbworld.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
lhhighlanderathletics.com lhhighlanderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lhs-trojans.com lhs-trojans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lickingvalleyathletics.com lickingvalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lidarradar.com lidarradar.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
lisburnjuniorfootballleague.co.uk lisburnjuniorfootballleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 284 days
listenonrepeat.com listenonrepeat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 14 days
ljhuskyathletics.com ljhuskyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lmhaonline.com lmhaonline.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Dec 2019 Dec 2019 One Off
lmhockey.com lmhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
lmhtf.com lmhtf.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
lnkfi.re lnkfi.re
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
lobandsmash.com lobandsmash.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Feb 2020 59 days
localpov.com localpov.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 135 days
lolakers.com lolakers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
londonjuniormustangs.com londonjuniormustangs.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
loopnewsbarbados.com loopnewsbarbados.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
lorainathletics.org lorainathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
loretteminorhockey.com loretteminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
lorettoacademyathletics.com lorettoacademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lovepanky.com lovepanky.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 154 days
lphsathletics.net lphsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lshsactivities.com lshsactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ludlowathletics.org ludlowathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lumberjocks.com lumberjocks.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
lutontown-mad.co.uk lutontown-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Feb 2020 231 days
lvhswildcatathletics.com lvhswildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lyricscraze.com lyricscraze.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Oct 2019 One Off
malaysiakini.com malaysiakini.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
managertoday.com.tw managertoday.com.tw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
manoramaonline.com manoramaonline.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
maplesofthawks.com maplesofthawks.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
maplestage.com maplestage.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 44 days
marauderathletics.com marauderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
marauderathletics.org marauderathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
marlinmaniac.com marlinmaniac.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
matichon.co.th matichon.co.th
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
mchsathletics.com mchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mckayathletics.com mckayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mcmichaelathletics.com mcmichaelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mcs-athletics.com mcs-athletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mcseagles.org mcseagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellocharlotte.com media1.hellocharlotte.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellonashville.com media1.hellonashville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 Aug 2020 Aug 2020 One Off
medyafaresi.com medyafaresi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 58 days
melanysguydlines.com melanysguydlines.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
memphisathletics.com memphisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
menaulsports.com menaulsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mesquiteathletics.com mesquiteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
metasrc.com metasrc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 311 days
mhspioneers.com mhspioneers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
miamisburgathletics.com miamisburgathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
michiganreefers.com michiganreefers.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
micromaxinfo.com micromaxinfo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 244 days
mid-carolinaathletics.com mid-carolinaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
midlevelexceptional.com midlevelexceptional.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
milacawolves.com milacawolves.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
milanathletics.com milanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
milehighsticking.com milehighsticking.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
milenio.com milenio.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
milfordmavs.com milfordmavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mimosasandmotherhood.com mimosasandmotherhood.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
missfrugalmommy.com missfrugalmommy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
mix1043fm.com mix1043fm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
mlspartanathletics.org mlspartanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mmmarauders.com mmmarauders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mmoui.com mmoui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
modernhealth.net modernhealth.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Mar 2020 86 days
mommysbusy.com mommysbusy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
monashoressports.com monashoressports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mondeostoc.com mondeostoc.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
moodycountyenterprise.com moodycountyenterprise.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Feb 2020 236 days
mooseheadstew.com mooseheadstew.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Dec 2019 Feb 2020 51 days
moovimex.com moovimex.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 63 days
morellmustangs.ca morellmustangs.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
mpanthers.com mpanthers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mqtblazers.com mqtblazers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mrhssentinels.org mrhssentinels.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
msbbulldogs.com msbbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mulberryathletics.com mulberryathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
murhinorenovationsaaa.ca murhinorenovationsaaa.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
murrayhsathletics.com murrayhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
muscleandfitness.com muscleandfitness.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
musicstack.com musicstack.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
musketfire.com musketfire.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
muyhistoria.es muyhistoria.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Feb 2020 57 days
muynegociosyeconomia.es muynegociosyeconomia.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
muzikum.eu muzikum.eu
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
mwwire.com mwwire.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 310 days
myabarth.co.uk myabarth.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
myjeepcompass.com myjeepcompass.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mymbonline.com mymbonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mynation.com mynation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 47 days
mypembrokenc.com mypembrokenc.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Oct 2019 63 days
nbbha.com nbbha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Mar 2020 211 days
nbskolvikings.com nbskolvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ncyfjdyp.cn ncyfjdyp.cn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
nenb91.com nenb91.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Oct 2019 One Off
nesn.com nesn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
neuquahockey.org neuquahockey.org
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
new-life-skin.com new-life-skin.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
newarena.com newarena.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 149 days
newberryobserver.com newberryobserver.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Nov 2019 One Off
newbrunswickhunting.com newbrunswickhunting.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
newsd.co newsd.co
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
newstimes.com newstimes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
nfraidersathletics.com nfraidersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ngoisao.net ngoisao.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
nhs-cougars.com nhs-cougars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nhsgladiatorsathletics.com nhsgladiatorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nilesathletics.com nilesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nissanforums.com nissanforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
nissanmurano.org nissanmurano.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
njblackhawks.com njblackhawks.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
nmk.world nmk.world
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
nnjie.com nnjie.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
nnusc.com nnusc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
nodakoutdoors.com nodakoutdoors.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nolanwritin.com nolanwritin.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
northamerica-news1.com northamerica-news1.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
northwesterntrojans.org northwesterntrojans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
npftv.com npftv.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nsrjhl.com nsrjhl.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
nuklearpower.com nuklearpower.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
nwmounties.com nwmounties.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oakridgeathletics.org oakridgeathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
objectivist.co objectivist.co
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
ochsathletics.com ochsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oclancerathletics.com oclancerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oghspatriots.com oghspatriots.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ohsathletics.org ohsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ohscardinals.com ohscardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ohswolverines.com ohswolverines.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oldnorthbanter.com oldnorthbanter.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
olentangybravesathletics.com olentangybravesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
olentangyorangeathletics.com olentangyorangeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
olmstedfallsathletics.net olmstedfallsathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
omahabryanbears.com omahabryanbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
onebarb.com onebarb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ontarioathletics.org ontarioathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ootyindia.com ootyindia.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Dec 2019 65 days
opelikaathletics.com opelikaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
opslens.com opslens.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 143 days
osbrad.com osbrad.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
ourbeagleworld.com ourbeagleworld.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
oxigeno.com.pe oxigeno.com.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Feb 2020 121 days
pacificwaverider.com pacificwaverider.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
paintbranchathletics.org paintbranchathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
palaciosathletics.com palaciosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
panorama.com.ve panorama.com.ve
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
pantagraph.com pantagraph.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
paolahighschoolathletics.com paolahighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
parenting101.com parenting101.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
patsfans.com patsfans.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
pawofthetiger.com pawofthetiger.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 166 days
rhylanddistrictsundayleague.co.uk rhylanddistrictsundayleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Nov 2019 163 days
rhsfalcons.com rhsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pcactivities.com pcactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pcahsathletics.com pcahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pcpatriotsports.com pcpatriotsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pdhsaztecs.com pdhsaztecs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pdslstoke.co.uk pdslstoke.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
pelhamhighathletics.com pelhamhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pendletonathletics.com pendletonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
riftui.com riftui.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 304 days
rightwingnewshour.com rightwingnewshour.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
rimathleticsactivities.com rimathleticsactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ripewithdecay.com ripewithdecay.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Jan 2020 65 days
perfil.com perfil.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
personalitycafe.com personalitycafe.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
peru21.pe peru21.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
phonesreview.co.uk phonesreview.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 110 days
photorumors.com photorumors.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
phsterrors.org phsterrors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
physicsandmathstutor.com physicsandmathstutor.com
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
pilotmountainnews.com pilotmountainnews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Nov 2019 121 days
pioneerforums.com pioneerforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
piranha-fury.com piranha-fury.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
pjfrfc.co.uk pjfrfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
pleated-jeans.com pleated-jeans.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
plhsfightingpointers.com plhsfightingpointers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
plymouthchristianeagles.com plymouthchristianeagles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pocketpence.co.uk pocketpence.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jul 2019 47 days
podcastrecap.com podcastrecap.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
poe.ninja poe.ninja
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Feb 2020 120 days
poinews.jp poinews.jp
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
pomonareddevilathletics.com pomonareddevilathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
popsci.com popsci.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 48 days
pottervilleathletics.com pottervilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
powerpyx.com powerpyx.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 17 days
practicalandpretty.com practicalandpretty.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
praisedc.com praisedc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
praisephilly.com praisephilly.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
praiserichmond.com praiserichmond.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
prbucksports.com prbucksports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
prcforum.com prcforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
riverforestathletics.com riverforestathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
riverhawkathletics.com riverhawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rittmanathletics.org rittmanathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
premierbaseball.net premierbaseball.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
preservationtalk.com preservationtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
pricepanda.com.ph pricepanda.com.ph
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 109 days
prizegrab.com prizegrab.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 231 days
progolfnow.com progolfnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
ptpanthers.org ptpanthers.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ptwarriors.org ptwarriors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
puntomk2.co.uk puntomk2.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
pwinsiderxtra.com pwinsiderxtra.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
qctimes.com qctimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
quanwu021.com quanwu021.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
quebec4x4.com quebec4x4.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
quebecdoctordirectory.ca quebecdoctordirectory.ca
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
queenscountyminorhockey.com queenscountyminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
qunb.com qunb.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
qysa.ca qysa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 143 days
rabbitathletics.com rabbitathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
radcliffefc.com radcliffefc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
radicallyloved.com radicallyloved.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
radionowindy.com radionowindy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
radiotimes.com radiotimes.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ramonaathletics.com ramonaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
raptorsrapture.com raptorsrapture.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
rawstory.com rawstory.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
rctv.com rctv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 77 days
readdetectiveconan.com readdetectiveconan.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
readfood.co readfood.co
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
readhxh.com readhxh.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
reading-mad.co.uk reading-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
readkingdom.com readkingdom.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 82 days
reallyrawfood.com reallyrawfood.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
redarrowathletics.com redarrowathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
reddevilarmada.com reddevilarmada.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 201 days
reelmama.com reelmama.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Jan 2020 128 days
reference.com reference.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
armfilm.co armfilm.co
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
armslocker.com armslocker.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
rnhl.ca rnhl.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
adrianalately.com adrianalately.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
roeperathletics.org roeperathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rogerbaconspartans.org rogerbaconspartans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rotherhamunited-mad.co.uk rotherhamunited-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Feb 2020 40 days
rothiracryptowallet.com rothiracryptowallet.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 One Off
roxpile.com roxpile.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
rubidouxathletics.com rubidouxathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
rushthekop.com rushthekop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
sabreathletics.org sabreathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
saguaroathletics.com saguaroathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
salud180.com salud180.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 166 days
adrenalease.ca adrenalease.ca
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
saskatoonballhockey.com saskatoonballhockey.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 21 days
saturdaydownsouth.com saturdaydownsouth.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
addatoday.com addatoday.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 12 days
addisonathletics.com addisonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
advicefromatwentysomething.com advicefromatwentysomething.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
screencrush.com screencrush.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
scrigroup.com scrigroup.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 59 days
scroll.in scroll.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
agreatertown.com agreatertown.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
section215.com section215.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
ahomemadeliving.com ahomemadeliving.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
ajhsprospectors.org ajhsprospectors.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
akinseaglessports.com akinseaglessports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sfhsdonsathletics.com sfhsdonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sfchronicle.com sfchronicle.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
sherwoodathletics.org sherwoodathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
shopforyourcause.com shopforyourcause.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
albionrovers-mad.co.uk albionrovers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Feb 2020 206 days
sicemdawgs.com sicemdawgs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
sickchirpse.com sickchirpse.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Aug 2019 21 days
allpar.com allpar.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
allthingsthrifty.com allthingsthrifty.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
amommystory.com amommystory.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
sjajaguars.org sjajaguars.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
amandaclearcreekathletics.com amandaclearcreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
amandajanebrown.com amandajanebrown.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
skidmore-tynanathletics.com skidmore-tynanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
smallbusiness.co.uk smallbusiness.co.uk
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
smallvolvos.com smallvolvos.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
slsforums.com slsforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
smithandwessonforums.com smithandwessonforums.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
smokybike.com smokybike.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 21 days
smhsathletics.com smhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
snathletics.com snathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
smtigers.com smtigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
animanga.es animanga.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
socialanxietysupport.com socialanxietysupport.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
snowflakelobosathletics.com snowflakelobosathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
soapoperaspy.com soapoperaspy.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 103 days
sohh.com sohh.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
sodomojo.com sodomojo.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
sofrep.com sofrep.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
southsideshowdown.com southsideshowdown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
andhrajyothy.com andhrajyothy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
sousvideguy.com sousvideguy.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
southchristiansports.com southchristiansports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
southdearbornathletics.com southdearbornathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
android-x86.org android-x86.org
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
spellcheck.net spellcheck.net
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
spjfl.co.uk spjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 230 days
sportscastr.com sportscastr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 301 days
sportschatplace.com sportschatplace.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jan 2020 234 days
sportslogos.net sportslogos.net
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 45 days
apartmentratings.com apartmentratings.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
sprayberryathletics.com sprayberryathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
springbrookathletics.org springbrookathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
springfieldlocalathletics.com springfieldlocalathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
sputnikmusic.com sputnikmusic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
sravnigama.com.ru sravnigama.com.ru
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
srfalcons.org srfalcons.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ssrfanatic.com ssrfanatic.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
stairwayto11.com stairwayto11.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 153 days
atlallday.com atlallday.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
014837.com 014837.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
1039thedoc.com 1039thedoc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
103gbfrocks.com 103gbfrocks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stitchandunwind.com stitchandunwind.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
1043wowcountry.com 1043wowcountry.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1053rnb.com 1053rnb.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1061evansville.com 1061evansville.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
1075zoofm.com 1075zoofm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
stmaknights.com stmaknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
123telugu.com 123telugu.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 13 days
1390granitecitysports.com 1390granitecitysports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
streameasy.com streameasy.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
ststephensathletics.org ststephensathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
178pjw.com 178pjw.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 58 days
aberdeen-mad.co.uk aberdeen-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Nov 2019 169 days
summervilleathletics.com summervilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
abqjournal.com abqjournal.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Nov 2019 Mar 2020 120 days
sunderland-mad.co.uk sunderland-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 165 days
acidigital.com acidigital.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 212 days
actitudfem.com actitudfem.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
addsomeveg.com addsomeveg.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
afcwimbledon-mad.co.uk afcwimbledon-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Feb 2020 128 days
ahscolts.net ahscolts.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ajfl.org.uk ajfl.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 268 days
alamosanews.com alamosanews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Mar 2020 293 days
swanseatigersathletics.com swanseatigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
albat.com albat.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 213 days
swbulldogs.com swbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
sweepon.com sweepon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 45 days
svha.ca svha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
allfortennessee.com allfortennessee.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
alloverthehill.com alloverthehill.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
amarujalatv.com amarujalatv.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 108 days
szbjq.com szbjq.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
animesonlinebr.site animesonlinebr.site
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 64 days
sztosowe.pl sztosowe.pl
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jul 2019 Jul 2019 One Off
annapolisathletics.com annapolisathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ansonrecord.com ansonrecord.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Nov 2019 Nov 2019 One Off
tabascohoynew.com.mx tabascohoynew.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Mar 2020 70 days
tamilcrowhd.com tamilcrowhd.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
tascosarebels.org tascosarebels.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tattooedmartha.com tattooedmartha.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
tbirdathletics.com tbirdathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tcnathletics.com tcnathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
teamerstg.net teamerstg.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 100 days
arlingtonlionsathletics.com arlingtonlionsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
audioexpert.com audioexpert.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
tellonym.me tellonym.me
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
teleantillas.com.do teleantillas.com.do
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
tenisguru.com tenisguru.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
australiangeographic.com.au australiangeographic.com.au
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
teslegends.pro teslegends.pro
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 50 days
texas4x4.org texas4x4.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
textnow.com textnow.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
tfpdl.online tfpdl.online
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
aveggieventure.com aveggieventure.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
avhshawkathletics.com avhshawkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
thebassbarn.com thebassbarn.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
thebullamarillo.com thebullamarillo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
thecouponingcouple.com thecouponingcouple.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ayalasports.com ayalasports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
thehuskyhaul.com thehuskyhaul.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
thelightnc.com thelightnc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
aztecscricketclub.com aztecscricketclub.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Sep 2019 57 days
baadultsoftball.com baadultsoftball.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
thepewterplank.com thepewterplank.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
babynames.co.uk babynames.co.uk
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
thesixersense.com thesixersense.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
thesurfersview.com thesurfersview.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 292 days
thetandd.com thetandd.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
thetruthaboutcars.com thetruthaboutcars.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
thisisfutbol.com thisisfutbol.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
thscougarsathletics.com thscougarsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tidalfish.com tidalfish.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
tigernet.com tigernet.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 231 days
bamahammer.com bamahammer.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
timberlandathletics.com timberlandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
timeonthewatercanada.com timeonthewatercanada.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
timesleader.com timesleader.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Nov 2019 169 days
timesoccer.com timesoccer.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
timezoff.com timezoff.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
timvandevall.com timvandevall.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tintero.com.ar tintero.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 26 days
tintucbaomoi.com tintucbaomoi.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 19 days
tipchasers.com tipchasers.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Sep 2019 26 days
tkathletics.com tkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
titannationathletics.com titannationathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
titansized.com titansized.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
tivizor.ru tivizor.ru
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
tlzone.net tlzone.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
tmba.ca tmba.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Jul 2019 One Off
toiabarry.com toiabarry.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
tokeofthetown.com tokeofthetown.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
bartleby.com bartleby.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
baseballamerica.com baseballamerica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
baseballpress.com baseballpress.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 181 days
tomahawktake.com tomahawktake.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
batesvilleathletics.com batesvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tools2tiaras.com tools2tiaras.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
top-law-schools.com top-law-schools.com
Attribute Value First Detected Last Detected Overlap Duration
PRIM PRIM-19139 Sep 2019 Jan 2020 130 days
tosaeastathletics.com tosaeastathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
total76ers.com total76ers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalacc.com totalacc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalastros.com totalastros.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalbig10.com totalbig10.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalbuffalobills.com totalbuffalobills.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalcanucks.com totalcanucks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totaldiamondbacks.com totaldiamondbacks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalgeorgiasouthern.com totalgeorgiasouthern.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalnwa.com totalnwa.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalsportswire.com totalsportswire.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
totaluconn.com totaluconn.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
totalwhitesox.com totalwhitesox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bcaquaria.com bcaquaria.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
bcbay.com bcbay.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 62 days
bcpfa.ca bcpfa.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
tpathletics.org tpathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
beartrapsummerfestival.com beartrapsummerfestival.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
tri-townicearena.com tri-townicearena.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Mar 2020 280 days
trib.com trib.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
behindthebuckpass.com behindthebuckpass.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
trollebus.mx trollebus.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
trumanstales.com trumanstales.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
truyencv.com truyencv.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
bereavedandblessed.com bereavedandblessed.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 131 days
tvilleathletics.com tvilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
twingoforum.co.uk twingoforum.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
twinpeakscharteracademyathletics.com twinpeakscharteracademyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
tycsports.com tycsports.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
bet-boom294.com bet-boom294.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
uber-facts.com uber-facts.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
ucclfootball.co.uk ucclfootball.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
uchsathletics.com uchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bethcenterbulldogs.com bethcenterbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
uhnd.com uhnd.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 231 days
uhsathletics.org uhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
uhsutes.com uhsutes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ukulele-tabs.com ukulele-tabs.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
ultimateclassicrock.com ultimateclassicrock.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
bhpbears.com bhpbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bhsathletics.org bhsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bhsbulldogs.com bhsbulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
unlockingkiki.com unlockingkiki.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
upperstclairathletics.com upperstclairathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
usatoday.com usatoday.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
uwants.net uwants.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
uwatchfreetv.online uwatchfreetv.online
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
vahsathletics.com vahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
birdswatcher.com birdswatcher.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
vchsathletics.com vchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
blabber.buzz blabber.buzz
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 49 days
venomstrikes.com venomstrikes.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
black458.com black458.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Feb 2020 66 days
blackandteal.com blackandteal.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
blackhawkup.com blackhawkup.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
blacknews.com blacknews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
blakeathletics.org blakeathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bldaily.com bldaily.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Sep 2019 One Off
vietgiaitri.com vietgiaitri.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
vika-ag.com vika-ag.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
vmhsathletics.com vmhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bluelinestation.com bluelinestation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
bluemanhoop.com bluemanhoop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
vrsz.icu vrsz.icu
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
vwatlasforum.com vwatlasforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
vwvortex.com vwvortex.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
bobcatathletics.org bobcatathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
vtxcafe.com vtxcafe.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
walesveteransfootball.co.uk walesveteransfootball.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 232 days
bogalusalumberjacks.org bogalusalumberjacks.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wallaseyanddistrictsfl.co.uk wallaseyanddistrictsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 232 days
bogiceskating.com bogiceskating.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
boisemusicfestival.com boisemusicfestival.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
bolde.com bolde.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Mar 2020 171 days
wamha.ca wamha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
boltsbythebay.com boltsbythebay.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
bomurl.com bomurl.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
wareshoalsathletics.com wareshoalsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
watchtv24.com watchtv24.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
watch.bz watch.bz
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 296 days
wbktfm.com wbktfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wcbears.com wcbears.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
waverlywarriorsathletics.com waverlywarriorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wawaseeathletics.com wawaseeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wdwmagic.com wdwmagic.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
wealthtl.com wealthtl.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
wearecamdenhs.com wearecamdenhs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
weareccathletics.com weareccathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
bosoxinjection.com bosoxinjection.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
bowiebulldogathletics.com bowiebulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
weboathletics.com weboathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ceceolisa.com ceceolisa.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 66 days
weddbook.com weddbook.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
bradleyathletics.org bradleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
break410.com break410.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
westalbanybulldogs.com westalbanybulldogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
breatheheavy.com breatheheavy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
wfhscoyoteathletics.com wfhscoyoteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
brhsjacketpride.com brhsjacketpride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wheatonknights.com wheatonknights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wheelerwildcatathletics.com wheelerwildcatathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
brighteyedbaker.com brighteyedbaker.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
briha.org briha.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
wicklowleague.com wicklowleague.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jan 2020 232 days
wideopenroads.com wideopenroads.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Sep 2019 Mar 2020 193 days
wildaboutmovies.com wildaboutmovies.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
wildelifecomic.com wildelifecomic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
brokensilenze.net brokensilenze.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
bsfl.co.uk bsfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 274 days
withthefirstpick.com withthefirstpick.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
witl.com witl.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wiveswithknives.net wiveswithknives.net
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
wjathletics.org wjathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wjon.com wjon.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wjpy888.com wjpy888.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
wmtornadoes.com wmtornadoes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
buckeyevalleyathletics.com buckeyevalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wolverhamptonwanderers-mad.co.uk wolverhamptonwanderers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
womansworld.com womansworld.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
buffalo.com buffalo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
buffalonews.com buffalonews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
wordlistresearch.com wordlistresearch.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 16 days
bulldogsathletics.com bulldogsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
worldsoccertalk.com worldsoccertalk.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
wpdh.com wpdh.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
wreckemred.com wreckemred.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
wrestletalk.com wrestletalk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Mar 2020 127 days
wrkr.com wrkr.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 May 2019 One Off
burtonalbion-mad.co.uk burtonalbion-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 78 days
wwd.com wwd.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
wynncash11.com wynncash11.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Nov 2019 65 days
wxcowboys.com wxcowboys.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
buzzypop.com buzzypop.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jun 2019 Jun 2019 One Off
bvbbuzz.com bvbbuzz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 177 days
wycombewanderers-mad.co.uk wycombewanderers-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 May 2019 Feb 2020 260 days
byacoedsoftballtournament.com byacoedsoftballtournament.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
caitlinhoustonblog.com caitlinhoustonblog.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 66 days
xmenfansite.com xmenfansite.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Mar 2020 192 days
xsmn.me xsmn.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 61 days
xuegodroot.xyz xuegodroot.xyz
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 15 days
caneswarning.com caneswarning.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
yalalla.com yalalla.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 15 days
canoodlesoup.com canoodlesoup.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
capacathletics.com capacathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ydsmx.com ydsmx.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
henrycountyathletics.com henrycountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
carolinahuddle.com carolinahuddle.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 55 days
yorkieforum.com yorkieforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
yorktonunitedfc.ca yorktonunitedfc.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
youredm.com youredm.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Feb 2020 91 days
ypff.co.uk ypff.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
ypsigrizzlies.com ypsigrizzlies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
yumgoggle.com yumgoggle.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
yxztalk.com yxztalk.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
cavaliersnation.com cavaliersnation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 322 days
cavemensports.com cavemensports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cavernaathletics.com cavernaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cbcmha.ca cbcmha.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
zarlit.com zarlit.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 125 days
cbwmh.ca cbwmh.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
zeebiz.com zeebiz.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
ncraiders.com ncraiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
zetarepublic.com zetarepublic.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Sep 2019 Mar 2020 190 days
cedarspringsathletics.com cedarspringsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
zodiac168.com zodiac168.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 46 days
zodiacsigns-horoscope.com zodiacsigns-horoscope.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
zone9lacrosse.ca zone9lacrosse.ca
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
cfbstats.com cfbstats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 245 days
checkingcreditcard.com checkingcreditcard.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Sep 2019 One Off
chevelles.com chevelles.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chhshoops.com chhshoops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
my.is my.is
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chicagolandfishing.com chicagolandfishing.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
chmbarockets.com chmbarockets.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 217 days
chscougarathletics.com chscougarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
churchillathletics.com churchillathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cifras.com.br cifras.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Mar 2020 224 days
cincomas.com cincomas.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
clackamasathletics.com clackamasathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
clik.pw clik.pw
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
club4g.org club4g.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
clubtitan.org clubtitan.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
clubvitaleu.com clubvitaleu.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Mar 2020 Mar 2020 One Off
cngsports.ca cngsports.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
cnhockey.com cnhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
coacht.com coacht.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
company.directory company.directory
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-8425488243879801 May 2019 May 2019 One Off
comstockparkathletics.com comstockparkathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
consumersearch.com consumersearch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
coolimba.com coolimba.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 277 days
coolmaterial.com coolmaterial.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
copleyathletics.org copleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cougarnation.us cougarnation.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
covathletics.org covathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
coveralia.com coveralia.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
cowanathletics.com cowanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cpgophers.com cpgophers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cpmha.ca cpmha.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
cronista.com cronista.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Nov 2019 One Off
crossbownation.com crossbownation.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
csgo-stats.com csgo-stats.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 49 days
cssfl.org.uk cssfl.org.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 89 days
cuatro.com cuatro.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
cubaheadlines.com cubaheadlines.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 218 days
cumberlandminorhockey.ca cumberlandminorhockey.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 218 days
curioushistorian.com curioushistorian.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Aug 2019 Aug 2019 9 days
cuyhtsathletics.com cuyhtsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cvhsgrizzlies.net cvhsgrizzlies.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cynspo.com cynspo.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 One Off
cypresscreekathletics.com cypresscreekathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
cypruspiratesathletics.com cypruspiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
deadline.com deadline.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 74 days
deathvalleyvoice.com deathvalleyvoice.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
deilataylor.com deilataylor.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Feb 2020 130 days
dfwrestaurantweek.com dfwrestaurantweek.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Sep 2019 149 days
diabeteshealthpage.com diabeteshealthpage.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Sep 2019 Mar 2020 173 days
diabetesjuntosxti.mx diabetesjuntosxti.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 168 days
nctsharknation.com nctsharknation.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dicksonathletics.com dicksonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dinsta.com dinsta.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
districtondeck.com districtondeck.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
dockathletics.org dockathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
doctorwhowatch.com doctorwhowatch.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
dorksideoftheforce.com dorksideoftheforce.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Jan 2020 65 days
dovermercurysfl.co.uk dovermercurysfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 281 days
downersgrovesouthathletics.com downersgrovesouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dpsstiversathletics.com dpsstiversathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
draftsite.com draftsite.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 42 days
drhsjaguars.com drhsjaguars.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
driffielddistrictafl.co.uk driffielddistrictafl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 281 days
dublinathletics.org dublinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
dublinathletics.us dublinathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ducatimonster.org ducatimonster.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
dukereport.com dukereport.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
dunkingwithwolves.com dunkingwithwolves.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
dutchtownathletics.com dutchtownathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ecathletics.org ecathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
economiahoy.mx economiahoy.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 117 days
ectrojansathletics.com ectrojansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
edetroit.co edetroit.co
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Jun 2019 One Off
edgewaterathletics.com edgewaterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
edgewoodcougarathletics.com edgewoodcougarathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
edinburghcity-mad.co.uk edinburghcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 195 days
edmidentity.com edmidentity.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
eelsathletics.com eelsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
egrfc.com egrfc.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
egthunderbirds.com egthunderbirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ehow.com.br ehow.com.br
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Aug 2019 49 days
eightcount.tv eightcount.tv
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 36 days
einsteinathletics.org einsteinathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ekcowhitecapsfc.co.uk ekcowhitecapsfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Jun 2019 43 days
ekfalcons.com ekfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
elcaminoathletics.org elcaminoathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
elcolombiano.com elcolombiano.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
elcomercio.com elcomercio.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
eldestapeweb.com eldestapeweb.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762769 May 2019 May 2019 One Off
eldiario.com.mx eldiario.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 One Off
elementownersclub.com elementownersclub.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
elkintribune.com elkintribune.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Sep 2019 56 days
ellebeeandco.com ellebeeandco.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Feb 2020 67 days
ellysaysopa.com ellysaysopa.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 131 days
elnacional.com elnacional.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
elnashra.com elnashra.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 106 days
elranchodons.com elranchodons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
eluniverso.com eluniverso.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Mar 2020 Mar 2020 14 days
elwoodpanthers.net elwoodpanthers.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
emailondeck.com emailondeck.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
emmalinebride.com emmalinebride.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
enufh.com enufh.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
epaperlokmat.in epaperlokmat.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
epochtimes.de epochtimes.de
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 55 days
eshsathletics.com eshsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
esnacky.com esnacky.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
espn1420.com espn1420.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
estevanminorhockey.com estevanminorhockey.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Feb 2020 191 days
evanstonathletics.com evanstonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
examveda.com examveda.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Dec 2019 119 days
expatforum.com expatforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
extra.ec extra.ec
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
fabulizemag.com fabulizemag.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 One Off
fadeawayworld.net fadeawayworld.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Aug 2019 One Off
fancycrave.com fancycrave.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 14 days
fcgriffins.com fcgriffins.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
felicidad.com.pe felicidad.com.pe
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Feb 2020 131 days
femalehockeychallenge.com femalehockeychallenge.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
fentonathletics.org fentonathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fextralife.com fextralife.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Aug 2019 Feb 2020 191 days
fiestast.net fiestast.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
fiestast.org fiestast.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
fightingeaglesports.org fightingeaglesports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fightinggobbler.com fightinggobbler.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
filerathletics.com filerathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fishersgateflyersfc.co.uk fishersgateflyersfc.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 95 days
fjcforums.com fjcforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
flameforthought.com flameforthought.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
flickeringmyth.com flickeringmyth.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Sep 2019 One Off
flyershockey.ca flyershockey.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
flywareagle.com flywareagle.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
folsomathletics.com folsomathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
foodmeanderings.com foodmeanderings.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 124 days
footballoutsiders.com footballoutsiders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Sep 2019 Sep 2019 One Off
footballscoop.com footballscoop.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
fordforumsonline.com fordforumsonline.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
forumdaily.com forumdaily.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Mar 2020 45 days
fourfourcrew.com fourfourcrew.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 187 days
fourtitude.com fourtitude.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
frankenmuthathletics.com frankenmuthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
fullmatchesandshows.com fullmatchesandshows.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Oct 2019 One Off
fullydelicious.com fullydelicious.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Mar 2020 Mar 2020 One Off
fun107.com fun107.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
funbrk.com funbrk.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 155 days
funsubstance.com funsubstance.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Nov 2019 One Off
futboltotal.com.mx futboltotal.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Feb 2020 65 days
fvhsathletics.com fvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gadsdencityathletics.com gadsdencityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gaffneyindiansathletics.com gaffneyindiansathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gagadaily.com gagadaily.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 224 days
gamerescape.com gamerescape.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 66 days
gamespew.com gamespew.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 58 days
garawayathletics.com garawayathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gardencityathletics.com gardencityathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gardenersworld.com gardenersworld.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
gatesheadanddistrictsundayleague.co.uk gatesheadanddistrictsundayleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 286 days
geardiary.com geardiary.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Aug 2019 Aug 2019 One Off
gestiopolis.com gestiopolis.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
gifclub.net gifclub.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
gilberttigersathletics.com gilberttigersathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gjhstigers.com gjhstigers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
glacierpilots.com glacierpilots.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
goadamscentralathletics.com goadamscentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gobeavertonbeavers.com gobeavertonbeavers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gobigredknox.com gobigredknox.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goblackshirts.com goblackshirts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goc8.net goc8.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
gocardinalritter.org gocardinalritter.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocelts.com gocelts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gocentralsports.com gocentralsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goclementsfootball.com goclementsfootball.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goclspartans.org goclspartans.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
godinezathletics.com godinezathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goeasterneagles.org goeasterneagles.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gofalconathletics.com gofalconathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gofalconsports.org gofalconsports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goganders.com goganders.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gogetaroomie.com gogetaroomie.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 59 days
gohammondathletics.com gohammondathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goheritage.org goheritage.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gohhshurricanes.com gohhshurricanes.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gohowebulldogs.net gohowebulldogs.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gokennedycavs.com gokennedycavs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
golowcholesterol.com golowcholesterol.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 131 days
gomaroonsathletics.com gomaroonsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gonorthridgevikings.com gonorthridgevikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goodreturns.in goodreturns.in
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
goplymouthathletics.com goplymouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gorajahs.com gorajahs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gorebelsathletics.com gorebelsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
goriversideathletics.com goriversideathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gosabercatsgo.com gosabercatsgo.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
govikingsathletics.com govikingsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gowbmillers.com gowbmillers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gowildcatactivities.com gowildcatactivities.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
gowildcatsathletics.com gowildcatsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
grab4d.net grab4d.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
grubstreet.com grubstreet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 189 days
guacamoley.com guacamoley.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Oct 2019 157 days
guelphknightsbasketball.ca guelphknightsbasketball.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Mar 2020 224 days
guiadecocinafacil.com guiadecocinafacil.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 124 days
guiadelnino.com guiadelnino.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Mar 2020 224 days
guiadelocio.com guiadelocio.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Mar 2020 Mar 2020 One Off
guitarworld.com guitarworld.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Feb 2020 89 days
gunnerforum.com gunnerforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
guyspeed.com guyspeed.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
gwcarversports.com gwcarversports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hadd.world hadd.world
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
halfcrazymama.com halfcrazymama.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Feb 2020 Feb 2020 One Off
halloweenforum.com halloweenforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
hcaeaglessports.org hcaeaglessports.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hcbeavers.net hcbeavers.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hdlivewireforum.com hdlivewireforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
heavy.com heavy.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jun 2019 One Off
helloalbertville.com helloalbertville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloames.com helloames.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloappleton.com helloappleton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloashwaubenon.com helloashwaubenon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellobellgardens.com hellobellgardens.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloberkeley.com helloberkeley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellobigspring.com hellobigspring.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellobrawley.com hellobrawley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloclifton.com helloclifton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloclinton.com helloclinton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellocollegestation.com hellocollegestation.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloeasley.com helloeasley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloedgewater.com helloedgewater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloelpasoderobles.com helloelpasoderobles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloeustis.com helloeustis.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloferndale.com helloferndale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellofountainvalley.com hellofountainvalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellogodfrey.com hellogodfrey.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellograndjunction.com hellograndjunction.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellohaines.com hellohaines.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohibbing.com hellohibbing.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellohuntington.com hellohuntington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellojefferson.com hellojefferson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellojordan.com hellojordan.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
hellojurupavalley.com hellojurupavalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellokernersville.com hellokernersville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Apr 2021 80 days
hellokettering.com hellokettering.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellokirksville.com hellokirksville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellokirkwood.com hellokirkwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolagrange.com hellolagrange.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolakeville.com hellolakeville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellolanghorne.com hellolanghorne.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
helloleaguecity.com helloleaguecity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloleander.com helloleander.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloloveland.com helloloveland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomadisonheights.com hellomadisonheights.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomchenry.com hellomchenry.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellomercerisland.com hellomercerisland.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellonapavalley.com hellonapavalley.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellonationalcity.com hellonationalcity.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellonewbrighton.com hellonewbrighton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellonewzealand.com hellonewzealand.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
hellonoblesville.com hellonoblesville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellonorwood.com hellonorwood.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Jan 2021 Apr 2021 80 days
hellonortonshores.com hellonortonshores.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellooakdale.com hellooakdale.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellooaklawnvillage.com hellooaklawnvillage.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellooakridge.com hellooakridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellooceanside.com hellooceanside.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloofallon.com helloofallon.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloossining.com helloossining.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellopatterson.com hellopatterson.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellophoenix.com hellophoenix.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Apr 2021 2 years, 202 days
helloportales.com helloportales.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloportangeles.com helloportangeles.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloportsainttlucie.com helloportsainttlucie.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Jan 2021 102 days
hellosaintmartin.com hellosaintmartin.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Sep 2018 Jan 2021 2 years, 122 days
hellosanleandro.com hellosanleandro.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
helloseminole.com helloseminole.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosikeston.com hellosikeston.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosomerville.com hellosomerville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellostrongsville.com hellostrongsville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosusanville.com hellosusanville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellosylvania.com hellosylvania.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotaunton.com hellotaunton.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotinleypark.com hellotinleypark.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellotumwater.com hellotumwater.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowashington.com hellowashington.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowestbend.com hellowestbend.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowheeling.com hellowheeling.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowhiteplains.com hellowhiteplains.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hellowoodbridge.com hellowoodbridge.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Nov 2020 Apr 2021 153 days
hellowyoming.com hellowyoming.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-118163407 Oct 2020 Apr 2021 182 days
hemiforum.com hemiforum.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hertsadvertisersundayfl.co.uk hertsadvertisersundayfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 287 days
hexus.net hexus.net
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hhcardinals.com hhcardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hhmvl.com hhmvl.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hhshawksnest.com hhshawksnest.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hhsmustangathletics.org hhsmustangathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hilandathletics.com hilandathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hillgroveathletics.com hillgroveathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
historyrevealed.com historyrevealed.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hitched.ie hitched.ie
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hockeyfights.com hockeyfights.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hockeymineurst-isidore.com hockeymineurst-isidore.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
hondainterceptor.org hondainterceptor.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
hondapioneerforum.com hondapioneerforum.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
hopkinsathletics.com hopkinsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
horizonprimarype.com horizonprimarype.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Oct 2019 159 days
hot963.com hot963.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
houndnation1.com houndnation1.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
howemilitaryathletics.org howemilitaryathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hseroyalsathletics.com hseroyalsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hullcity-mad.co.uk hullcity-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Feb 2020 188 days
humansoftumblr.com humansoftumblr.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 62 days
hwhswildcats.com hwhswildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hyundaiperformance.com hyundaiperformance.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
iadityak.com iadityak.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 61 days
icepop.com icepop.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
ihackmyi.com ihackmyi.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
iheartcats.com iheartcats.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
iheartoldtowneorange.com iheartoldtowneorange.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Feb 2020 126 days
iii911.com iii911.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
ilateral.com ilateral.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Dec 2019 125 days
illianachristianvikings.com illianachristianvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
imagenradio.com.mx imagenradio.com.mx
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
imp.center imp.center
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
impalas.net impalas.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
insidehoops.com insidehoops.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 279 days
insidetheiggles.com insidetheiggles.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
insidetheloudhouse.com insidetheloudhouse.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
inspirationfeed.com inspirationfeed.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Mar 2020 Mar 2020 One Off
instagimg.com instagimg.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 3 days
irctchelp.in irctchelp.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 160 days
irock935.com irock935.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
irtv24.co irtv24.co
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
islwynjuniorleague.co.uk islwynjuniorleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Feb 2020 63 days
izismile.com izismile.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 69 days
jacketathletics.com jacketathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jaginfo.org jaginfo.org
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
jamiiforums.com jamiiforums.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jul 2019 Sep 2019 56 days
jbwstage.com jbwstage.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
jcpatriotsathletics.com jcpatriotsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jeromeathletics.net jeromeathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jeweell.com jeweell.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
jfoot1969.co.uk jfoot1969.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Aug 2019 98 days
jigsawpuzz.com jigsawpuzz.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
jimtownathletics.org jimtownathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jjsoccer.ca jjsoccer.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Feb 2020 126 days
jobtapu.com jobtapu.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 4 days
johnadamsathletics.com johnadamsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
johnmarshallathletics.org johnmarshallathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
joshuaathletics.com joshuaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
juabwasps.com juabwasps.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
jyghxsm.com jyghxsm.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Aug 2019 45 days
kagstv.com kagstv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
kalamazoonow.com kalamazoonow.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kaohoon.com kaohoon.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Feb 2020 One Off
katsfm.com katsfm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kawasakininja1000.com kawasakininja1000.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
kawiforums.com kawiforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
kbxhockey.com kbxhockey.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
kcentv.com kcentv.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 67 days
kckingdom.com kckingdom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
keepingitheel.com keepingitheel.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Jan 2020 Jan 2020 One Off
kentvalleyjfl.co.uk kentvalleyjfl.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 285 days
kffirebirds.com kffirebirds.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kfx450hq.com kfx450hq.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
khppf.com khppf.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 92 days
killerfrogs.com killerfrogs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
king5.com king5.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 62 days
kisscasper.com kisscasper.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
kiwireport.com kiwireport.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Dec 2019 64 days
kizzy-online.com kizzy-online.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Nov 2019 65 days
kmlchargers.com kmlchargers.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
kmmohockey.org kmmohockey.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jun 2019 One Off
knightspride.com knightspride.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ndhsbulldogathletics.com ndhsbulldogathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ndhsrebels.com ndhsrebels.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
koolam.com koolam.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kora-star.tv kora-star.tv
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Oct 2019 62 days
kpopstarz.com kpopstarz.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
krfofm.com krfofm.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Dec 2019 Dec 2019 One Off
kruupdate.com kruupdate.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 91 days
kul.vn kul.vn
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Mar 2020 91 days
kushnercobras.com kushnercobras.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
laacibnet.net laacibnet.net
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Dec 2019 133 days
lady67s.ca lady67s.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Oct 2019 One Off
lalalisette.com lalalisette.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
lancerregister.com lancerregister.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
lapelathletics.com lapelathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
laprensafl.com laprensafl.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Jun 2019 Jul 2019 49 days
larnerfc.com larnerfc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jun 2019 48 days
lasportshub.com lasportshub.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
latestgossipwu.com latestgossipwu.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Mar 2020 30 days
lavilleathletics.com lavilleathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lawfirmofdarrellkeith.net lawfirmofdarrellkeith.net
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Dec 2019 One Off
lchsfalcons.com lchsfalcons.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
leaf.tv leaf.tv
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B May 2019 Aug 2019 98 days
letras.com.br letras.com.br
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Nov 2019 Mar 2020 124 days
lichngaytot.com lichngaytot.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 30 days
lilianbarnett.com lilianbarnett.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Oct 2019 One Off
lindahomeiswheremyheartis.com lindahomeiswheremyheartis.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
lisagcooks.com lisagcooks.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
literock969.com literock969.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
livingmgz.com livingmgz.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Mar 2020 154 days
ljcoyoteathletics.com ljcoyoteathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ljvikings.com ljvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lmshs-lions.com lmshs-lions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
loadoutroom.com loadoutroom.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
logancountyathletics.com logancountyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
logangrizzlies.org logangrizzlies.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
loopjamaica.com loopjamaica.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
loopslu.com loopslu.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
looptt.com looptt.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
losandes.com.ar losandes.com.ar
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
low-riders.com low-riders.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
lqathletics.com lqathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
lsfa.co.uk lsfa.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Feb 2020 237 days
lssgame.com lssgame.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 60 days
luskherald.com luskherald.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Feb 2020 Feb 2020 One Off
lutheranathletics.org lutheranathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
luxelookbook.me luxelookbook.me
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Dec 2019 127 days
lyreka.com lyreka.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
lyricsfeast.com lyricsfeast.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Dec 2019 Dec 2019 One Off
maariv.co.il maariv.co.il
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Mar 2020 215 days
mamasuncut.com mamasuncut.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
manutdtalk.com manutdtalk.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
maroonandwhitenation.com maroonandwhitenation.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
marriagecounselingblog.com marriagecounselingblog.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
masonbulldogsports.com masonbulldogsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mcdonoughathletics.com mcdonoughathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mcintoshathletics.com mcintoshathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mcpharmaceuticals.com mcpharmaceuticals.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
mdchscrusaderathletics.com mdchscrusaderathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mdxers.org mdxers.org
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
meadowcreekathletics.org meadowcreekathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
medcitynews.com medcitynews.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
hellolouisville.com media1.hellolouisville.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 Aug 2020 Aug 2020 One Off
hellowinnipeg.com media1.hellowinnipeg.com
Attribute Value First Detected Last Detected Overlap Duration
UA UA-121239807 Aug 2020 Aug 2020 One Off
megduerksen.com megduerksen.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Sep 2019 Jan 2020 130 days
melanieredd.com melanieredd.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mens6.com mens6.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Dec 2019 Feb 2020 58 days
menstennisforums.com menstennisforums.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
mentalfloss.com mentalfloss.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jul 2019 Jul 2019 One Off
mentertained.com mentertained.com
Attribute Value First Detected Last Detected Overlap Duration
NEX NEX-3391 Jun 2019 Jul 2019 48 days
mghl.ca mghl.ca
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Mar 2020 28 days
mhspolarbearathletics.com mhspolarbearathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
miamidiario.com miamidiario.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Nov 2019 Mar 2020 124 days
midcurrent.com midcurrent.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
milandawgs.com milandawgs.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
milehighmaniac.com milehighmaniac.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
mineralcountyminer.com mineralcountyminer.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Jan 2020 233 days
mkdons-mad.co.uk mkdons-mad.co.uk
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Aug 2019 Aug 2019 One Off
mockingbirdhillcottage.com mockingbirdhillcottage.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Dec 2019 Dec 2019 One Off
modularfords.com modularfords.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
mokkaownersclub.co.uk mokkaownersclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
mommyneedsvodka.com mommyneedsvodka.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
moonareaathletics.com moonareaathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mshstrojanathletics.com mshstrojanathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mtairynews.com mtairynews.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Sep 2019 Sep 2019 One Off
mtmad.es mtmad.es
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Feb 2020 196 days
muathletics.com muathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
muscularmustangs.com muscularmustangs.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
mvmavericks.com mvmavericks.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
mvwildcats.com mvwildcats.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
myha.org myha.org
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Feb 2020 Feb 2020 One Off
nameberry.com nameberry.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
nbaanalysis.net nbaanalysis.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Feb 2020 282 days
nbabite.com nbabite.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 27 days
nbfoa.ca nbfoa.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Oct 2019 Oct 2019 One Off
nbjbhl.com nbjbhl.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 62 days
nelsoncountycardinals.com nelsoncountycardinals.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
netknots.com netknots.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
newstalk955.com newstalk955.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
newsy.com newsy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
newtiburon.com newtiburon.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
nflspinzone.com nflspinzone.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
nhregister.com nhregister.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
ninjah2.org ninjah2.org
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
nlva.net nlva.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 Dec 2019 226 days
nmblacktornadosports.com nmblacktornadosports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
northviewsports.com northviewsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nphswolfpackathletics.com nphswolfpackathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nshahsathletics.com nshahsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nutleyathletics.org nutleyathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
nxownersclub.co.uk nxownersclub.co.uk
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Oct 2019 Oct 2019 One Off
nybass.com nybass.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
nybeachcams.com nybeachcams.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Mar 2020 261 days
oabo.ca oabo.ca
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
ocoeeathletics.com ocoeeathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
odathletics.com odathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
odcsathletics.org odcsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
odemowlathletics.com odemowlathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oglecountylife.com oglecountylife.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
ohsomillennialmom.com ohsomillennialmom.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
ohspiratesathletics.com ohspiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oilonwhyte.com oilonwhyte.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
okemosathletics.net okemosathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
oldielyrics.com oldielyrics.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Mar 2020 175 days
olentangylibertyathletics.com olentangylibertyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
olneycharterathletics.com olneycharterathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
olympiahighschoolathletics.com olympiahighschoolathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
omahanorthvikings.com omahanorthvikings.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
omahanorthwesthuskies.com omahanorthwesthuskies.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
online-filmek.me online-filmek.me
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Feb 2020 Mar 2020 26 days
onlymyhealth.com onlymyhealth.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jul 2019 Jul 2019 One Off
onthebright.com onthebright.com
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Oct 2019 Mar 2020 146 days
onvideo.org onvideo.org
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 210 days
oofu.icu oofu.icu
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
ooyyo.com ooyyo.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Oct 2019 63 days
opencritic.com opencritic.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Mar 2020 146 days
osseo-orioles.com osseo-orioles.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
otroligtbra.se otroligtbra.se
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Aug 2019 One Off
ourlads.com ourlads.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Mar 2020 293 days
ourmidland.com ourmidland.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jun 2019 One Off
ovidelsiesports.com ovidelsiesports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
packslight.com packslight.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Jan 2020 Jan 2020 One Off
passaicvalleyathletics.com passaicvalleyathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pchsathletics.com pchsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pcpitstop.nl pcpitstop.nl
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Jan 2020 Jan 2020 One Off
pcrecordtimes.com pcrecordtimes.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jun 2019 Sep 2019 104 days
pebblebrookathletics.com pebblebrookathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pelicandebrief.com pelicandebrief.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
pembinavalleymha.com pembinavalleymha.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Feb 2020 183 days
pembrokeshireleague.co.uk pembrokeshireleague.co.uk
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Jul 2019 48 days
pflsports.net pflsports.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
phimso1.us phimso1.us
Attribute Value First Detected Last Detected Overlap Duration
PUBM PUBM-158017 Aug 2019 Aug 2019 16 days
phsbulldogsathletics.org phsbulldogsathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pigeons.biz pigeons.biz
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
pikdo.online pikdo.online
Attribute Value First Detected Last Detected Overlap Duration
IEX IEX-189205 Dec 2019 Dec 2019 One Off
pikecentralathletics.com pikecentralathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pikeroadathletics.org pikeroadathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pinckneypiratesathletics.com pinckneypiratesathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pinedaleroundup.com pinedaleroundup.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Aug 2019 Aug 2019 One Off
pirate-4x4.ru pirate-4x4.ru
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Oct 2019 Oct 2019 One Off
pistonpowered.com pistonpowered.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Jan 2020 130 days
pizzabottle.com pizzabottle.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 May 2019 May 2019 One Off
plattepirates.org plattepirates.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
playingfor90.com playingfor90.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Sep 2019 35 days
pleasantonathletics.com pleasantonathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
plymouthathletics.com plymouthathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pmawarriorsathletics.com pmawarriorsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pnop.com pnop.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Jan 2020 65 days
pocketbikeplanet.com pocketbikeplanet.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
poe.trade poe.trade
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 306 days
poeapp.com poeapp.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jan 2020 Mar 2020 79 days
poetsathletics.com poetsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
polarisriders.com polarisriders.com
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
popcarpet.com popcarpet.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 207 days
popupexplorer.com popupexplorer.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
poresto.net poresto.net
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-6748 Jul 2019 Mar 2020 230 days
pottershousepumas.com pottershousepumas.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
powder.com powder.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 210 days
powdersvillepatriotathletics.com powdersvillepatriotathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
powerequipmentforum.com powerequipmentforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
percolatekitchen.com percolatekitchen.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Jan 2020 65 days
predominantlyorange.com predominantlyorange.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Sep 2019 One Off
prhslions.com prhslions.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
priuschat.com priuschat.com
Attribute Value First Detected Last Detected Overlap Duration
AVVID AVVID-7802 Aug 2019 Mar 2020 210 days
prosportsdaily.com prosportsdaily.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
prudentmedia.in prudentmedia.in
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Feb 2020 Feb 2020 One Off
puckprose.com puckprose.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Oct 2019 81 days
pucksofafeather.com pucksofafeather.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
pufferfish.net pufferfish.net
Attribute Value First Detected Last Detected Overlap Duration
SONO SONO-783272317B Nov 2019 Nov 2019 One Off
purcellmarianathletics.org purcellmarianathletics.org
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pvathletics.com pvathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pvhsathletics.com pvhsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
pwcforum.com pwcforum.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Oct 2019 Oct 2019 One Off
pwpodcasts.com pwpodcasts.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 May 2019 Mar 2020 305 days
qmusica.tv qmusica.tv
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Feb 2020 119 days
radaronline.com radaronline.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Mar 2020 224 days
radio.com radio.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Jun 2019 Jul 2019 48 days
radiopup.com radiopup.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
ragalahari.com ragalahari.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Oct 2019 Feb 2020 119 days
rallyontheriverqc.com rallyontheriverqc.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Oct 2019 Oct 2019 One Off
ramforumz.com ramforumz.com
Attribute Value First Detected Last Detected Overlap Duration
AOL AOL-49648 Nov 2019 Nov 2019 One Off
randolphathletics.net randolphathletics.net
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ravallirepublic.com ravallirepublic.com
Attribute Value First Detected Last Detected Overlap Duration
CA CA-PUB-4449341246402301 Mar 2020 Mar 2020 One Off
ravennaathletics.us ravennaathletics.us
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
ravennabulldogsathletics.com ravennabulldogsathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
razorbackers.com razorbackers.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
redanhighathletics.com redanhighathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
redbirdrants.com redbirdrants.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
redrants.com redrants.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
reeths-pufferathletics.com reeths-pufferathletics.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
reportingkc.com reportingkc.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 148 days
reviewingthebrew.com reviewingthebrew.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
rhymejunkie.com rhymejunkie.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
riflehighschoolsports.com riflehighschoolsports.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CU7QPX3O Dec 2019 Dec 2019 One Off
riggosrag.com riggosrag.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Nov 2019 100 days
rihannasnavy.com rihannasnavy.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 148 days
rimfirecentral.com rimfirecentral.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
rinconriders.com rinconriders.com
Attribute Value First Detected Last Detected Overlap Duration
DM DM-100974 Nov 2019 Nov 2019 One Off
rinkroyalty.com rinkroyalty.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Sep 2019 Nov 2019 65 days
risingapple.com risingapple.com
Attribute Value First Detected Last Detected Overlap Duration
FWHL FWHL-762737 Aug 2019 Jan 2020 165 days
rivergrandrapids.com rivergrandrapids.com
Attribute Value First Detected Last Detected Overlap Duration
MEDI MEDI-8CUZ310G2 Nov 2019 Nov 2019 One Off
HELLOFUZHOU.COM
Non IP Attributes
Attribute
UA UA-118163407
Sep 2018 - Apr 2021
GTM GTM-UA-118129358-1
May 2019 - Apr 2021
UA UA-121239807
May 2019 - Aug 2020
UA UA-118129358
Jun 2021 - Sep 2022
AOL AOL-6748
May 2019 - Mar 2020
MEDI MEDI-8CUZ310G2
May 2019 - Mar 2020
SONO SONO-783272317B
May 2019 - Mar 2020
LIJI LIJI-261774
May 2019 - Mar 2020
CONN CONN-102738
May 2019 - Mar 2020
BIDF BIDF-6FF46480-EA5A-4698-934E-7E3979C1D87E
May 2019 - Mar 2020
DM DM-100974
May 2019 - Feb 2020
SVRN SVRN-265277
May 2019 - Feb 2020
PUBM PUBM-158017
Aug 2019 - Mar 2020
AOL AOL-11647
Aug 2019 - Mar 2020
FWHL FWHL-762737
Aug 2019 - Mar 2020
FWHL FWHL-970193
Aug 2019 - Mar 2020
TEAD TEAD-16544
Aug 2019 - Mar 2020
DM DM-101492
Aug 2019 - Mar 2020
ORC ORC-963
Aug 2019 - Mar 2020
TELA TELA-457
Aug 2019 - Mar 2020
AVVID AVVID-7802
Aug 2019 - Mar 2020
YUME YUME-4016333178
Aug 2019 - Mar 2020
GUMG GUMG-13810
Aug 2019 - Mar 2020
PRIM PRIM-19139
Aug 2019 - Mar 2020
GTM GTM-UA-121239807-2
Oct 2019 - Mar 2020
AOL AOL-49648
Oct 2019 - Feb 2020
SVRN SVRN-261774
Dec 2019 - Mar 2020
TREM TREM-J54V6-5C8FF
Dec 2019 - Mar 2020
NEX NEX-3391
May 2019 - Aug 2019
GTM GTM-UA-118163407-2
Sep 2018 - Nov 2018
CA CA-PUB-5369125237996028
Sep 2018 - Nov 2018
CA CA-PUB-9695858187321950
Sep 2018 - Sep 2018
CA CA-PUB-8425488243879801
May 2019 - May 2019
FWHL FWHL-762769
May 2019 - May 2019
ORC ORC-402
May 2019 - May 2019
GTM GTM-AW-804755169
Aug 2019 - Aug 2019
MEDI MEDI-8CU7QPX3O
Dec 2019 - Dec 2019
IEX IEX-189205
Dec 2019 - Dec 2019
CA CA-PUB-4449341246402301
Mar 2020 - Mar 2020
HELLOFUZHOU.COM
IP History

Click the IP addresses to see over domains using them.